Latent transforming growth factor beta binding protein 3

Overview
NameLatent transforming growth factor beta binding protein 3
Smed IDSMED30030168
Length (bp)2626
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Latent transforming growth factor beta binding protein 3 (SMED30030168) t-SNE clustered cells

Violin plots show distribution of expression levels for Latent transforming growth factor beta binding protein 3 (SMED30030168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Latent transforming growth factor beta binding protein 3 (SMED30030168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Latent transforming growth factor beta binding protein 3 (SMED30030168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30030168SMESG000008188.1 dd_Smed_v6_1886_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030168SMESG000008188.1 dd_Smed_v6_1886_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30030168SMESG000008188.1 dd_Smed_v6_1886_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30030168SMESG000008188.1 dd_Smed_v4_1886_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Human
Match: FBN2 (fibrillin 2 [Source:HGNC Symbol;Acc:HGNC:3604])

HSP 1 Score: 193.356 bits (490), Expect = 6.933e-50
Identity = 168/553 (30.38%), Postives = 242/553 (43.76%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDM--------------------------CRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++    C  +  G  L  E CC     AWG PC+RCEL   C +G   I G+ C+D+NEC+ +  +C +G+C+N +GSF C C      D     C+  R ++C  +   + C   +  V        C C  G     + + C K    +Y+                           C+ + P +C +GKC     ++KC CN G+    + ++C   +D C R +  +C +G CV+    + C+C  GY S +   K C  I  C+  P  LC  G C+      ++C C     P+G             E+ P  S ED      DI+ C  S   + C+ G C+NM   Y+C C PG+      Q C            D+     +   CD          +C  S  SY+C C+ GY    DG+ C+DIDEC  NP ICD G C N PG Y+C C+DGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  842 CECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSE-CCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDEC---IHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAF-PGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTD-IDEC-RISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPL-LCRGGTCV-NTEGSFQCDC-----PLGH------------ELSP--SREDCV----DINEC--SLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC-----------TDIDECMIMNGGCDT---------QCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM---KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDE 1337          

HSP 2 Score: 174.866 bits (442), Expect = 5.054e-44
Identity = 159/564 (28.19%), Postives = 247/564 (43.79%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
             C+C  G T    G+ C +I   +C+L      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  +C  GKC N  GSF+C C+S +  D  + +C     +C   P+LCG G+ CV+ +  +  C+C  GY           ++    D C    P +C  G C+    +++C+C  G+  S   + C   ++ C+  + + C NGKCV++   Y C C+ GY ++ DR+ CT I +    +   D QC       YEC C  G+A M  G+ C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+ S+  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C D+DECS     C     C+N+PGSY+C+C +GFT      G  C D +EC E  +LC+NG C N  G+++C+C  G+  ++  + C
Sbjct:  946 HCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECI-HPVPGKFRMDACCCAVGAAWGTECEECP----KPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTD-IDECRISPDLCGSGI-CVN-TPGSFECECFEGYESGFM----MMKNCMDIDECE-RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT-NSEGSYECSCSEGYALMPDGRSCADI--DECENNP-----------------------DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC------DLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIG--NGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGD----GFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSC 1456          

HSP 3 Score: 167.162 bits (422), Expect = 1.509e-41
Identity = 164/614 (26.71%), Postives = 262/614 (42.67%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYR---CECLPGFVLDKQGQACKE--RVEYKT--------NQMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC C PG      G+ C +  +   C+  + +GVC++   G     E CC      +G+PCQ C         G C  G  I +DG  +DINEC     IC +G C N RGS+RC C+S Y+ D    +C+    +C     LC  G+     +  ++ C C PGYV   + ++C   +  + + C          G C  +  ++ CEC+ G   SS G  C  ++                 NG    +  C +L   +      C+ D+       R K   C  +  C+++P  +CP+G+C+      + C C  G    G G+ C  I  +Q                     C+  +  D+C       +   +R   C C  G     + + C +    EY+T            DV +        ++  +F  +C  G+C  +  S++C+CN+G+   ++ + C+DIDEC I+P +C  G C+N+PGS++C CF+G+    M     C D +EC     LC+ G C NT GSFQC C  G+  S  ++DCV + + S          +C+  +  C    G + CSC  G  A  +   C  + +
Sbjct:  648 RCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG--RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCID-IDECLVNRLLCDNGL--CRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVN--------GACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFP-GVCPNGRCV-NSKGSFHCECPEGLTLDGTGRVCLDIRMEQ---------------------CYLKWDEDECIH----PVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMM-MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLS------DNLCR--NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDE 1212          

HSP 4 Score: 138.272 bits (347), Expect = 1.685e-32
Identity = 128/452 (28.32%), Postives = 199/452 (44.03%), Query Frame = 3
Query:  723 QDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQ----------GQACKERVEYKTNQMNDVASSFSLKTQCDK------FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            Q I+ C+  + +C +G+CI    S+RC C+  Y+ D    DC+      E   N C  G DCV+ +  ++ CKC  G+ ++      +KQ+    D C   G  +C  G+C+    +++C CN G+  ++DGK+C    D CT  N  +C NG C++    + C C  G+  + + + CT + +     +C +G CI      + C C PG A    G+                              C  ++ R  C GG    +K        PG V   +          G+ C+      + + + + SS    T   +          +C NG C     SY+C CN+GY+    G+ C DIDEC +N  +CD G C N+PGSY C+C  G+          C D NEC   ++ C NG C+N  GSF C+C+ G   S+    C+
Sbjct:  460 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQD-ANGDCIDVD---ECTSNPCTNG-DCVN-TPGSYYCKCHAGFQRTP-----TKQACIDIDECIQNG-VLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDH-DECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCI-NSEGSFRCDCPPGLAVGMDGR-----------------------------VCVDTHMRSTCYGG----IKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTET--ETCEDINEC--ESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICI 858          

HSP 5 Score: 120.553 bits (301), Expect = 4.994e-27
Identity = 106/414 (25.60%), Postives = 172/414 (41.55%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC-----------------IESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            Q    C+   NLC  G    ++S Y   C+C  GY +  +G                     C  G C+    +Y C+C+ G+  +   ++C   +D C + NGV+C NG+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                        D+D C        C  G CIN +  +RC+C PG  +   G+ C +        M         K  C +          C                  ++ + +   C++G   ++DG+   DI+EC+++P IC  G C N  GSY+C+C  G+       G  C D +EC     LC NG+C+NT GS+ C C  GY+   + + C  + +
Sbjct:  460 QTIDICKHHANLCLNGRCIPTVSSYR--CECNMGYKQDANGDCIDVDECTSNP---------CTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQ-NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE-DGSFKCICKPGFVLAPNGRYCT-----------------------DVDECQTPGI---CMNGHCINSEGSFRCDCPPGLAVGMDGRVCVD------THMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGR---DINECALDPDICANGICENLRGSYRCNCNSGYEPD--ASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINE 822          

HSP 6 Score: 117.857 bits (294), Expect = 3.465e-26
Identity = 121/409 (29.58%), Postives = 177/409 (43.28%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE--IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            RCE   C  G+ +  +G C D++EC  S  C +G C+N  GS+ C C + +Q  P +  C+    +C Q   LC  G  CV+    +  C C  G+  + DGK+C       +D C      +C  G CI +  ++KC C  G++ + +G+ C   VD C      +C NG C++    + C C  G     D + C    D + RS C      G C+ P P    +  C       G G+ C+   +  S    G  SS         DI+ C  +   D C  G C N++  YRC C  G+  D  G+ C +  E   N++                   LC+NG C  +  SY C C  GY    + + C DI+EC  NP  C  G C N+ GS+ C C  G  +
Sbjct:  485 RCE---CNMGYKQDANGDCIDVDECT-SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQNGVLCKNGR-CVNTD-GSFQCICNAGFELTTDGKNCV-----DHDECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTD-VDECQTPG--ICMNGHCINSEGSFRCDCPPGLAVGMDGRVCV---DTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINEC--ALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRL-------------------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNP--CVNGACRNNLGSFNCECSPGSKL 850          

HSP 7 Score: 114.005 bits (284), Expect = 5.013e-25
Identity = 152/609 (24.96%), Postives = 233/609 (38.26%), Query Frame = 3
Query:  684 RCEKGFIEI---DGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKC-EQIPN----------LCGPGMDCVSLS-IYNHLCKCLP--------GYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC----TSIC-----------DLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIG--PTSSNEDSKSSQGD---------------------------------------------IDFCFYSYYRDQCKGGA--CINMK-----NHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVR 2234
            +C+KG+I       +C+  N CQ       G+CI   G  RC C   Y F   Q +   R   C  Q+ N          +C   + C ++   + H C+  P        G++ ++   +C        D C+   P +C  G CI    +++C C  G+  S   + C+  +D C+   G+ C  G+C +    Y C C  GY +S D  +C    T +C           +L  R      QC  +P   +    +P   P+   ++ RR+  D   +G  P S+      + G+                                                   +   D CK  A  C+N +     + YRCEC  G+  D  G                           D+  S  C NG C+ +  SY C+C+ G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +     G  C D +ECT TT++C NG+C N  GSF+C C  G++ +   + C  V        + +   IC   + +C  S G F C CP GL   ++  +C            I   V VR
Sbjct:  132 QCQKGYIGTYCGQPVCE--NGCQ-----NGGRCI---GPNRCACV--YGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQD-----VDECQAI-PGICQGGNCINTVGSFECRCPAGHKQSETTQKCED-IDECSIIPGI-CETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGLVNGRCAQELPGRMT--KMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC----------------------IDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT--DGKNCVDHDECT-TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD-------ECQTPGICM--NGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVR 684          

HSP 8 Score: 97.0561 bits (240), Expect = 9.698e-20
Identity = 85/266 (31.95%), Postives = 118/266 (44.36%), Query Frame = 3
Query:  216 QTVHGESHICGVNENSFVCCSGYRLDSEGDCTIPI--CVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ 989
            Q V    ++CG   +S+ CC G++    G+  I +  C  RC   G C   + CQC  G I + C +                    N G      RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    IC+ G CIN  GSF C C + ++       C +   +C  IP +C  G    S ++ ++ C C  GYV S DG  C  Q
Sbjct:   80 QDVLRGPNVCGSRFHSY-CCPGWKTLPGGNQCIVLQQCSVRCMNGGTCAD-DHCQCQKGYIGTYCGQP------------VCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKC-EDIDECSIIPGICETGE--CSNTVGSYFCVCPRGYVTSTDGSRCIDQ 328          

HSP 9 Score: 85.8853 bits (211), Expect = 2.182e-16
Identity = 92/356 (25.84%), Postives = 148/356 (41.57%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK------------------------------------QSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACK 1586
            E GF+ +   C DI+EC+ + + C+ G C+N  GSF+C C   ++  P + DCV    +C    NLC  G  CV++ I  + C C PGY  + D + C+                                     +S    D C    P +C  G+C      Y+C C  G++AS D K+C   V+ C   N  +C  G+C +    +IC C  GY+       CT +  C++   +      C+  P + ++C C  G+  +G G +C  +    +     S N    ++ G                  D+D C  +   + C+ G C+N+   YRCEC  GF      ++C+
Sbjct: 1114 ESGFMMMKN-CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLCRNG-KCVNM-IGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECE-NNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCID-VNECD-LNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGS-FKCSCREGW--IGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENI--NLCENGQCLNVPGAYRCECEMGFTPASDSRSCQ 1457          

HSP 10 Score: 72.4034 bits (176), Expect = 3.335e-12
Identity = 68/240 (28.33%), Postives = 101/240 (42.08%), Query Frame = 3
Query: 1341 CLPGFAPMGKGKQCRRIMSDQSEI----GPTSSNEDSKSSQGDI-DFCFYSYYRDQCK-GGACINMKNHYRCECLPGFV-----LDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            C PG+  +  G QC  I+  Q  +    G T +++  +  +G I  +C      + C+ GG CI      RC C+ GF       D +   C  +V  +  Q        +    C   G      G   E   +    C  G+  ++    C D+DEC   P IC  G CIN+ GS++C C  G          KC D +EC+    +C+ G C NT GS+ C C  GY++S     C+
Sbjct:   97 CCPGWKTLPGGNQC--IVLQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPN---RCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAW---GHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETT--QKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCI 326          

HSP 11 Score: 62.003 bits (149), Expect = 5.962e-9
Identity = 70/253 (27.67%), Postives = 104/253 (41.11%), Query Frame = 3
Query: 1200 DYICQCDSGYTSSY-DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV--EYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGI 1949
            D  CQC  GY  +Y  +  C + C    R + P+            C C+ GF     G QC R        GP  +  +++  QG +     +  +  C   A I     + CE  P      Q Q C+       +T    DV    ++          +C  G CI +  S++C+C  G++ S   + C DIDECSI P IC+ G C N+ GSY C C  G+       G +C D     + T +C +G+
Sbjct:  128 DDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPN-----------RCACVYGFT----GPQCER----DYRTGPCFTQVNNQMCQGQLTGIVCT--KTLCC--ATIGRAWGHPCEMCP-----AQPQPCRRGFIPNIRTGACQDVDECQAIPG--------ICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTST--DGSRCID-----QRTGMCFSGL 337          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Human
Match: FBN2 (fibrillin 2 [Source:HGNC Symbol;Acc:HGNC:3604])

HSP 1 Score: 192.971 bits (489), Expect = 1.375e-49
Identity = 164/546 (30.04%), Postives = 239/546 (43.77%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGP-------------------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++    C  +  G  L  E CC     AWG PC+RCEL   C +G   I G+ C+D+NEC+ +  +C +G+C+N +GSF C C      D     C+  R ++C  +   + C   +  V        C C  G     + + C K    +Y+        +C  G   A         N+G + +  G+   K ++ C  + G+ C  GKC +    + C+C+SG+    + + CT I  C + P  LC  G C+  P + +EC C  G+ +     K C  I  D+ E  P                      +E S S +  +D    S   + C+ G C+NM   Y+C C PG+      Q C            D+     +   CD          +C  S  SY+C C+ GY    DG+ C+DIDEC  NP ICD G C N PG Y+C C+DGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  875 CECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSE-CCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDEC---IHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYET-------LCPRGAGFA---------NRGDVLT--GRPFYKDINECKAFPGM-CTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISP-DLCGSGICVNTPGS-FECECFEGYESGFMMMKNCMDI--DECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-----------DIDECMIMNGGCDT---------QCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM---KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDE 1370          

HSP 2 Score: 181.03 bits (458), Expect = 8.191e-46
Identity = 172/622 (27.65%), Postives = 267/622 (42.93%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
             C+C  G T    G+ C +I   +C+L      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  +C  GKC N  GSF+C C+S +  D  + +C     +C   P+LCG G+ CV+ +  +  C+C  GY           ++    D C    P +C  G C+    +++C+C  G+  S   + C   ++ C+  + + C NGKCV++   Y C C+ GY ++ DR+ CT I +    +   D QC       YEC C  G+A M  G+ C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+ S+  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C D+DECS     C     C+N+PGSY+C+C +GFT      G  C D +EC E  +LC+NG C N  G+++C+C  G+  ++  + C  + + S Q        IC      C    G+F C C +G +     G C  + +  D
Sbjct:  979 HCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECI-HPVPGKFRMDACCCAVGAAWGTECEECP----KPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTD-IDECRISPDLCGSGI-CVN-TPGSFECECFEGYESGFM----MMKNCMDIDECE-RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT-NSEGSYECSCSEGYALMPDGRSCADI--DECENNP-----------------------DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC------DLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIG--NGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGD----GFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQ-------NICV--FGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD 1538          

HSP 3 Score: 166.777 bits (421), Expect = 2.471e-41
Identity = 163/611 (26.68%), Postives = 260/611 (42.55%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE--RVEYKT--------NQMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC C PG      G+ C +  +   C+  + +GVC++   G     E CC      +G+PCQ C         G C  G  I +DG  +DINEC     IC +G C N RGS+RC C+S Y+ D    +C+    +C     LC  G+     +  ++ C C PGYV   + ++C   +  + + C          G C  +  ++ CEC+ G   SS G  C  ++                 NG    +  C +L   +      C+ D+       R K   C  +  C+++P  +CP+G+C+      + C C  G    G G+ C  I  +Q                     C+  +  D+C        +    C C  G     + + C +    EY+T            DV +        ++  +F  +C  G+C  +  S++C+CN+G+   ++ + C+DIDEC I+P +C  G C+N+PGS++C CF+G+    M     C D +EC     LC+ G C NT GSFQC C  G+  S  ++DCV + + S          +C+  +  C    G + CSC  G  A  +   C  + +
Sbjct:  681 RCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG--RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCID-IDECLVNRLLCDNGL--CRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVN--------GACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFP-GVCPNGRCV-NSKGSFHCECPEGLTLDGTGRVCLDIRMEQ---------------------CYLKWDEDECIHPVPGKFRMDACC-CAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMM-MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLS------DNLCR--NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDE 1245          

HSP 4 Score: 145.976 bits (367), Expect = 8.485e-35
Identity = 172/625 (27.52%), Postives = 241/625 (38.56%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCT-------------------------------------------RYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT-------------SICDLYP--RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF +   G C   P     +K  CC +      WGDPC+ C           C  G   +  +    +D+NEC  S  IC +G+CIN  GSFRC C   Y  D     CV   +    I N CG G  C ++ I +  C C  G+     G   + +  N+        P +C F +C+    +Y+C C  GY    D K CK  +D C                                            R    +C NG+CV++   Y C+C+ G+ SS    +C              +IC +    R+L    +C      G+  +C     P+    Q ++I       GP  + +       DID C      + C  G CIN    +RC C  G+  D  G +C +  E                +Q  K  +++C N     +  SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC    SLC   GIC+NT GSF C+C  G+       +C  V +               +C H C+   G + C CP G
Sbjct: 2080 QCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKC-SVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDEC--SIGNPCGNGT-CTNV-IGSFECNCNEGFEP---GPMMNCEDINECAQ----NPLLCAF-RCMNTFGSYECTCPIGYALREDQKMCKD-LDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCE--LCPLPGTAQYKKICPH----GPGYTTDGR-----DIDEC--KVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDEC---------------SQSPKPCNYICKN-----TEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC-QFLCVNTLGGFTCKCPPGFTQHHT----ACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNH----------RCQHGCQNILGGYRCGCPQG 2642          

HSP 5 Score: 137.117 bits (344), Expect = 4.338e-32
Identity = 128/452 (28.32%), Postives = 199/452 (44.03%), Query Frame = 3
Query:  723 QDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQ----------GQACKERVEYKTNQMNDVASSFSLKTQCDK------FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            Q I+ C+  + +C +G+CI    S+RC C+  Y+ D    DC+      E   N C  G DCV+ +  ++ CKC  G+ ++      +KQ+    D C   G  +C  G+C+    +++C CN G+  ++DGK+C    D CT  N  +C NG C++    + C C  G+  + + + CT + +     +C +G CI      + C C PG A    G+                              C  ++ R  C GG    +K        PG V   +          G+ C+      + + + + SS    T   +          +C NG C     SY+C CN+GY+    G+ C DIDEC +N  +CD G C N+PGSY C+C  G+          C D NEC   ++ C NG C+N  GSF C+C+ G   S+    C+
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQD-ANGDCIDVD---ECTSNPCTNG-DCVN-TPGSYYCKCHAGFQRTP-----TKQACIDIDECIQNG-VLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDH-DECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCI-NSEGSFRCDCPPGLAVGMDGR-----------------------------VCVDTHMRSTCYGG----IKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTET--ETCEDINEC--ESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICI 891          

HSP 6 Score: 136.732 bits (343), Expect = 7.142e-32
Identity = 155/609 (25.45%), Postives = 226/609 (37.11%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLS-RG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC----------------------------------EL-GRCEKG------------------FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK----------CE-QIPNLCGPGMDCVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L    RG   +      G+ +S+  CC +   AWG+PC+ C                                  EL G C+ G                    E   IC+DI+EC     +C  G C N  G++ C+C   Y       +C+  +K           CE ++P      M C + ++                  +  +C  +PG+   +         A   D C+   P +C  G CI    +++CEC  G+  +     C+  +D C+  + +   N  C++    Y C+C +G+  S      DR +C  I ++    LC D Q        Y+C C  GF        C                        D+D C     R  C  G C N    Y C C PGF L               N   D+        +C  F   +C NGRC     S++C CN GY+ + DGK C D +EC   P  C  GTC N  GS++C C  G+ + +      C D NEC E  ++C  G C NT G FQC C  G++ S+  + C   +
Sbjct: 1555 ECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDI-----HTGKAVDIDECKEI-PGICANGVCINQIGSFRCECPTGFSYNDLLLVCED-IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQ------GSYQCICHNGFKASQDQTMCM-----------------------DVDEC----ERHPCGNGTCKNTVGSYNCLCYPGFELTHN------------NDCLDI-------DECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE----NCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR 2100          

HSP 7 Score: 130.954 bits (328), Expect = 3.673e-30
Identity = 147/537 (27.37%), Postives = 216/537 (40.22%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP---------------RSLCP-------------------------DGQC-IPQPNNGYECRC----LPGFAPMGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCN--------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RCE   C  GF +  +G C D NEC +   +C  G C++ +GS++C+C + ++    Q  C+    +CE+ P  CG G    ++  YN  C C PG+  +              D C  +   VC  G+C  +  ++KC CN+GY  + DGK+C  T + C    G   P G C +L   + C C  GY    +     + CD  P               + LCP                         +G+C +P+  N  + +C    +PG    G G  C     D             G   S  D++    D++ C  S     C  G CIN    +RCEC  G+ LD  G  C +  E        + +     T  +  GSF CN                            RC+ +  SY+C C  GY    D K+C D+DEC+     C+     C N  G++ C C  G      P G  C D NEC     +C+NG C N  GS++C+CN G+ SS+   +C+
Sbjct: 1875 RCE---CAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMD-VDECERHP--CGNGTCKNTVGSYN--CLCYPGFELT------HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNE-CVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPG---EGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTRE---DVNECLES--PGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECS------IGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMA--RRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECL 2379          

HSP 8 Score: 122.865 bits (307), Expect = 1.295e-27
Identity = 156/571 (27.32%), Postives = 230/571 (40.28%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR-------------DQCKGGA--------CINMKNHYRCECLPGFVLD----KQGQACKERVEYKTN--------------QMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGG------PKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDT-------EPSKI---------CKKCSHYCKYSN-----GLFVCSCPNGLDAVLETGLCAKVSQ 2189
            E GF+ +   C DI+EC+ + + C+ G C+N  GSF+C C   ++  P + DCV    +C    NLC  G  CV++ I  + C C PGY  + D     +Q     D C           +C     +Y+C C++GY    DG+SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL   ++C  G+C       + C C  G++       C  +  D+ EIG  + N D  +S  +I   F    R             D+C  G         C+N    YRC C  GF  D         C E +    N              +M    +S S   Q     SF  +C  G C      + C C+ GY+    G  C+DIDEC+ +P  C  G C+N+PG Y+C+C   F ++    G        CY +       SL  N           C C+ G    N  + C  V  NS + Y          P+ I         C++    C+  N     G F C CP G     +T +C  + +
Sbjct: 1147 ESGFMMMKN-CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLCRNG-KCVNM-IGTYQCSCNPGYQATPD-----RQGCTDIDECMIMNGGC--DTQCTNSEGSYECSCSEGYALMPDGRSCAD-IDECEN-NPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN-SNICMFGEC-ENTKGSFICHCQLGYSVKKGTTGCTDV--DECEIG--AHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA-DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPV--NSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDE 1695          

HSP 9 Score: 120.168 bits (300), Expect = 8.709e-27
Identity = 106/414 (25.60%), Postives = 172/414 (41.55%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC-----------------IESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            Q    C+   NLC  G    ++S Y   C+C  GY +  +G                     C  G C+    +Y C+C+ G+  +   ++C   +D C + NGV+C NG+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                        D+D C        C  G CIN +  +RC+C PG  +   G+ C +        M         K  C +          C                  ++ + +   C++G   ++DG+   DI+EC+++P IC  G C N  GSY+C+C  G+       G  C D +EC     LC NG+C+NT GS+ C C  GY+   + + C  + +
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYR--CECNMGYKQDANGDCIDVDECTSNP---------CTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQ-NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE-DGSFKCICKPGFVLAPNGRYCT-----------------------DVDEC---QTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVD------THMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGR---DINECALDPDICANGICENLRGSYRCNCNSGYEPD--ASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINE 855          

HSP 10 Score: 117.857 bits (294), Expect = 4.930e-26
Identity = 121/406 (29.80%), Postives = 176/406 (43.35%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE--IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDG 1862
            RCE   C  G+ +  +G C D++EC  S  C +G C+N  GS+ C C + +Q  P +  C+    +C Q   LC  G  CV+    +  C C  G+  + DGK+C       +D C      +C  G CI +  ++KC C  G++ + +G+ C   VD C      +C NG C++    + C C  G     D + C    D + RS C      G C+ P P    +  C       G G+ C+   +  S    G  SS         DI+ C  +   D C  G C N++  YRC C  G+  D  G+ C +  E   N++                   LC+NG C  +  SY C C  GY    + + C DI+EC  NP  C  G C N+ GS+ C C  G
Sbjct:  518 RCE---CNMGYKQDANGDCIDVDECT-SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQNGVLCKNGR-CVNTD-GSFQCICNAGFELTTDGKNCV-----DHDECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTD-VDECQTPG--ICMNGHCINSEGSFRCDCPPGLAVGMDGRVCV---DTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINEC--ALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRL-------------------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNP--CVNGACRNNLGSFNCECSPG 880          

HSP 11 Score: 116.316 bits (290), Expect = 1.178e-25
Identity = 135/519 (26.01%), Postives = 205/519 (39.50%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC---KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQCRRIMSDQS---EIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECS---------------------------------------INPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKY---DTE 2066
            C+DINEC  + +  + +C+N  GS+ C C   Y     Q  C    +  E + +    GM C +L I   +C C PG  +  DG+ C  ++      CR   P +C  G+C+    +Y+CECN+G+ +SS G  C   ++ + F      +        +L     C CD G    +  + C        + +CP G           EC+ +P     G   QC   M       ++G T+  + S +S  D+D C  S     C    C N +  Y+C C  G+VL + G+ CK+  E +T Q N      +    F+ K                +C    S     G C  +  S+ C+C  G+     G  C D+DEC                                         NP+ C   +C N+ GSY+C+C  GF+         C+D NEC+ + + C  G C NT G + C C  GY    +   CVS    +  +Y   DTE
Sbjct: 2251 CEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNL-IGTFMCICPPGMARRPDGEGCVDENE-----CRTK-PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNG---QCINTMGSFRCFCKVGYTT--DISGTSCIDLDEC--SQSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQF--SSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGYYRVGQGH-CVSGMGFNKGQYLSLDTE 2750          

HSP 12 Score: 113.235 bits (282), Expect = 1.262e-24
Identity = 121/472 (25.64%), Postives = 182/472 (38.56%), Query Frame = 3
Query: 1026 PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC----TSIC-----------DLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIG--PTSSNEDSKSSQGD---------------------------------------------IDFCFYSYYRDQCKGGA--CINMK-----NHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVR 2234
            P +C  G CI    +++C C  G+  S   + C+  +D C+   G+ C  G+C +    Y C C  GY +S D  +C    T +C           +L  R      QC  +P   +    +P   P+   ++ RR+  D   +G  P S+      + G+                                                   +   D CK  A  C+N +     + YRCEC  G+  D  G                           D+  S  C NG C+ +  SY C+C+ G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +     G  C D +ECT TT++C NG+C N  GSF+C C  G++ +   + C  V        + +   IC   + +C  S G F C CP GL   ++  +C            I   V VR
Sbjct:  284 PGICQGGNCINTVGSFECRCPAGHKQSETTQKCED-IDECSIIPGI-CETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGLVNGRCAQELPGRMT--KMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC----------------------IDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT--DGKNCVDHDECT-TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD-------ECQTPGICM--NGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVR 717          

HSP 13 Score: 111.694 bits (278), Expect = 3.195e-24
Identity = 120/438 (27.40%), Postives = 173/438 (39.50%), Query Frame = 3
Query:  717 ICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ------------RKKKCEQIPN---------LCGPGMDCVSLS---------IYNHLCKCLPGYVK-------SLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA--PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
             C D+NEC   S IC  G+C N +GSF C C   Y        C                  C  IP            G G+ C+ L            N  C   PG  +       + DG +CS       ++       +C  G+C+     Y+CEC  G+  +SD +SC+  +D C+  N  +C  G C +L   + C CD GY        CT I +      C +G C+  P   YEC C P F   P G G    R+ +   + GP      S +++  +        R  C    C ++   +   CE  P     +    C     ++ N +  +        +C +    LC  G CI +  S+QC+C  GY  S D ++C DIDEC  +P +C  GTC N+ G+Y C C   +   N  GG  C D
Sbjct: 1322 TCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENI------NLCENGQCLNVPGAYRCECEMGFTPASDSRSCQD-IDECSFQN--ICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGR-YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGV-----GVSRSSC----CCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDID---ECQELPG-LCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVN--GGHNCMD 1734          

HSP 14 Score: 110.153 bits (274), Expect = 1.036e-23
Identity = 92/287 (32.06%), Postives = 128/287 (44.60%), Query Frame = 3
Query:  216 QTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ 989
            Q V    ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS+G I+S+C  +                       +                 N G      RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    IC+ G CIN  GSF C C + ++       C +   +C  IP +C  G    S ++ ++ C C  GYV S DG  C  Q
Sbjct:   80 QDVLRGPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKC-EDIDECSIIPGICETGE--CSNTVGSYFCVCPRGYVTSTDGSRCIDQ 361          

HSP 15 Score: 93.2041 bits (230), Expect = 1.748e-18
Identity = 132/533 (24.77%), Postives = 207/533 (38.84%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL--DGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTS--SNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-------RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC----IESGSSYQCQCNT--GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C +GF      C D++EC  +  +C++G+C+N  G++RC C   +        C Q   +C    N+C  G            C  LPG    +  DG    +   N  D+     P  C  G C+     Y+C C   +  +  G  C         + F  R +G +  N +     +   C C  G       + C  +      +LCP G+   P P      +  EC+ LPG     +G  C           P     +ED++  + DID CF   +   C  G C N   +Y C C P ++    G  C +       R    T   N++  + + +  C  +      N  C        + ++  C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++     C D +EC+   +LC +N  C N+ GS++C+C +G+           +  N       E  +I   CSH  C    G + C C NG  A  +  +C  V +
Sbjct: 1436 CSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSC-QDIDEC-SFQNICVFGT-----------CNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC---QGGNCINTFGSFQCECPQGYYLSEDTRICE-DIDECFA--HPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLL--LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF----------KLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDE 1937          

HSP 16 Score: 77.0258 bits (188), Expect = 1.524e-13
Identity = 110/461 (23.86%), Postives = 169/461 (36.66%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQL-SKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC+C  GF    +G  C +   G CF  + + +C        L +K  CC      WG  C+ C L                    Q+ +IC  G                Y  D    D      +C+ +PNLC  G  C++ ++ +  C C  GY   + G SC        D C    P  C++  C     +Y+C C +GY+   DGK+CK   +  T+ +        CV+    + C+C  G+T  +      + C   P      G C   P + + C C  GF+    G  C                        D+D C  ++   +C+ G C N+   YRC C  G++   Q   C +  E                          C +  C  +  SY+C C +G+        C D++ECS + + C+ G C N+ G Y C C  G+
Sbjct: 2362 RCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPL----------------PGTAQYKKICPHGP--------------GYTTDGRDID------ECKVMPNLCTNGQ-CIN-TMGSFRCFCKVGYTTDISGTSCID-----LDECS-QSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC---QFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGS-FSCECQRGFSLDATGLNCE-----------------------DVDECDGNH---RCQHG-CQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNA--------------------CGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGY 2725          

HSP 17 Score: 68.1662 bits (165), Expect = 8.039e-11
Identity = 37/101 (36.63%), Postives = 52/101 (51.49%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            C  G+  ++    C D+DEC   P IC  G CIN+ GS++C C  G          KC D +EC+    +C+ G C NT GS+ C C  GY++S     C+
Sbjct:  261 CRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETT--QKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCI 359          

HSP 18 Score: 64.3142 bits (155), Expect = 1.054e-9
Identity = 82/294 (27.89%), Postives = 126/294 (42.86%), Query Frame = 3
Query: 1077 CECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV--EYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGI 1949
            C C+ G I+S+ G    K++  C+    V C NG   + ++D+ CQC  GY  +Y  +  C + C    R + P+            C C+ GF     G QC R        GP  +  +++  QG +     +  +  C   A I     + CE  P      Q Q C+       +T    DV    ++          +C  G CI +  S++C+C  G++ S   + C DIDECSI P IC+ G C N+ GSY C C  G+       G +C D     + T +C +G+
Sbjct:  130 CTCSSGQISSTCGS---KSIQQCS----VRCMNGG--TCADDH-CQCQKGYIGTYCGQPVCENGCQNGGRCIGPN-----------RCACVYGFT----GPQCER----DYRTGPCFTQVNNQMCQGQLTGIVCT--KTLCC--ATIGRAWGHPCEMCPA-----QPQPCRRGFIPNIRTGACQDVDECQAIPG--------ICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTST--DGSRCID-----QRTGMCFSGL 370          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Human
Match: FBN2 (fibrillin 2 [Source:HGNC Symbol;Acc:HGNC:3604])

HSP 1 Score: 192.971 bits (489), Expect = 1.375e-49
Identity = 164/546 (30.04%), Postives = 239/546 (43.77%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGP-------------------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++    C  +  G  L  E CC     AWG PC+RCEL   C +G   I G+ C+D+NEC+ +  +C +G+C+N +GSF C C      D     C+  R ++C  +   + C   +  V        C C  G     + + C K    +Y+        +C  G   A         N+G + +  G+   K ++ C  + G+ C  GKC +    + C+C+SG+    + + CT I  C + P  LC  G C+  P + +EC C  G+ +     K C  I  D+ E  P                      +E S S +  +D    S   + C+ G C+NM   Y+C C PG+      Q C            D+     +   CD          +C  S  SY+C C+ GY    DG+ C+DIDEC  NP ICD G C N PG Y+C C+DGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  875 CECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSE-CCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDEC---IHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYET-------LCPRGAGFA---------NRGDVLT--GRPFYKDINECKAFPGM-CTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISP-DLCGSGICVNTPGS-FECECFEGYESGFMMMKNCMDI--DECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-----------DIDECMIMNGGCDT---------QCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM---KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDE 1370          

HSP 2 Score: 181.03 bits (458), Expect = 8.191e-46
Identity = 172/622 (27.65%), Postives = 267/622 (42.93%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
             C+C  G T    G+ C +I   +C+L      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  +C  GKC N  GSF+C C+S +  D  + +C     +C   P+LCG G+ CV+ +  +  C+C  GY           ++    D C    P +C  G C+    +++C+C  G+  S   + C   ++ C+  + + C NGKCV++   Y C C+ GY ++ DR+ CT I +    +   D QC       YEC C  G+A M  G+ C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+ S+  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C D+DECS     C     C+N+PGSY+C+C +GFT      G  C D +EC E  +LC+NG C N  G+++C+C  G+  ++  + C  + + S Q        IC      C    G+F C C +G +     G C  + +  D
Sbjct:  979 HCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECI-HPVPGKFRMDACCCAVGAAWGTECEECP----KPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTD-IDECRISPDLCGSGI-CVN-TPGSFECECFEGYESGFM----MMKNCMDIDECE-RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT-NSEGSYECSCSEGYALMPDGRSCADI--DECENNP-----------------------DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC------DLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIG--NGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGD----GFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQ-------NICV--FGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD 1538          

HSP 3 Score: 166.777 bits (421), Expect = 2.471e-41
Identity = 163/611 (26.68%), Postives = 260/611 (42.55%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE--RVEYKT--------NQMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC C PG      G+ C +  +   C+  + +GVC++   G     E CC      +G+PCQ C         G C  G  I +DG  +DINEC     IC +G C N RGS+RC C+S Y+ D    +C+    +C     LC  G+     +  ++ C C PGYV   + ++C   +  + + C          G C  +  ++ CEC+ G   SS G  C  ++                 NG    +  C +L   +      C+ D+       R K   C  +  C+++P  +CP+G+C+      + C C  G    G G+ C  I  +Q                     C+  +  D+C        +    C C  G     + + C +    EY+T            DV +        ++  +F  +C  G+C  +  S++C+CN+G+   ++ + C+DIDEC I+P +C  G C+N+PGS++C CF+G+    M     C D +EC     LC+ G C NT GSFQC C  G+  S  ++DCV + + S          +C+  +  C    G + CSC  G  A  +   C  + +
Sbjct:  681 RCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG--RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCID-IDECLVNRLLCDNGL--CRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVN--------GACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFP-GVCPNGRCV-NSKGSFHCECPEGLTLDGTGRVCLDIRMEQ---------------------CYLKWDEDECIHPVPGKFRMDACC-CAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMM-MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLS------DNLCR--NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDE 1245          

HSP 4 Score: 145.976 bits (367), Expect = 8.485e-35
Identity = 172/625 (27.52%), Postives = 241/625 (38.56%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCT-------------------------------------------RYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT-------------SICDLYP--RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF +   G C   P     +K  CC +      WGDPC+ C           C  G   +  +    +D+NEC  S  IC +G+CIN  GSFRC C   Y  D     CV   +    I N CG G  C ++ I +  C C  G+     G   + +  N+        P +C F +C+    +Y+C C  GY    D K CK  +D C                                            R    +C NG+CV++   Y C+C+ G+ SS    +C              +IC +    R+L    +C      G+  +C     P+    Q ++I       GP  + +       DID C      + C  G CIN    +RC C  G+  D  G +C +  E                +Q  K  +++C N     +  SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC    SLC   GIC+NT GSF C+C  G+       +C  V +               +C H C+   G + C CP G
Sbjct: 2080 QCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKC-SVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDEC--SIGNPCGNGT-CTNV-IGSFECNCNEGFEP---GPMMNCEDINECAQ----NPLLCAF-RCMNTFGSYECTCPIGYALREDQKMCKD-LDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCE--LCPLPGTAQYKKICPH----GPGYTTDGR-----DIDEC--KVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDEC---------------SQSPKPCNYICKN-----TEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC-QFLCVNTLGGFTCKCPPGFTQHHT----ACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNH----------RCQHGCQNILGGYRCGCPQG 2642          

HSP 5 Score: 137.117 bits (344), Expect = 4.338e-32
Identity = 128/452 (28.32%), Postives = 199/452 (44.03%), Query Frame = 3
Query:  723 QDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQ----------GQACKERVEYKTNQMNDVASSFSLKTQCDK------FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            Q I+ C+  + +C +G+CI    S+RC C+  Y+ D    DC+      E   N C  G DCV+ +  ++ CKC  G+ ++      +KQ+    D C   G  +C  G+C+    +++C CN G+  ++DGK+C    D CT  N  +C NG C++    + C C  G+  + + + CT + +     +C +G CI      + C C PG A    G+                              C  ++ R  C GG    +K        PG V   +          G+ C+      + + + + SS    T   +          +C NG C     SY+C CN+GY+    G+ C DIDEC +N  +CD G C N+PGSY C+C  G+          C D NEC   ++ C NG C+N  GSF C+C+ G   S+    C+
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQD-ANGDCIDVD---ECTSNPCTNG-DCVN-TPGSYYCKCHAGFQRTP-----TKQACIDIDECIQNG-VLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDH-DECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCI-NSEGSFRCDCPPGLAVGMDGR-----------------------------VCVDTHMRSTCYGG----IKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTET--ETCEDINEC--ESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICI 891          

HSP 6 Score: 136.732 bits (343), Expect = 7.142e-32
Identity = 155/609 (25.45%), Postives = 226/609 (37.11%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLS-RG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC----------------------------------EL-GRCEKG------------------FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK----------CE-QIPNLCGPGMDCVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L    RG   +      G+ +S+  CC +   AWG+PC+ C                                  EL G C+ G                    E   IC+DI+EC     +C  G C N  G++ C+C   Y       +C+  +K           CE ++P      M C + ++                  +  +C  +PG+   +         A   D C+   P +C  G CI    +++CEC  G+  +     C+  +D C+  + +   N  C++    Y C+C +G+  S      DR +C  I ++    LC D Q        Y+C C  GF        C                        D+D C     R  C  G C N    Y C C PGF L               N   D+        +C  F   +C NGRC     S++C CN GY+ + DGK C D +EC   P  C  GTC N  GS++C C  G+ + +      C D NEC E  ++C  G C NT G FQC C  G++ S+  + C   +
Sbjct: 1555 ECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDI-----HTGKAVDIDECKEI-PGICANGVCINQIGSFRCECPTGFSYNDLLLVCED-IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQ------GSYQCICHNGFKASQDQTMCM-----------------------DVDEC----ERHPCGNGTCKNTVGSYNCLCYPGFELTHN------------NDCLDI-------DECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE----NCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR 2100          

HSP 7 Score: 130.954 bits (328), Expect = 3.673e-30
Identity = 147/537 (27.37%), Postives = 216/537 (40.22%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP---------------RSLCP-------------------------DGQC-IPQPNNGYECRC----LPGFAPMGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCN--------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RCE   C  GF +  +G C D NEC +   +C  G C++ +GS++C+C + ++    Q  C+    +CE+ P  CG G    ++  YN  C C PG+  +              D C  +   VC  G+C  +  ++KC CN+GY  + DGK+C  T + C    G   P G C +L   + C C  GY    +     + CD  P               + LCP                         +G+C +P+  N  + +C    +PG    G G  C     D             G   S  D++    D++ C  S     C  G CIN    +RCEC  G+ LD  G  C +  E        + +     T  +  GSF CN                            RC+ +  SY+C C  GY    D K+C D+DEC+     C+     C N  G++ C C  G      P G  C D NEC     +C+NG C N  GS++C+CN G+ SS+   +C+
Sbjct: 1875 RCE---CAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMD-VDECERHP--CGNGTCKNTVGSYN--CLCYPGFELT------HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNE-CVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPG---EGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTRE---DVNECLES--PGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECS------IGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMA--RRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECL 2379          

HSP 8 Score: 122.865 bits (307), Expect = 1.295e-27
Identity = 156/571 (27.32%), Postives = 230/571 (40.28%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR-------------DQCKGGA--------CINMKNHYRCECLPGFVLD----KQGQACKERVEYKTN--------------QMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGG------PKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDT-------EPSKI---------CKKCSHYCKYSN-----GLFVCSCPNGLDAVLETGLCAKVSQ 2189
            E GF+ +   C DI+EC+ + + C+ G C+N  GSF+C C   ++  P + DCV    +C    NLC  G  CV++ I  + C C PGY  + D     +Q     D C           +C     +Y+C C++GY    DG+SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL   ++C  G+C       + C C  G++       C  +  D+ EIG  + N D  +S  +I   F    R             D+C  G         C+N    YRC C  GF  D         C E +    N              +M    +S S   Q     SF  +C  G C      + C C+ GY+    G  C+DIDEC+ +P  C  G C+N+PG Y+C+C   F ++    G        CY +       SL  N           C C+ G    N  + C  V  NS + Y          P+ I         C++    C+  N     G F C CP G     +T +C  + +
Sbjct: 1147 ESGFMMMKN-CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLCRNG-KCVNM-IGTYQCSCNPGYQATPD-----RQGCTDIDECMIMNGGC--DTQCTNSEGSYECSCSEGYALMPDGRSCAD-IDECEN-NPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN-SNICMFGEC-ENTKGSFICHCQLGYSVKKGTTGCTDV--DECEIG--AHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA-DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPV--NSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDE 1695          

HSP 9 Score: 120.168 bits (300), Expect = 8.709e-27
Identity = 106/414 (25.60%), Postives = 172/414 (41.55%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC-----------------IESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            Q    C+   NLC  G    ++S Y   C+C  GY +  +G                     C  G C+    +Y C+C+ G+  +   ++C   +D C + NGV+C NG+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                        D+D C        C  G CIN +  +RC+C PG  +   G+ C +        M         K  C +          C                  ++ + +   C++G   ++DG+   DI+EC+++P IC  G C N  GSY+C+C  G+       G  C D +EC     LC NG+C+NT GS+ C C  GY+   + + C  + +
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYR--CECNMGYKQDANGDCIDVDECTSNP---------CTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQ-NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE-DGSFKCICKPGFVLAPNGRYCT-----------------------DVDEC---QTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVD------THMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGR---DINECALDPDICANGICENLRGSYRCNCNSGYEPD--ASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINE 855          

HSP 10 Score: 117.857 bits (294), Expect = 4.930e-26
Identity = 121/406 (29.80%), Postives = 176/406 (43.35%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE--IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDG 1862
            RCE   C  G+ +  +G C D++EC  S  C +G C+N  GS+ C C + +Q  P +  C+    +C Q   LC  G  CV+    +  C C  G+  + DGK+C       +D C      +C  G CI +  ++KC C  G++ + +G+ C   VD C      +C NG C++    + C C  G     D + C    D + RS C      G C+ P P    +  C       G G+ C+   +  S    G  SS         DI+ C  +   D C  G C N++  YRC C  G+  D  G+ C +  E   N++                   LC+NG C  +  SY C C  GY    + + C DI+EC  NP  C  G C N+ GS+ C C  G
Sbjct:  518 RCE---CNMGYKQDANGDCIDVDECT-SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQNGVLCKNGR-CVNTD-GSFQCICNAGFELTTDGKNCV-----DHDECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTD-VDECQTPG--ICMNGHCINSEGSFRCDCPPGLAVGMDGRVCV---DTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINEC--ALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRL-------------------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNP--CVNGACRNNLGSFNCECSPG 880          

HSP 11 Score: 116.316 bits (290), Expect = 1.178e-25
Identity = 135/519 (26.01%), Postives = 205/519 (39.50%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC---KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQCRRIMSDQS---EIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECS---------------------------------------INPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKY---DTE 2066
            C+DINEC  + +  + +C+N  GS+ C C   Y     Q  C    +  E + +    GM C +L I   +C C PG  +  DG+ C  ++      CR   P +C  G+C+    +Y+CECN+G+ +SS G  C   ++ + F      +        +L     C CD G    +  + C        + +CP G           EC+ +P     G   QC   M       ++G T+  + S +S  D+D C  S     C    C N +  Y+C C  G+VL + G+ CK+  E +T Q N      +    F+ K                +C    S     G C  +  S+ C+C  G+     G  C D+DEC                                         NP+ C   +C N+ GSY+C+C  GF+         C+D NEC+ + + C  G C NT G + C C  GY    +   CVS    +  +Y   DTE
Sbjct: 2251 CEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNL-IGTFMCICPPGMARRPDGEGCVDENE-----CRTK-PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNG---QCINTMGSFRCFCKVGYTT--DISGTSCIDLDEC--SQSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQF--SSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGYYRVGQGH-CVSGMGFNKGQYLSLDTE 2750          

HSP 12 Score: 113.235 bits (282), Expect = 1.262e-24
Identity = 121/472 (25.64%), Postives = 182/472 (38.56%), Query Frame = 3
Query: 1026 PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC----TSIC-----------DLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIG--PTSSNEDSKSSQGD---------------------------------------------IDFCFYSYYRDQCKGGA--CINMK-----NHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVR 2234
            P +C  G CI    +++C C  G+  S   + C+  +D C+   G+ C  G+C +    Y C C  GY +S D  +C    T +C           +L  R      QC  +P   +    +P   P+   ++ RR+  D   +G  P S+      + G+                                                   +   D CK  A  C+N +     + YRCEC  G+  D  G                           D+  S  C NG C+ +  SY C+C+ G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +     G  C D +ECT TT++C NG+C N  GSF+C C  G++ +   + C  V        + +   IC   + +C  S G F C CP GL   ++  +C            I   V VR
Sbjct:  284 PGICQGGNCINTVGSFECRCPAGHKQSETTQKCED-IDECSIIPGI-CETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGLVNGRCAQELPGRMT--KMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC----------------------IDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT--DGKNCVDHDECT-TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD-------ECQTPGICM--NGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVR 717          

HSP 13 Score: 111.694 bits (278), Expect = 3.195e-24
Identity = 120/438 (27.40%), Postives = 173/438 (39.50%), Query Frame = 3
Query:  717 ICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ------------RKKKCEQIPN---------LCGPGMDCVSLS---------IYNHLCKCLPGYVK-------SLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA--PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
             C D+NEC   S IC  G+C N +GSF C C   Y        C                  C  IP            G G+ C+ L            N  C   PG  +       + DG +CS       ++       +C  G+C+     Y+CEC  G+  +SD +SC+  +D C+  N  +C  G C +L   + C CD GY        CT I +      C +G C+  P   YEC C P F   P G G    R+ +   + GP      S +++  +        R  C    C ++   +   CE  P     +    C     ++ N +  +        +C +    LC  G CI +  S+QC+C  GY  S D ++C DIDEC  +P +C  GTC N+ G+Y C C   +   N  GG  C D
Sbjct: 1322 TCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENI------NLCENGQCLNVPGAYRCECEMGFTPASDSRSCQD-IDECSFQN--ICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGR-YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGV-----GVSRSSC----CCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDID---ECQELPG-LCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVN--GGHNCMD 1734          

HSP 14 Score: 110.153 bits (274), Expect = 1.036e-23
Identity = 92/287 (32.06%), Postives = 128/287 (44.60%), Query Frame = 3
Query:  216 QTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ 989
            Q V    ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS+G I+S+C  +                       +                 N G      RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    IC+ G CIN  GSF C C + ++       C +   +C  IP +C  G    S ++ ++ C C  GYV S DG  C  Q
Sbjct:   80 QDVLRGPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKC-EDIDECSIIPGICETGE--CSNTVGSYFCVCPRGYVTSTDGSRCIDQ 361          

HSP 15 Score: 93.2041 bits (230), Expect = 1.748e-18
Identity = 132/533 (24.77%), Postives = 207/533 (38.84%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL--DGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTS--SNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-------RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC----IESGSSYQCQCNT--GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C +GF      C D++EC  +  +C++G+C+N  G++RC C   +        C Q   +C    N+C  G            C  LPG    +  DG    +   N  D+     P  C  G C+     Y+C C   +  +  G  C         + F  R +G +  N +     +   C C  G       + C  +      +LCP G+   P P      +  EC+ LPG     +G  C           P     +ED++  + DID CF   +   C  G C N   +Y C C P ++    G  C +       R    T   N++  + + +  C  +      N  C        + ++  C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++     C D +EC+   +LC +N  C N+ GS++C+C +G+           +  N       E  +I   CSH  C    G + C C NG  A  +  +C  V +
Sbjct: 1436 CSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSC-QDIDEC-SFQNICVFGT-----------CNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC---QGGNCINTFGSFQCECPQGYYLSEDTRICE-DIDECFA--HPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLL--LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF----------KLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDE 1937          

HSP 16 Score: 77.0258 bits (188), Expect = 1.524e-13
Identity = 110/461 (23.86%), Postives = 169/461 (36.66%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQL-SKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC+C  GF    +G  C +   G CF  + + +C        L +K  CC      WG  C+ C L                    Q+ +IC  G                Y  D    D      +C+ +PNLC  G  C++ ++ +  C C  GY   + G SC        D C    P  C++  C     +Y+C C +GY+   DGK+CK   +  T+ +        CV+    + C+C  G+T  +      + C   P      G C   P + + C C  GF+    G  C                        D+D C  ++   +C+ G C N+   YRC C  G++   Q   C +  E                          C +  C  +  SY+C C +G+        C D++ECS + + C+ G C N+ G Y C C  G+
Sbjct: 2362 RCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPL----------------PGTAQYKKICPHGP--------------GYTTDGRDID------ECKVMPNLCTNGQ-CIN-TMGSFRCFCKVGYTTDISGTSCID-----LDECS-QSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC---QFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGS-FSCECQRGFSLDATGLNCE-----------------------DVDECDGNH---RCQHG-CQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNA--------------------CGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGY 2725          

HSP 17 Score: 68.1662 bits (165), Expect = 8.039e-11
Identity = 37/101 (36.63%), Postives = 52/101 (51.49%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            C  G+  ++    C D+DEC   P IC  G CIN+ GS++C C  G          KC D +EC+    +C+ G C NT GS+ C C  GY++S     C+
Sbjct:  261 CRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETT--QKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCI 359          

HSP 18 Score: 64.3142 bits (155), Expect = 1.054e-9
Identity = 82/294 (27.89%), Postives = 126/294 (42.86%), Query Frame = 3
Query: 1077 CECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV--EYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGI 1949
            C C+ G I+S+ G    K++  C+    V C NG   + ++D+ CQC  GY  +Y  +  C + C    R + P+            C C+ GF     G QC R        GP  +  +++  QG +     +  +  C   A I     + CE  P      Q Q C+       +T    DV    ++          +C  G CI +  S++C+C  G++ S   + C DIDECSI P IC+ G C N+ GSY C C  G+       G +C D     + T +C +G+
Sbjct:  130 CTCSSGQISSTCGS---KSIQQCS----VRCMNGG--TCADDH-CQCQKGYIGTYCGQPVCENGCQNGGRCIGPN-----------RCACVYGFT----GPQCER----DYRTGPCFTQVNNQMCQGQLTGIVCT--KTLCC--ATIGRAWGHPCEMCPA-----QPQPCRRGFIPNIRTGACQDVDECQAIPG--------ICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTST--DGSRCID-----QRTGMCFSGL 370          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Human
Match: FBN3 (fibrillin 3 [Source:HGNC Symbol;Acc:HGNC:18794])

HSP 1 Score: 189.119 bits (479), Expect = 2.158e-48
Identity = 162/551 (29.40%), Postives = 237/551 (43.01%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLS--IYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQ--CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN-------QMNDVASSF------SLKTQCDKFGSFLCNNGR---------CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     +G  C +   G C+L +    C  +  G  L  E CC     AWG PC+RCE+   C +GF  + G+ C D+NEC+ +  +C +G+C+N  GSFRC C      D     CV  R + C      + CG     V+L       +C C  G V  ++ ++C               P    F      G  +    ++ +++   G+   K V+ C  + G+ C +G C +    + C C  G+      + CT I  C + P  LC  G C+  P + +EC C PG+                       S      +  D+D C     RD   C+GG C N    Y+C+C PG  L  +G AC++  E   +       Q  +V  +F        ++  D+ G    N  R         CI +  SY+C C  GY    DG+ C+D+DEC  NP +CDQG C N PG ++C C+DGF     P    C D +EC     +C +G C+NT GSF C C  GY+       C  V +
Sbjct:  831 CKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSE-CCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECG-----VTLPGKYRMDVCCCSIGAVWGVECEACPD-------------PESLEFASLCPRGLGFA---SRDFLS---GRPFYKDVNECKVFPGL-CTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISP-DLCGQGTCVNTPGS-FECECFPGY----------------------ESGFMLMKNCMDVDEC----ARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMA--TPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDE 1325          

HSP 2 Score: 172.17 bits (435), Expect = 5.263e-43
Identity = 164/625 (26.24%), Postives = 252/625 (40.32%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE--------------LGRCEKGFIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCF-----DGFTIH-------------------NMPG-------------GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            RC+C  G     +G+ C ++    CFL      C     G +   ++CC +    WG  C+ C               LG   + F+      +D+NEC+ +  +C  G C N  GSF C C+  +  D  + +C     +C   P+LCG G  CV+ +  +  C+C PGY    +  K+C        D      P +C  G C     +YKC+C  G+  ++ G +C+  +D C+  +G+ CP+G+CV++   + C C +G+ S+ DR+ C  I +   ++   D  CI      Y C C  G++ M  G+ C  +  D+ E  P                         C  G C NM   +RC C  GF+     + C +  E   N                     +C +G C  +  S+ C C  GY        CSD+DEC +    CD   +C+N PGS+ C C      DGF  H                   N+PG             G  C DR+EC E   LC NG C N  G ++C+C  G+  +   + C  V + +          +C   S  C+   G+F C C  G +     G C  +++  D
Sbjct:  935 RCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPG-KYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTD-IDECRISPDLCGQGT-CVN-TPGSFECECFPGYESGFMLMKNCMDVDECARD------PLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACED-IDECSLSDGL-CPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVHCI-NTEGSYRCSCGQGYSLMPDGRACADV--DECEENPRV-----------------------CDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLN-------------------PHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQ-------GNLCAFGS--CENLPGMFRCICNGGYELDRGGGNCTDINECAD 1493          

HSP 3 Score: 152.91 bits (385), Expect = 5.839e-37
Identity = 179/702 (25.50%), Postives = 270/702 (38.46%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYR-LDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXX----------------------XXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDL---YPRSLCPDGQCIPQPNNGYECRCL---------PGFAP---------MGKGKQCRRIMSDQSE------IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            ++CG   +++ CC G+R       C +PIC   CG  G C +PN C C++G +A SC     S  + S  N   CR                         N G      RC C  GF G  C  +   G CF  +    C     GL  +K LCC     AWG PC+ C  +   C +GFI                                          +     Q   +C+ +P LC  G  CV++    H C+C  G+  S    +C   +    +     G  +C  G C     +Y C C+QG+ +S DG         C  Y    C        S  +  +C       Y R++C   CD    +     P+  C P+ +N ++  C          PG  P         MG      R+    S+      +GP +SN  + +    ID C   ++ + C  G C+   + YRCEC  G+  D +G+                          D+  S  C++G C+    +Y C+C  G+QA+   + C D+DEC ++  +C  G C+N+ GS+QC C  GF +   P G  C D NEC  T+++C NG+C N  GSF C C  G++ +     C+ +        + +   IC   + +C  + G F C C  GL    +  +C   
Sbjct:   58 NVCGSRFHAY-CCPGWRTFPGRSQCVVPICRRACGE-GFCSQPNLCTCADGTLAPSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPN----------------------------------------IHTGACQDVDECQAVPGLC-QGGSCVNMVGSFH-CRCPVGHRLSDSSAACEDVN----ECLSLSG--LCSGGDCTNTVGSYVCTCSQGFASSLDGT-------HCLNYRAGAC-------FSVLFGGRCAGDLAGHYTRRQC--CCDRGRCWAAGPVPE-LCPPRGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDIC--RHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGEC----------------------IDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELS--PDGKNCVDHNECA-TSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDID-------ECQTPGICV--NGHCTNTEGSFRCQCLGGLAVGTDGRVCVDT 656          

HSP 4 Score: 144.05 bits (362), Expect = 3.659e-34
Identity = 124/427 (29.04%), Postives = 194/427 (45.43%), Query Frame = 3
Query:  723 QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK--TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSG 1994
            Q I+ C+ ++ +C +G+C+    S+RC C+  Y  D V+ +C+    +C   P   G   DCV++    H C+C PG+  +      ++Q+    D C   G  +CH G+C+    +++C CN G+  S DGK+C   VD        +C NG C++    + C C  G+  +     C  I +     +C +G C       + C+CL G A    G+ C       +  G       ++   G +            K   C    +H       GF    Q    K+  E++    + +  +   +   +C      +C NG C     SY+C CN GY+A   GK C+D+DEC++N  +CD G C NSPGSY CSC  GF  H       C D +EC   +S C +G+C+N  GS+ C+C  G
Sbjct:  449 QTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQD-VRGECID-VDECTSSPCHHG---DCVNIPGTYH-CRCYPGFQATP-----TRQACVDVDECIVSG-GLCHLGRCVNTEGSFQCVCNAGFELSPDGKNC---VDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCT-NTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVT-----------KSECCCANPDH-------GFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINEC-ALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGF--HFWQDTEICKDVDEC--LSSPCVSGVCRNLAGSYTCKCGPG 836          

HSP 5 Score: 143.665 bits (361), Expect = 4.618e-34
Identity = 156/612 (25.49%), Postives = 253/612 (41.34%), Query Frame = 3
Query:  564 LSLSRGVCMKHPYG-------LQLSKELCCGAFQV--AWGDPCQRCEL----------GRCEKGFIE--IDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-----DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER------VEYKTNQMNDVASSFSLKTQC-------DKFGSF--LCNNGRCIESGSSYQCQCNTGYQASL---DGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFD 2210
            + + + VC +H  G         +++++CC ++ +  AW  PC+ C            G    GF+     G   DI+EC +   IC +G CIN+ GSFRC C + + ++ +   C +   +C    + C    DC+++   ++ CKC  GY  S  G    +    +        P VC  G C+    +Y C C++G+ AS+D   C   +D C R     C NG C ++   Y C C  G+  ++     D  +CT++       +C  G C+      + C C  GF     GK C       S  G T      ++ +G                  DID C  S   + C  G C N    ++C C PGFVL   G  C +         ++  + +   +  + KT+C       + +G    LC      E  +++Q  C  G+ A     D +   D++EC+ NP +C  G C+N+ GS++C C  G+++     G  C D +EC+     C  G C N  G F+C C  G+        C  + + S              C+  C  + G ++C+CP G     +  +C  V +  D Q D
Sbjct: 1688 MDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLAC-EDVDECGSRESPCQQNADCINIP-GSYRCKCTRGYKLSPGGACVGRNECREI-------PNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMD-IDECDRQ---PCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVG----QVCRFGHCL-NTAGSFHCLCQDGFELTADGKNCVDTNECLSLAG-TCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDEC--SEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQ----EGSAAFQELCPFGHGAVPGPDDSR--EDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFT--GINCVDTDECS-VGHPCGQGTCTNVIGGFECACADGF-EPGLMMTCEDIDECSLNPL---------LCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQD 2259          

HSP 6 Score: 129.798 bits (325), Expect = 8.253e-30
Identity = 146/592 (24.66%), Postives = 215/592 (36.32%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSL----SRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-----------------------------------GRCEKG------------------FIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKC----------EQIPNLCGPGMDCVSLSI---YNHLCKCLPGYVKSLDGKSCSKQSAN-----------KYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            +G  C +   G CFL        G+      G+ +++  CC +   AWG+PC+ C +                                   G C+ G                    E   IC+DI+EC   S IC  G C N  G++ C+C + Y       +C+  +K             ++       M C S +I   +N  C+  P  +       C  Q+               D C    P +C  G CI    +++CEC  G+  +S   +C+  VD C         N  C+++   Y C+C  GY  S       R +C  I      ++C  G C+      Y C C  GF        C                        DID C     R  C  G C N+   Y C C PGFV+   G      V++                +C      +C  G C+ +  S+ C C  G++ + DGK C D +EC      C  GTC N  GS++C C  GF + +      C D +EC+E  +LC  G C N+ GSFQC C  G++ S+    C   +
Sbjct: 1522 SGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEI-PAICANGICINQIGSFRCECPAGFNYNSILLACED-VDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREI-----PNVCSHGDCM-DTEGSYMCLCHRGFQASADQTLCM-----------------------DIDEC----DRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDC----VDFD---------------ECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQS----DHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTR 2055          

HSP 7 Score: 127.872 bits (320), Expect = 3.892e-29
Identity = 171/668 (25.60%), Postives = 247/668 (36.98%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCELGRCEKGFIEIDGIC--------------QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNG-KCVSLSNDYICQCDSGYTS-SYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQ--SEIGPTSSNEDSKSSQG--------------------------------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD------------NSNQKYD-------TEPSKICK-----KC--------SHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +C C PGF     G  C +     CF     G C   P     +K  CC + +    WGDPC+ C     ++G      +C              +D+NEC  +  +C +G C+N  GSFRC C   Y  D    +CV   +    + + CG G  C ++ I    C C  G+   L        +    D C    P +C F +C     +Y C C  GY    DG  C+  VD C          G +C +L   + C C  G        + CT  + C   P  LC +G+C+      + C C  GF P     +C  I      +E+  T     S SS+                                             D+D C    +   C  G CIN    +RC C  G+  D     C +  E                +Q  K  +FLC N +      S+ C C  GY    DG+ C D+DEC+     C Q  C+N+ G++ C C  GFT H+      C+D +EC+     C  +G C NT GSF+C+C+ G+   +    C  V +            N    Y        T+ S+  +     +C        S  C+ + G F C CP+G D     G C +V +
Sbjct: 2035 QCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSV-PKAFNTTKTRCCCSKRPGEGWGDPCELCP----QEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDEC--SVGHPCGQGT-CTNV-IGGFECACADGFEPGL------MMTCEDIDECSL-NPLLCAF-RCHNTEGSYLCTCPAGYTLREDGAMCRD-VDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQP-DLCVNGRCV-NTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHL--CAHGECINSLGSFRCHCQAGYTPDATATTCLDMDEC---------------SQVPKPCTFLCKNTK-----GSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNC-QFLCVNTVGAFTCRCPPGFTQHHQ----ACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDE 2655          

HSP 8 Score: 125.561 bits (314), Expect = 1.787e-28
Identity = 144/528 (27.27%), Postives = 206/528 (39.02%), Query Frame = 3
Query:  684 RCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR----KKCT--------SICDLYPRS---LCPDG-------------------------QC-IPQPNNGYECRCLPGFAP-MGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSF----------SLKTQCD-----KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPG-GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            +C +G+ +   G C   NEC +   +C  G C++  GS+ CLC   +Q    Q  C+    +C++ P  CG G     +  YN  C C PG+V + +G          +D C      VC FG C+    ++ C C  G+  ++DGK+C  T + C    G   P G C +L   + C C  G+    D      +C+          C   P S   LCP G                         +C +P+  N  + RC     P  G G  C     + S           G     +DS+    D++ C  +     C  G C+N    +RCEC  G+ LD  G  C +  E             +V   F           L   C+          LC   RC  +  SY C C  GY    DG +C D+DEC+     C      C N  G++ C C  G  +  +PG G  C D NEC     LC NG C NT GSF+C C+ G+  S    +C  ++
Sbjct: 1832 KCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMD-IDECDRQP--CGNGTCKNIIGSYN--CLCFPGFVVTHNGD------CVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNE-CLSLAGTCLP-GTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSRE---DVNEC--AENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAF-RCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPG--MRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIR 2338          

HSP 9 Score: 115.546 bits (288), Expect = 2.527e-25
Identity = 136/570 (23.86%), Postives = 224/570 (39.30%), Query Frame = 3
Query:  717 ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP----RSLCPDGQC-IPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYFELFSATDREDFRSKVTTQFNDTVLDK 2348
             C+DI+EC  + +  + +C N  GS+ C C + Y      A C    +  +   +    GM+C +L I    C C PG ++ L G   S +     + C    P +C  G+C+    +++C+C++G+  S     C   +     +  V+    + +S S++ + + +              +C L      R LCP G     +  +  ECR L      G+            + G T   + + ++  D+D C  S     C    C N K  + C C  G++L++ G+ CK+  E  + Q N      +   +F+ +                +C         +G C  +  S++C+C+ G+     G  C D++EC   P  C  G C N  G Y+CSC  GFT H+     +C D NEC  +   C +  C+NT G F+C C SG+        C  V + + ++           CS+ C  + G F+C CP G     + G C           D PD   +    +           S  DR    +    Q N   LD 
Sbjct: 2205 TCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNL-IGTFACVCPPG-MRPLPG---SGEGCTDDNECHAQ-PDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHD-IRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECINSLGSFRCHCQAGYTP--DATATTCLDMDEC--SQVPKPCTF-LCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD-GPHRCQHG-CQNQLGGYRCSCPQGFTQHSQ--WAQCVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRR---------GPCSYSCANTPGGFLCGCPQGYFRAGQ-GHCVSGLGFSPGPQDTPDKEELLS--SEACYECKINGLSPRDRPRRSAHRDHQVNLATLDS 2746          

HSP 10 Score: 114.775 bits (286), Expect = 4.476e-25
Identity = 143/546 (26.19%), Postives = 218/546 (39.93%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI---MSDQSEIGPTSSNEDSKSS------QGDIDFCFYSYYRDQCK-------GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKT----------QCDKFGS-----------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG----TCINSPG----SYQCSCFDGFTIHNM----------------PGGPK---------CYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCP 2138
            C+DI+EC  S  +C  G+C+N  G+F+C C + +Q  P +  CV   +   ++ N  G  + C++    ++ C C  GY    DG++C+       D C    P VC  G C      ++C C  G++A+ D ++C   VD C   N  +C +G C +    ++C C  GY        C+ +  C++   +      C+  P + + CRCLPG+  +G G +C  +   +S +    P     +   S      QG     F+   RD+C         G C+N    YRCEC  GF   +  +AC++  E     +    S  +L            + D+ G              C NG CI +  SY C C   ++ +  G  C D    +      D+G    +C    G       C C  G    N                 PGG             D +EC E   LC+ G C NT+GSFQC+C  GY  S   + C  + + S        S IC   + Y    N  + C CP
Sbjct: 1153 CEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINEC--RVQNG-GCDVHCINTE-GSYRCSCGQGYSLMPDGRACAD-----VDECE-ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVD-VDECD-LNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGS-FSCRCLPGW--VGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTH------SGICGPGTCYNTLGN--YTCVCP 1675          

HSP 11 Score: 114.005 bits (284), Expect = 6.085e-25
Identity = 122/425 (28.71%), Postives = 176/425 (41.41%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMS-DQSEIGPTSSNEDSKSSQG-DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECT 1919
            RCE   C  G+ + + G C D++EC  S  C  G C+N  G++ C C   +Q  P +  CV    +C     LC  G  CV+    +  C C  G+  S DGK+C   +             +C  G C+ +  ++ C C  G++ +  G  C   +D C      +C NG C +    + CQC  G     D + C    D + RS C      G C  P P    +  C       G G+ C+   + D +E     S+    ++ G DI+ C  +   + C  G C N++  YRC C  G+     G+ C +  E   N                   S LC+NG C  S  SY C C  G+    D ++C D+DEC  +P  C  G C N  GSY C C  G  +   P G  C D  + T
Sbjct:  474 RCE---CNVGYTQDVRGECIDVDECT-SSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVD-VDECIVSGGLCHLGR-CVNTE-GSFQCVCNAGFELSPDGKNCVDHNECATST-------MCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMD-IDECQTPG--ICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCV---DTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINEC--ALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALN-------------------SLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSP--CVSGVCRNLAGSYTCKCGPGSRLD--PSGTFCLDSTKGT 853          

HSP 12 Score: 111.309 bits (277), Expect = 4.006e-24
Identity = 110/428 (25.70%), Postives = 169/428 (39.49%), Query Frame = 3
Query: 1005 DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINS-PGS-----------------------------YQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
            D+CR +   +C  G+C+    +Y+CECN GY     G+     VD CT      C +G CV++   Y C+C  G+ ++  R+ C  + + +    LC  G+C+      ++C C  GF     GK C               NE + S+               C  G C+N    + C C PGF+L   G  C +  E +T                      +C NG C  +  S++CQC  G     DG++C D    S      ++G+C    PG+                             +Q  C  G  I          D NEC     +C NG+C+N  GS++C CN GY +    +DC  V + +        S +C   + +C+ S G + CSCP G     +T +C  V + +
Sbjct:  452 DICRHF-TNLCLNGRCLPTPSSYRCECNVGYTQDVRGEC--IDVDECTSS---PCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCV-NTEGSFQCVCNAGFELSPDGKNC------------VDHNECATSTM--------------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQT--------------------PGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITT-----DGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALN------SLLCD--NGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECL 813          

HSP 13 Score: 109.383 bits (272), Expect = 1.826e-23
Identity = 127/496 (25.60%), Postives = 185/496 (37.30%), Query Frame = 3
Query:  720 CQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDID-FCFYSYYRDQ----------------CKGGACINMKNHYRCECLPGFVLDKQGQACKE--------------------------------------RVEYKTNQMNDVASSFSLKTQCDKFGSF--------------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC---KNGICKN 1958
            C D++EC+ + ++C  G C N  G  RCLC   +   P    CV    +C+  P++C  G DC + +  + +C C  GY+       CS       D C   G        C+    ++ C C  G++   DG  C   +D C        P G C+++   Y C C  G+        DR +C    DL     C +GQC+  P  GY C C  GF P    + C+ +  D+   G   +    ++  G     C   Y  D+                C  G CIN    Y C C   F L+  G  C +                                      R      ++  +A++   +T C     F                    LC  G C+ +  S+QC+C  GY  S   ++C DIDECS +  IC  GTC N+ G+Y C C   +   N  GG  C D  +     S+C    NG C+N
Sbjct: 1236 CADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVD-VDECDLNPHICLHG-DCEN-TKGSFVCHCQLGYMVRKGATGCSD-----VDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVG--DGFECHD-LDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDL-----CDNGQCLNAPG-GYRCECEMGFDPTEDHRACQDV--DECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVN--GGNNCMDMRK-----SVCFRHYNGTCQN 1705          

HSP 14 Score: 103.99 bits (258), Expect = 8.005e-22
Identity = 113/426 (26.53%), Postives = 165/426 (38.73%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ--------SANKYDMCRFYGPYVCHFGKCIA----------------DGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSL-CPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C  GF +  DG  C D NEC  S +C +G C+NE GSF CLC   +   P    C+   +   Q P +C  G    + +  +  C+CL G     DG+ C           +  K    R +   V     C A                D   ++  C+ G   ++DG+   +        +  VC NG C +L   Y C C+ GY +    K CT + +    SL C +G C   P + Y C C PGF      + C+                       D+D C  S     C  G C N+   Y C+C PG  LD  G  C +  +  T  +    S   +  Q     S  C            +C+    C  G+ A + G  C D++EC   P +C  G C+N+ GS++C C +G  +
Sbjct:  558 CNAGFELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDEC--QTPGICVNGH--CTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINECA-----LDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGS-YSCSCPPGFHFWQDTEICK-----------------------DVDECLSS----PCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTK-GTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGF-ARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLML 944          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Human
Match: FBN3 (fibrillin 3 [Source:HGNC Symbol;Acc:HGNC:18794])

HSP 1 Score: 188.734 bits (478), Expect = 2.656e-48
Identity = 162/551 (29.40%), Postives = 237/551 (43.01%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLS--IYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQ--CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN-------QMNDVASSF------SLKTQCDKFGSFLCNNGR---------CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     +G  C +   G C+L +    C  +  G  L  E CC     AWG PC+RCE+   C +GF  + G+ C D+NEC+ +  +C +G+C+N  GSFRC C      D     CV  R + C      + CG     V+L       +C C  G V  ++ ++C               P    F      G  +    ++ +++   G+   K V+ C  + G+ C +G C +    + C C  G+      + CT I  C + P  LC  G C+  P + +EC C PG+                       S      +  D+D C     RD   C+GG C N    Y+C+C PG  L  +G AC++  E   +       Q  +V  +F        ++  D+ G    N  R         CI +  SY+C C  GY    DG+ C+D+DEC  NP +CDQG C N PG ++C C+DGF     P    C D +EC     +C +G C+NT GSF C C  GY+       C  V +
Sbjct:  789 CKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSE-CCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECG-----VTLPGKYRMDVCCCSIGAVWGVECEACPD-------------PESLEFASLCPRGLGFA---SRDFLS---GRPFYKDVNECKVFPGL-CTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISP-DLCGQGTCVNTPGS-FECECFPGY----------------------ESGFMLMKNCMDVDEC----ARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMA--TPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDE 1283          

HSP 2 Score: 172.17 bits (435), Expect = 5.522e-43
Identity = 164/625 (26.24%), Postives = 252/625 (40.32%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE--------------LGRCEKGFIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCF-----DGFTIH-------------------NMPG-------------GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            RC+C  G     +G+ C ++    CFL      C     G +   ++CC +    WG  C+ C               LG   + F+      +D+NEC+ +  +C  G C N  GSF C C+  +  D  + +C     +C   P+LCG G  CV+ +  +  C+C PGY    +  K+C        D      P +C  G C     +YKC+C  G+  ++ G +C+  +D C+  +G+ CP+G+CV++   + C C +G+ S+ DR+ C  I +   ++   D  CI      Y C C  G++ M  G+ C  +  D+ E  P                         C  G C NM   +RC C  GF+     + C +  E   N                     +C +G C  +  S+ C C  GY        CSD+DEC +    CD   +C+N PGS+ C C      DGF  H                   N+PG             G  C DR+EC E   LC NG C N  G ++C+C  G+  +   + C  V + +          +C   S  C+   G+F C C  G +     G C  +++  D
Sbjct:  893 RCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPG-KYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTD-IDECRISPDLCGQGT-CVN-TPGSFECECFPGYESGFMLMKNCMDVDECARD------PLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACED-IDECSLSDGL-CPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVHCI-NTEGSYRCSCGQGYSLMPDGRACADV--DECEENPRV-----------------------CDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLN-------------------PHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQ-------GNLCAFGS--CENLPGMFRCICNGGYELDRGGGNCTDINECAD 1451          

HSP 3 Score: 148.288 bits (373), Expect = 1.455e-35
Identity = 164/608 (26.97%), Postives = 231/608 (37.99%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYR-LDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXX----------------------XXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADC-------------------------VQRKKKCEQ--------IPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG-KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            ++CG   +++ CC G+R       C +PIC   CG  G C +PN C C++G +A SC     S  + S  N   CR                         N G      RC C  GF G  C  +   G CF  +    C     GL  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G C+N  GSF C C   ++     A C                          +R+  C++        +P LC P        +       LPG+     G            M    GP      +    G + +   + G   S+ G  +  +T+D C  +   +C NG+C+   + Y C+C+ GYT    R +C  + D    S C  G C+  P   Y CRC PGF      + C                        D+D C  S     C  G C+N +  ++C C  GF L   G+ C +  E  T+ M                    C NG C+    S+ C C  G+  +  G  C DIDEC   P IC  G C N+ GS++C C  G  +
Sbjct:   58 NVCGSRFHAY-CCPGWRTFPGRSQCVVPICRRACGE-GFCSQPNLCTCADGTLAPSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLFPG----LLGFGSNGMGPPLGP-----ARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICRHFTN-LCLNGRCLPTPSSYRCECNVGYTQDV-RGECIDV-DECTSSPCHHGDCVNIPGT-YHCRCYPGFQATPTRQACV-----------------------DVDECIVS--GGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTM--------------------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQ-TPGICVNGHCTNTEGSFRCQCLGGLAV 604          

HSP 4 Score: 143.665 bits (361), Expect = 4.560e-34
Identity = 124/427 (29.04%), Postives = 194/427 (45.43%), Query Frame = 3
Query:  723 QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK--TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSG 1994
            Q I+ C+ ++ +C +G+C+    S+RC C+  Y  D V+ +C+    +C   P   G   DCV++    H C+C PG+  +      ++Q+    D C   G  +CH G+C+    +++C CN G+  S DGK+C   VD        +C NG C++    + C C  G+  +     C  I +     +C +G C       + C+CL G A    G+ C       +  G       ++   G +            K   C    +H       GF    Q    K+  E++    + +  +   +   +C      +C NG C     SY+C CN GY+A   GK C+D+DEC++N  +CD G C NSPGSY CSC  GF  H       C D +EC   +S C +G+C+N  GS+ C+C  G
Sbjct:  407 QTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQD-VRGECID-VDECTSSPCHHG---DCVNIPGTYH-CRCYPGFQATP-----TRQACVDVDECIVSG-GLCHLGRCVNTEGSFQCVCNAGFELSPDGKNC---VDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCT-NTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVT-----------KSECCCANPDH-------GFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINEC-ALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGF--HFWQDTEICKDVDEC--LSSPCVSGVCRNLAGSYTCKCGPG 794          

HSP 5 Score: 143.665 bits (361), Expect = 5.190e-34
Identity = 156/612 (25.49%), Postives = 253/612 (41.34%), Query Frame = 3
Query:  564 LSLSRGVCMKHPYG-------LQLSKELCCGAFQV--AWGDPCQRCEL----------GRCEKGFIE--IDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-----DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER------VEYKTNQMNDVASSFSLKTQC-------DKFGSF--LCNNGRCIESGSSYQCQCNTGYQASL---DGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFD 2210
            + + + VC +H  G         +++++CC ++ +  AW  PC+ C            G    GF+     G   DI+EC +   IC +G CIN+ GSFRC C + + ++ +   C +   +C    + C    DC+++   ++ CKC  GY  S  G    +    +        P VC  G C+    +Y C C++G+ AS+D   C   +D C R     C NG C ++   Y C C  G+  ++     D  +CT++       +C  G C+      + C C  GF     GK C       S  G T      ++ +G                  DID C  S   + C  G C N    ++C C PGFVL   G  C +         ++  + +   +  + KT+C       + +G    LC      E  +++Q  C  G+ A     D +   D++EC+ NP +C  G C+N+ GS++C C  G+++     G  C D +EC+     C  G C N  G F+C C  G+        C  + + S              C+  C  + G ++C+CP G     +  +C  V +  D Q D
Sbjct: 1646 MDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLAC-EDVDECGSRESPCQQNADCINIP-GSYRCKCTRGYKLSPGGACVGRNECREI-------PNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMD-IDECDRQ---PCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVG----QVCRFGHCL-NTAGSFHCLCQDGFELTADGKNCVDTNECLSLAG-TCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDEC--SEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQ----EGSAAFQELCPFGHGAVPGPDDSR--EDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFT--GINCVDTDECS-VGHPCGQGTCTNVIGGFECACADGF-EPGLMMTCEDIDECSLNPL---------LCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQD 2217          

HSP 6 Score: 129.798 bits (325), Expect = 9.037e-30
Identity = 146/592 (24.66%), Postives = 215/592 (36.32%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSL----SRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-----------------------------------GRCEKG------------------FIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKC----------EQIPNLCGPGMDCVSLSI---YNHLCKCLPGYVKSLDGKSCSKQSAN-----------KYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            +G  C +   G CFL        G+      G+ +++  CC +   AWG+PC+ C +                                   G C+ G                    E   IC+DI+EC   S IC  G C N  G++ C+C + Y       +C+  +K             ++       M C S +I   +N  C+  P  +       C  Q+               D C    P +C  G CI    +++CEC  G+  +S   +C+  VD C         N  C+++   Y C+C  GY  S       R +C  I      ++C  G C+      Y C C  GF        C                        DID C     R  C  G C N+   Y C C PGFV+   G      V++                +C      +C  G C+ +  S+ C C  G++ + DGK C D +EC      C  GTC N  GS++C C  GF + +      C D +EC+E  +LC  G C N+ GSFQC C  G++ S+    C   +
Sbjct: 1480 SGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEI-PAICANGICINQIGSFRCECPAGFNYNSILLACED-VDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREI-----PNVCSHGDCM-DTEGSYMCLCHRGFQASADQTLCM-----------------------DIDEC----DRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDC----VDFD---------------ECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQS----DHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTR 2013          

HSP 7 Score: 127.487 bits (319), Expect = 4.723e-29
Identity = 171/668 (25.60%), Postives = 247/668 (36.98%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCELGRCEKGFIEIDGIC--------------QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNG-KCVSLSNDYICQCDSGYTS-SYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQ--SEIGPTSSNEDSKSSQG--------------------------------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD------------NSNQKYD-------TEPSKICK-----KC--------SHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +C C PGF     G  C +     CF     G C   P     +K  CC + +    WGDPC+ C     ++G      +C              +D+NEC  +  +C +G C+N  GSFRC C   Y  D    +CV   +    + + CG G  C ++ I    C C  G+   L        +    D C    P +C F +C     +Y C C  GY    DG  C+  VD C          G +C +L   + C C  G        + CT  + C   P  LC +G+C+      + C C  GF P     +C  I      +E+  T     S SS+                                             D+D C    +   C  G CIN    +RC C  G+  D     C +  E                +Q  K  +FLC N +      S+ C C  GY    DG+ C D+DEC+     C Q  C+N+ G++ C C  GFT H+      C+D +EC+     C  +G C NT GSF+C+C+ G+   +    C  V +            N    Y        T+ S+  +     +C        S  C+ + G F C CP+G D     G C +V +
Sbjct: 1993 QCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSV-PKAFNTTKTRCCCSKRPGEGWGDPCELCP----QEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDEC--SVGHPCGQGT-CTNV-IGGFECACADGFEPGL------MMTCEDIDECSL-NPLLCAF-RCHNTEGSYLCTCPAGYTLREDGAMCRD-VDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQP-DLCVNGRCV-NTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHL--CAHGECINSLGSFRCHCQAGYTPDATATTCLDMDEC---------------SQVPKPCTFLCKNTK-----GSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNC-QFLCVNTVGAFTCRCPPGFTQHHQ----ACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDE 2613          

HSP 8 Score: 125.176 bits (313), Expect = 2.186e-28
Identity = 144/528 (27.27%), Postives = 206/528 (39.02%), Query Frame = 3
Query:  684 RCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR----KKCT--------SICDLYPRS---LCPDG-------------------------QC-IPQPNNGYECRCLPGFAP-MGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSF----------SLKTQCD-----KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPG-GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            +C +G+ +   G C   NEC +   +C  G C++  GS+ CLC   +Q    Q  C+    +C++ P  CG G     +  YN  C C PG+V + +G          +D C      VC FG C+    ++ C C  G+  ++DGK+C  T + C    G   P G C +L   + C C  G+    D      +C+          C   P S   LCP G                         +C +P+  N  + RC     P  G G  C     + S           G     +DS+    D++ C  +     C  G C+N    +RCEC  G+ LD  G  C +  E             +V   F           L   C+          LC   RC  +  SY C C  GY    DG +C D+DEC+     C      C N  G++ C C  G  +  +PG G  C D NEC     LC NG C NT GSF+C C+ G+  S    +C  ++
Sbjct: 1790 KCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMD-IDECDRQP--CGNGTCKNIIGSYN--CLCFPGFVVTHNGD------CVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNE-CLSLAGTCLP-GTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSRE---DVNEC--AENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAF-RCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPG--MRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIR 2296          

HSP 9 Score: 115.161 bits (287), Expect = 2.913e-25
Identity = 136/570 (23.86%), Postives = 224/570 (39.30%), Query Frame = 3
Query:  717 ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP----RSLCPDGQC-IPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYFELFSATDREDFRSKVTTQFNDTVLDK 2348
             C+DI+EC  + +  + +C N  GS+ C C + Y      A C    +  +   +    GM+C +L I    C C PG ++ L G   S +     + C    P +C  G+C+    +++C+C++G+  S     C   +     +  V+    + +S S++ + + +              +C L      R LCP G     +  +  ECR L      G+            + G T   + + ++  D+D C  S     C    C N K  + C C  G++L++ G+ CK+  E  + Q N      +   +F+ +                +C         +G C  +  S++C+C+ G+     G  C D++EC   P  C  G C N  G Y+CSC  GFT H+     +C D NEC  +   C +  C+NT G F+C C SG+        C  V + + ++           CS+ C  + G F+C CP G     + G C           D PD   +    +           S  DR    +    Q N   LD 
Sbjct: 2163 TCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNL-IGTFACVCPPG-MRPLPG---SGEGCTDDNECHAQ-PDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHD-IRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECINSLGSFRCHCQAGYTP--DATATTCLDMDEC--SQVPKPCTF-LCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD-GPHRCQHG-CQNQLGGYRCSCPQGFTQHSQ--WAQCVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRR---------GPCSYSCANTPGGFLCGCPQGYFRAGQ-GHCVSGLGFSPGPQDTPDKEELLS--SEACYECKINGLSPRDRPRRSAHRDHQVNLATLDS 2704          

HSP 10 Score: 114.39 bits (285), Expect = 5.029e-25
Identity = 143/546 (26.19%), Postives = 216/546 (39.56%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI---MSDQSEIGPTSSNEDSKSS------QGDIDFCFYSYYRDQCK-------GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKT----------QCDKFGS-----------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG----TCINSPG----SYQCSCFDGFTIHNM----------------PGGPK---------CYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCP 2138
            C+DI+EC  S  +C  G+C+N  G+F+C C + +Q  P +  CV    +C      C   + C++    ++ C C  GY    DG++C+       D C    P VC  G C      ++C C  G++A+ D ++C   VD C   N  +C +G C +    ++C C  GY        C+ +  C++   +      C+  P + + CRCLPG+  +G G +C  +   +S +    P     +   S      QG     F+   RD+C         G C+N    YRCEC  GF   +  +AC++  E     +    S  +L            + D+ G              C NG CI +  SY C C   ++ +  G  C D    +      D+G    +C    G       C C  G    N                 PGG             D +EC E   LC+ G C NT+GSFQC+C  GY  S   + C  + + S        S IC   + Y    N  + C CP
Sbjct: 1111 CEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVD-INECRVQNGGCD--VHCINTE-GSYRCSCGQGYSLMPDGRACAD-----VDECE-ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVD-VDECD-LNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGS-FSCRCLPGW--VGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTH------SGICGPGTCYNTLGN--YTCVCP 1633          

HSP 11 Score: 114.005 bits (284), Expect = 7.445e-25
Identity = 113/457 (24.73%), Postives = 185/457 (40.48%), Query Frame = 3
Query:  894 GMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDL---YPRSLCPDGQCIPQPNNGYECRCL---------PGFAP---------MGKGKQCRRIMSDQSE------IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            G+ C       H C+   G++ ++   +C        D C+   P +C  G C+    ++ C C  G+  S    +C+        Y    C        S  +  +C       Y R++C   CD    +     P+  C P+ +N ++  C          PG  P         MG      R+    S+      +GP +SN  + +    ID C   ++ + C  G C+   + YRCEC  G+  D +G+                          D+  S  C++G C+    +Y C+C  G+QA+   + C D+DEC ++  +C  G C+N+ GS+QC C  GF +   P G  C D NEC  T+++C NG+C N  GSF C C  G++ +     C+ +        + +   IC   + +C  + G F C C  GL    +  +C   
Sbjct:  219 GLPCELCPAQPHPCR--RGFIPNIHTGAC-----QDVDECQAV-PGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACED-------YRAGAC-------FSVLFGGRCAGDLAGHYTRRQC--CCDRGRCWAAGPVPE-LCPPRGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDIC--RHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGEC----------------------IDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELS--PDGKNCVDHNECA-TSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDID-------ECQTPGICV--NGHCTNTEGSFRCQCLGGLAVGTDGRVCVDT 614          

HSP 12 Score: 114.005 bits (284), Expect = 7.573e-25
Identity = 122/425 (28.71%), Postives = 176/425 (41.41%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMS-DQSEIGPTSSNEDSKSSQG-DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECT 1919
            RCE   C  G+ + + G C D++EC  S  C  G C+N  G++ C C   +Q  P +  CV    +C     LC  G  CV+    +  C C  G+  S DGK+C   +             +C  G C+ +  ++ C C  G++ +  G  C   +D C      +C NG C +    + CQC  G     D + C    D + RS C      G C  P P    +  C       G G+ C+   + D +E     S+    ++ G DI+ C  +   + C  G C N++  YRC C  G+     G+ C +  E   N                   S LC+NG C  S  SY C C  G+    D ++C D+DEC  +P  C  G C N  GSY C C  G  +   P G  C D  + T
Sbjct:  432 RCE---CNVGYTQDVRGECIDVDECT-SSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVD-VDECIVSGGLCHLGR-CVNTE-GSFQCVCNAGFELSPDGKNCVDHNECATST-------MCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMD-IDECQTPG--ICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCV---DTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINEC--ALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALN-------------------SLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSP--CVSGVCRNLAGSYTCKCGPGSRLD--PSGTFCLDSTKGT 811          

HSP 13 Score: 111.309 bits (277), Expect = 4.240e-24
Identity = 110/428 (25.70%), Postives = 169/428 (39.49%), Query Frame = 3
Query: 1005 DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINS-PGS-----------------------------YQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
            D+CR +   +C  G+C+    +Y+CECN GY     G+     VD CT      C +G CV++   Y C+C  G+ ++  R+ C  + + +    LC  G+C+      ++C C  GF     GK C               NE + S+               C  G C+N    + C C PGF+L   G  C +  E +T                      +C NG C  +  S++CQC  G     DG++C D    S      ++G+C    PG+                             +Q  C  G  I          D NEC     +C NG+C+N  GS++C CN GY +    +DC  V + +        S +C   + +C+ S G + CSCP G     +T +C  V + +
Sbjct:  410 DICRHF-TNLCLNGRCLPTPSSYRCECNVGYTQDVRGEC--IDVDECTSS---PCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCV-NTEGSFQCVCNAGFELSPDGKNC------------VDHNECATSTM--------------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQT--------------------PGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITT-----DGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALN------SLLCD--NGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECL 771          

HSP 14 Score: 109.383 bits (272), Expect = 2.034e-23
Identity = 127/496 (25.60%), Postives = 185/496 (37.30%), Query Frame = 3
Query:  720 CQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDID-FCFYSYYRDQ----------------CKGGACINMKNHYRCECLPGFVLDKQGQACKE--------------------------------------RVEYKTNQMNDVASSFSLKTQCDKFGSF--------------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC---KNGICKN 1958
            C D++EC+ + ++C  G C N  G  RCLC   +   P    CV    +C+  P++C  G DC + +  + +C C  GY+       CS       D C   G        C+    ++ C C  G++   DG  C   +D C        P G C+++   Y C C  G+        DR +C    DL     C +GQC+  P  GY C C  GF P    + C+ +  D+   G   +    ++  G     C   Y  D+                C  G CIN    Y C C   F L+  G  C +                                      R      ++  +A++   +T C     F                    LC  G C+ +  S+QC+C  GY  S   ++C DIDECS +  IC  GTC N+ G+Y C C   +   N  GG  C D  +     S+C    NG C+N
Sbjct: 1194 CADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVD-VDECDLNPHICLHG-DCEN-TKGSFVCHCQLGYMVRKGATGCSD-----VDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVG--DGFECHD-LDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDL-----CDNGQCLNAPG-GYRCECEMGFDPTEDHRACQDV--DECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVN--GGNNCMDMRK-----SVCFRHYNGTCQN 1663          

HSP 15 Score: 103.605 bits (257), Expect = 1.013e-21
Identity = 113/426 (26.53%), Postives = 165/426 (38.73%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ--------SANKYDMCRFYGPYVCHFGKCIA----------------DGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSL-CPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C  GF +  DG  C D NEC  S +C +G C+NE GSF CLC   +   P    C+   +   Q P +C  G    + +  +  C+CL G     DG+ C           +  K    R +   V     C A                D   ++  C+ G   ++DG+   +        +  VC NG C +L   Y C C+ GY +    K CT + +    SL C +G C   P + Y C C PGF      + C+                       D+D C  S     C  G C N+   Y C+C PG  LD  G  C +  +  T  +    S   +  Q     S  C            +C+    C  G+ A + G  C D++EC   P +C  G C+N+ GS++C C +G  +
Sbjct:  516 CNAGFELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDEC--QTPGICVNGH--CTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINECA-----LDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGS-YSCSCPPGFHFWQDTEICK-----------------------DVDECLSS----PCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTK-GTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGF-ARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLML 902          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 105.531 bits (262), Expect = 4.156e-23
Identity = 113/389 (29.05%), Postives = 165/389 (42.42%), Query Frame = 3
Query:  933 CKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKC----ECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYIC---QCDSGYTSSYDRKKCTSIC---DLYPRS-LCPD-GQCIPQPN--NGYECRCLPG-FAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCN-NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECT----ETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C C  G+  + DG +C        D C           +C+    ++KC     C  GY   S+ + C+  VD C   +    P  +C +    Y C   +C  G   +    +CTSI      YP++ +C D  +C+   N   G EC   PG F    KG  C          G T   ED    Q  +           C    CIN+   Y+C+C PG+  +   + C++  E                  C KF   +C+ +  CI +  S++C+C  G+Q + DG+ C D++EC+   + C+Q  C+N PGSYQC C  GF +   P G KC D +EC+        LC  G C NT GS+ CQC  GY      + CV V +
Sbjct:  178 CSCRSGFDLAPDGMACVD-----IDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRD-VDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVN---GATGFCEDVNECQQGV-----------CGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDE------------------CIKFAGHVCDLSAECINTIGSFECKCKPGFQLASDGRRCEDVNECTTGIAACEQ-KCVNIPGSYQCICDRGFALG--PDGTKCEDIDECSIWAGSGNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDE 524          

HSP 2 Score: 88.5817 bits (218), Expect = 9.289e-18
Identity = 79/247 (31.98%), Postives = 120/247 (48.58%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICKSG-KCINERGSFRC-----LCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHF-GKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRS---LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI 1391
            C  G+   +G+C DI+EC     C +G +C+N  GSFRC     LC+  Y+ +     C +   +C+Q   +CG  M+C++L    + CKC PGY  +   K C        D C  +  +VC    +CI    +++C+C  G+  +SDG+ C+  V+ CT   G+     KCV++   Y C CD G+    D  KC  I  C ++  S   LC  G CI      Y C+C PG+     G+ C  +
Sbjct:  291 CPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFC-EDVNECQQ--GVCG-SMECINLP-GTYKCKCGPGYEFNDAKKRCE-----DVDECIKFAGHVCDLSAECINTIGSFECKCKPGFQLASDGRRCED-VNECT--TGIAACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGG-CI-NTKGSYLCQCPPGYKIQPDGRTCVDV 522          

HSP 3 Score: 85.1149 bits (209), Expect = 1.165e-16
Identity = 110/419 (26.25%), Postives = 176/419 (42.00%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQ--WSQICKSGKCINERGSFRCL----CSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSL--SIYNHLCKCLPGYVKS-LDGKSCSKQSANKY--------DMCRFYGPYVCHFG-KCIADGYNYKCE-----CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCP-DGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFD 1859
            C  GF +  DG+ C DI+EC        +S +C+N  GSF+C+    C + Y  D     C +   +C    + CGP   C +   S      KC  G +++ + G+  S    N Y        D+      + C  G +C+    +++C+     C  GY  +     C+  V+ C +    VC + +C++L   Y C+C  GY  +  +K+C  +  C  +   +C    +CI    + +EC+C PGF     G++C                ED       I  C             C+N+   Y+C C  GF L   G  C++      ++ +  A S          G+ LC  G CI +  SY CQC  GY+   DG+ C D+DEC++         C+N+ GS++C   D
Sbjct:  180 CRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERC-RDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCED-VNECQQG---VCGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGS-FECKCKPGFQLASDGRRC----------------EDVNECTTGIAACEQK----------CVNIPGSYQCICDRGFALGPDGTKCED-----IDECSIWAGS----------GNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSDKVCVNTLGSFKCHSID 550          

HSP 4 Score: 77.0258 bits (188), Expect = 3.369e-14
Identity = 96/408 (23.53%), Postives = 156/408 (38.24%), Query Frame = 3
Query: 1026 PYVCHFG-KCIAD----------GYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYIC----QCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDEC-SINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            P+V H G +C +           G   +C C  G+  + DG +C   +D C         + +C++    + C     C +GY    + ++C  +  C+L      P  QC       Y C         G G+    +  + + I   +          DID C   +    C  G  C+N    +RC+        ++G  C    E        V  +       ++    +C +  CI    +Y+C+C  GY+ +   K C D+DEC      +CD    CIN+ GS++C C  GF + +   G +C D NECT   + C+   C N  GS+QC C+ G+        C  + + S              C   C  + G ++C CP G     +   C  V +
Sbjct:  150 PHVLHLGDRCASSHCEHLCHDRGGEKVECSCRSGFDLAPDGMACVD-IDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQC-RNTQGSYRCD----AKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGH---NCGAGEECVNTPGSFRCQ--------QKGNLCAHGYE--------VNGATGFCEDVNECQQGVCGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGSFECKCKPGFQLAS--DGRRCEDVNECTTGIAACEQK-CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGN-----DLCMGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDE 524          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 105.145 bits (261), Expect = 5.760e-23
Identity = 114/390 (29.23%), Postives = 168/390 (43.08%), Query Frame = 3
Query:  933 CKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKC----ECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYIC---QCDSGYTSSYDRKKCTSIC---DLYPRS-LCPD-GQCIPQPN--NGYECRCLPG-FAPMGKGKQCRRIMSDQSEI-GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCN-NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECT----ETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C C  G+  + DG +C        D C           +C+    ++KC     C  GY   S+ + C+  VD C   +    P  +C +    Y C   +C  G   +    +CTSI      YP++ +C D  +C+   N   G EC   PG F    KG  C    +   E+ G T   ED    Q  +           C    CIN+   Y+C+C PG+  +   + C++  E                  C KF   +C+ +  CI +  S++C+C  G+Q + DG+ C D++EC+   + C+Q  C+N PGSYQC C  GF +   P G KC D +EC+        LC  G C NT GS+ CQC  GY      + CV V +
Sbjct:  178 CSCRSGFDLAPDGMACVD-----IDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRD-VDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLC----AHGYEVNGATGFCEDVNECQQGV-----------CGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDE------------------CIKFAGHVCDLSAECINTIGSFECKCKPGFQLASDGRRCEDVNECTTGIAACEQ-KCVNIPGSYQCICDRGFALG--PDGTKCEDIDECSIWAGSGNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDE 524          

HSP 2 Score: 88.5817 bits (218), Expect = 9.889e-18
Identity = 79/244 (32.38%), Postives = 119/244 (48.77%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICKSG-KCINERGSFRC-----LCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHF-GKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRS---LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC 1382
            C  G+   +G+C DI+EC     C +G +C+N  GSFRC     LC+  Y+ +     C +   +C+Q   +CG  M+C++L    + CKC PGY  +   K C        D C  +  +VC    +CI    +++C+C  G+  +SDG+ C+  V+ CT   G+     KCV++   Y C CD G+    D  KC  I  C ++  S   LC  G CI      Y C+C PG+     G+ C
Sbjct:  291 CPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFC-EDVNECQQ--GVCG-SMECINLP-GTYKCKCGPGYEFNDAKKRCE-----DVDECIKFAGHVCDLSAECINTIGSFECKCKPGFQLASDGRRCED-VNECT--TGIAACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGG-CI-NTKGSYLCQCPPGYKIQPDGRTC 519          

HSP 3 Score: 85.1149 bits (209), Expect = 1.153e-16
Identity = 117/447 (26.17%), Postives = 185/447 (41.39%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQ--WSQICKSGKCINERGSFRCL----CSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSL--SIYNHLCKCLPGYVKS-LDGKSCSKQSANKY--------DMCRFYGPYVCHFG-KCIADGYNYKCE-----CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCP-DGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFT--IHNMPGGPKCYDRNECTETTSLC 1937
            C  GF +  DG+ C DI+EC        +S +C+N  GSF+C+    C + Y  D     C +   +C    + CGP   C +   S      KC  G +++ + G+  S    N Y        D+      + C  G +C+    +++C+     C  GY  +     C+  V+ C +    VC + +C++L   Y C+C  GY  +  +K+C  +  C  +   +C    +CI      +EC+C PGF     G++C                ED       I  C             C+N+   Y+C C  GF L   G  C++      ++ +  A S          G+ LC  G CI +  SY CQC  GY+   DG+ C D+DEC++         C+N+ GS++C   D  T  IH+        ++N C    S C
Sbjct:  180 CRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERC-RDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCED-VNECQQG---VCGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECI-NTIGSFECKCKPGFQLASDGRRC----------------EDVNECTTGIAACEQK----------CVNIPGSYQCICDRGFALGPDGTKCED-----IDECSIWAGS----------GNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSDKVCVNTLGSFKCHSIDCPTNYIHDS------LNKNRCNRQPSAC 572          

HSP 4 Score: 76.6406 bits (187), Expect = 4.799e-14
Identity = 96/408 (23.53%), Postives = 156/408 (38.24%), Query Frame = 3
Query: 1026 PYVCHFG-KCIAD----------GYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYIC----QCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDEC-SINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            P+V H G +C +           G   +C C  G+  + DG +C   +D C         + +C++    + C     C +GY    + ++C  +  C+L      P  QC       Y C         G G+    +  + + I   +          DID C   +    C  G  C+N    +RC+        ++G  C    E        V  +       ++    +C +  CI    +Y+C+C  GY+ +   K C D+DEC      +CD    CIN+ GS++C C  GF + +   G +C D NECT   + C+   C N  GS+QC C+ G+        C  + + S              C   C  + G ++C CP G     +   C  V +
Sbjct:  150 PHVLHLGDRCASSHCEHLCHDRGGEKVECSCRSGFDLAPDGMACVD-IDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQC-RNTQGSYRCD----AKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGH---NCGAGEECVNTPGSFRCQ--------QKGNLCAHGYE--------VNGATGFCEDVNECQQGVCGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGSFECKCKPGFQLAS--DGRRCEDVNECTTGIAACEQK-CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGN-----DLCMGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDE 524          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 99.3673 bits (246), Expect = 6.157e-21
Identity = 111/408 (27.21%), Postives = 168/408 (41.18%), Query Frame = 3
Query:  915 SIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSND--YICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY---ECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR-------------------------CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            +I  + C+C PG+  S DG +CS       D C           +C+     ++C+C       +DG++C K V  C+  NG      +C + SN   Y C+C  G+  S +++ C  +   +       G C     N +   +C+C PGF           +  D             + S  DID C  +   +      C N+K  YRC+C  G+ L + G+ C+E +     Q+ +         Q D      C NG                          C+    S +CQC  G++   D K C DI ECS N   C+Q  C N  G Y CSC  GF +     G  C+D NEC      C   +CKN  GS +CQC +GYI ++ ++ CV+  D+++
Sbjct:  173 TIGTYYCRCWPGFELSGDGNTCSD-----IDECAVSNGGC--SDRCVNSPGGFRCDCPSDLYLHADGRTCGK-VTSCSTDNGGC--EHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNK----GGCQHHCTNNHGRAQCQCYPGF----------HLSYD-------------RRSCVDIDECAKNNGCEH----FCENVKGTYRCKCREGYQLGRDGRTCEEML--GGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQ-ICSNQEGGYMCSCEPGFELSE--DGHSCHDMNECLINNGGCAQ-LCKNRKGSRRCQCFAGYILAHDEKSCVAASDSAD 533          

HSP 2 Score: 77.0258 bits (188), Expect = 5.176e-14
Identity = 118/462 (25.54%), Postives = 167/462 (36.15%), Query Frame = 3
Query:  501 CQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI---CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C+C  GFTG  C    N           CM +  G +       G +              RC  GF +  DG  C DI+EC  S    S +C+N  G FRC C S          C  +   C      C    +  S   + + C+C  G+  S + +SC        D C F     C    C  +    +C+C  G+  S D +SC   +D C + NG       C ++   Y C+C  GY    D + C  +   C +       D  C  QP+ G+ C+C  G+      K C  I       G  S                            C+N+     C+C PGF L K  + C+           D++   S    C++          C      Y C C  G++ S DG  C D++EC IN   C Q  C N  GS +C CF G+ +
Sbjct:  141 CECPVGFTGAKCQYDAN----------ECMANNGGCEHECVNTIGTYYC------------RCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTC-GKVTSCSTDNGGCEHECENDSNGEF-YRCRCRVGFKLSENKRSC-----QPVDPC-FDNKGGCQH-HCTNNHGRAQCQCYPGFHLSYDRRSCVD-IDECAKNNGC---EHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGCQHD--CYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQ--------------------------ICVNLAGSVECQCKPGFRLMKDRKTCE-----------DISECSSNNGGCEQI---------CSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQ-LCKNRKGSRRCQCFAGYIL 518          

HSP 3 Score: 70.8626 bits (172), Expect = 3.867e-12
Identity = 101/438 (23.06%), Postives = 162/438 (36.99%), Query Frame = 3
Query:  906 VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYK---CECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK--NGICKN-----TYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            V+ +  + + +C PG+V       C + + +  D+C        + G C+   +N     CEC  G+     G  C+   + C   NG      +CV+    Y C+C  G+  S D   C+ I +    +     +C+  P  G+ C C         G+ C ++ S  ++ G    +E    S G+                        YRC C  GF L +  ++C+            V   F  K  C            C  +    QCQC  G+  S D + C DIDEC+ N     +  C N  G+Y+C C +G+ +          D   C E    C+  NG C++       G   C+C +GYI +N ++ C  + +      D         CS  C    G   C C  G   + +   C  +S+
Sbjct:   89 VNRTRRHTVAECCPGWVHRPGEAGCQRANCSA-DLCH-------NGGTCVPSEHNDNEQVCECPVGFT----GAKCQYDANECMANNGGC--EHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPG-GFRCDCPSDLYLHADGRTCGKVTSCSTDNG-GCEHECENDSNGEF-----------------------YRCRCRVGFKLSENKRSCQP-----------VDPCFDNKGGCQH---------HCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECAKNNGC--EHFCENVKGTYRCKCREGYQLGR--------DGRTCEEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGD---------CSQICVNLAGSVECQCKPGFRLMKDRKTCEDISE 448          

HSP 4 Score: 63.929 bits (154), Expect = 5.823e-10
Identity = 63/248 (25.40%), Postives = 98/248 (39.52%), Query Frame = 3
Query: 1518 MKNHYRCECLPGFV----------------LDKQGQACKERVEYKTNQMNDVASSFS-LKTQCDKFGSFLCNNG----RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSF-QCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
             + H   EC PG+V                L   G  C         Q+ +    F+  K Q D     + NNG     C+ +  +Y C+C  G++ S DG  CSDIDEC+++   C    C+NSPG ++C C     +H    G  C     C+     C++    ++ G F +C+C  G+  S  K+ C  V    + K           C H+C  ++G   C C  G     +   C  + +  
Sbjct:   92 TRRHTVAECCPGWVHRPGEAGCQRANCSADLCHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDA-NECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSD-RCVNSPGGFRCDCPSDLYLH--ADGRTCGKVTSCSTDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNK---------GGCQHHCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECA 326          

HSP 5 Score: 57.3806 bits (137), Expect = 5.343e-8
Identity = 58/250 (23.20%), Postives = 93/250 (37.20%), Query Frame = 3
Query: 1509 CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGS-YQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQ--------FDIPDNVRV 2231
            C+N    Y C C PGF L   G  C +        +++ A S    +             RC+ S   ++C C +      DG+ C  +  CS +   C+     +S G  Y+C C  GF +        C   + C +    C++  C N +G  QCQC  G+  S  ++ CV + + +              C H+C+   G + C C  G     +   C ++     V         +D PD   V
Sbjct:  170 CVNTIGTYYCRCWPGFELSGDGNTCSD--------IDECAVSNGGCSD------------RCVNSPGGFRCDCPSDLYLHADGRTCGKVTSCSTDNGGCEHECENDSNGEFYRCRCRVGFKLSENK--RSCQPVDPCFDNKGGCQH-HCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECAKNN----------GCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGCQHDCYDQPDGGHV 386          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 99.3673 bits (246), Expect = 6.750e-21
Identity = 111/408 (27.21%), Postives = 168/408 (41.18%), Query Frame = 3
Query:  915 SIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSND--YICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY---ECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR-------------------------CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            +I  + C+C PG+  S DG +CS       D C           +C+     ++C+C       +DG++C K V  C+  NG      +C + SN   Y C+C  G+  S +++ C  +   +       G C     N +   +C+C PGF           +  D             + S  DID C  +   +      C N+K  YRC+C  G+ L + G+ C+E +     Q+ +         Q D      C NG                          C+    S +CQC  G++   D K C DI ECS N   C+Q  C N  G Y CSC  GF +     G  C+D NEC      C   +CKN  GS +CQC +GYI ++ ++ CV+  D+++
Sbjct:  173 TIGTYYCRCWPGFELSGDGNTCSD-----IDECAVSNGGC--SDRCVNSPGGFRCDCPSDLYLHADGRTCGK-VTSCSTDNGGC--EHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNK----GGCQHHCTNNHGRAQCQCYPGF----------HLSYD-------------RRSCVDIDECAKNNGCEH----FCENVKGTYRCKCREGYQLGRDGRTCEEML--GGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQ-ICSNQEGGYMCSCEPGFELSE--DGHSCHDMNECLINNGGCAQ-LCKNRKGSRRCQCFAGYILAHDEKSCVAASDSAD 533          

HSP 2 Score: 77.0258 bits (188), Expect = 5.407e-14
Identity = 118/462 (25.54%), Postives = 167/462 (36.15%), Query Frame = 3
Query:  501 CQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI---CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C+C  GFTG  C    N           CM +  G +       G +              RC  GF +  DG  C DI+EC  S    S +C+N  G FRC C S          C  +   C      C    +  S   + + C+C  G+  S + +SC        D C F     C    C  +    +C+C  G+  S D +SC   +D C + NG       C ++   Y C+C  GY    D + C  +   C +       D  C  QP+ G+ C+C  G+      K C  I       G  S                            C+N+     C+C PGF L K  + C+           D++   S    C++          C      Y C C  G++ S DG  C D++EC IN   C Q  C N  GS +C CF G+ +
Sbjct:  141 CECPVGFTGAKCQYDAN----------ECMANNGGCEHECVNTIGTYYC------------RCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTC-GKVTSCSTDNGGCEHECENDSNGEF-YRCRCRVGFKLSENKRSC-----QPVDPC-FDNKGGCQH-HCTNNHGRAQCQCYPGFHLSYDRRSCVD-IDECAKNNGC---EHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGCQHD--CYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQ--------------------------ICVNLAGSVECQCKPGFRLMKDRKTCE-----------DISECSSNNGGCEQI---------CSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQ-LCKNRKGSRRCQCFAGYIL 518          

HSP 3 Score: 63.5438 bits (153), Expect = 6.249e-10
Identity = 63/248 (25.40%), Postives = 98/248 (39.52%), Query Frame = 3
Query: 1518 MKNHYRCECLPGFV----------------LDKQGQACKERVEYKTNQMNDVASSFS-LKTQCDKFGSFLCNNG----RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSF-QCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
             + H   EC PG+V                L   G  C         Q+ +    F+  K Q D     + NNG     C+ +  +Y C+C  G++ S DG  CSDIDEC+++   C    C+NSPG ++C C     +H    G  C     C+     C++    ++ G F +C+C  G+  S  K+ C  V    + K           C H+C  ++G   C C  G     +   C  + +  
Sbjct:   92 TRRHTVAECCPGWVHRPGEAGCQRANCSADLCHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDA-NECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSD-RCVNSPGGFRCDCPSDLYLH--ADGRTCGKVTSCSTDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNK---------GGCQHHCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECA 326          

HSP 4 Score: 57.3806 bits (137), Expect = 5.317e-8
Identity = 58/250 (23.20%), Postives = 93/250 (37.20%), Query Frame = 3
Query: 1509 CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGS-YQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQ--------FDIPDNVRV 2231
            C+N    Y C C PGF L   G  C +        +++ A S    +             RC+ S   ++C C +      DG+ C  +  CS +   C+     +S G  Y+C C  GF +        C   + C +    C++  C N +G  QCQC  G+  S  ++ CV + + +              C H+C+   G + C C  G     +   C ++     V         +D PD   V
Sbjct:  170 CVNTIGTYYCRCWPGFELSGDGNTCSD--------IDECAVSNGGCSD------------RCVNSPGGFRCDCPSDLYLHADGRTCGKVTSCSTDNGGCEHECENDSNGEFYRCRCRVGFKLSENK--RSCQPVDPCFDNKGGCQH-HCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECAKNN----------GCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGCQHDCYDQPDGGHV 386          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 98.9821 bits (245), Expect = 8.489e-21
Identity = 111/408 (27.21%), Postives = 168/408 (41.18%), Query Frame = 3
Query:  915 SIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSND--YICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY---ECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR-------------------------CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            +I  + C+C PG+  S DG +CS       D C           +C+     ++C+C       +DG++C K V  C+  NG      +C + SN   Y C+C  G+  S +++ C  +   +       G C     N +   +C+C PGF           +  D             + S  DID C  +   +      C N+K  YRC+C  G+ L + G+ C+E +     Q+ +         Q D      C NG                          C+    S +CQC  G++   D K C DI ECS N   C+Q  C N  G Y CSC  GF +     G  C+D NEC      C   +CKN  GS +CQC +GYI ++ ++ CV+  D+++
Sbjct:  173 TIGTYYCRCWPGFELSGDGNTCSD-----IDECAVSNGGC--SDRCVNSPGGFRCDCPSDLYLHADGRTCGK-VTSCSTDNGGC--EHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNK----GGCQHHCTNNHGRAQCQCYPGF----------HLSYD-------------RRSCVDIDECAKNNGCEH----FCENVKGTYRCKCREGYQLGRDGRTCEEML--GGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQ-ICSNQEGGYMCSCEPGFELSE--DGHSCHDMNECLINNGGCAQ-LCKNRKGSRRCQCFAGYILAHDEKSCVAASDSAD 533          

HSP 2 Score: 76.2554 bits (186), Expect = 7.741e-14
Identity = 118/462 (25.54%), Postives = 167/462 (36.15%), Query Frame = 3
Query:  501 CQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI---CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C+C  GFTG  C    N           CM +  G +       G +              RC  GF +  DG  C DI+EC  S    S +C+N  G FRC C S          C  +   C      C    +  S   + + C+C  G+  S + +SC        D C F     C    C  +    +C+C  G+  S D +SC   +D C + NG       C ++   Y C+C  GY    D + C  +   C +       D  C  QP+ G+ C+C  G+      K C  I       G  S                            C+N+     C+C PGF L K  + C+           D++   S    C++          C      Y C C  G++ S DG  C D++EC IN   C Q  C N  GS +C CF G+ +
Sbjct:  141 CECPVGFTGAKCQYDAN----------ECMANNGGCEHECVNTIGTYYC------------RCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTC-GKVTSCSTDNGGCEHECENDSNGEF-YRCRCRVGFKLSENKRSC-----QPVDPC-FDNKGGCQH-HCTNNHGRAQCQCYPGFHLSYDRRSCVD-IDECAKNNGC---EHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGCQHD--CYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQ--------------------------ICVNLAGSVECQCKPGFRLMKDRKTCE-----------DISECSSNNGGCEQI---------CSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQ-LCKNRKGSRRCQCFAGYIL 518          

HSP 3 Score: 70.4774 bits (171), Expect = 5.319e-12
Identity = 101/438 (23.06%), Postives = 162/438 (36.99%), Query Frame = 3
Query:  906 VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYK---CECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK--NGICKN-----TYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            V+ +  + + +C PG+V       C + + +  D+C        + G C+   +N     CEC  G+     G  C+   + C   NG      +CV+    Y C+C  G+  S D   C+ I +    +     +C+  P  G+ C C         G+ C ++ S  ++ G    +E    S G+                        YRC C  GF L +  ++C+            V   F  K  C            C  +    QCQC  G+  S D + C DIDEC+ N     +  C N  G+Y+C C +G+ +          D   C E    C+  NG C++       G   C+C +GYI +N ++ C  + +      D         CS  C    G   C C  G   + +   C  +S+
Sbjct:   89 VNRTRRHTVAECCPGWVHRPGEAGCQRANCSA-DLCH-------NGGTCVPSEHNDNEQVCECPVGFT----GAKCQYDANECMANNGGC--EHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPG-GFRCDCPSDLYLHADGRTCGKVTSCSTDNG-GCEHECENDSNGEF-----------------------YRCRCRVGFKLSENKRSCQP-----------VDPCFDNKGGCQH---------HCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECAKNNGC--EHFCENVKGTYRCKCREGYQLGR--------DGRTCEEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGD---------CSQICVNLAGSVECQCKPGFRLMKDRKTCEDISE 448          

HSP 4 Score: 63.1586 bits (152), Expect = 7.952e-10
Identity = 63/248 (25.40%), Postives = 98/248 (39.52%), Query Frame = 3
Query: 1518 MKNHYRCECLPGFV----------------LDKQGQACKERVEYKTNQMNDVASSFS-LKTQCDKFGSFLCNNG----RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSF-QCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
             + H   EC PG+V                L   G  C         Q+ +    F+  K Q D     + NNG     C+ +  +Y C+C  G++ S DG  CSDIDEC+++   C    C+NSPG ++C C     +H    G  C     C+     C++    ++ G F +C+C  G+  S  K+ C  V    + K           C H+C  ++G   C C  G     +   C  + +  
Sbjct:   92 TRRHTVAECCPGWVHRPGEAGCQRANCSADLCHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDA-NECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSD-RCVNSPGGFRCDCPSDLYLH--ADGRTCGKVTSCSTDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNK---------GGCQHHCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECA 326          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 88.9669 bits (219), Expect = 1.687e-17
Identity = 161/621 (25.93%), Postives = 233/621 (37.52%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLS--LSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG--RCEKGFIEIDGICQD---------------------INECQWSQICKSGKCINERGSFRCLCSSSY------------QFDPVQAD--CVQR-------------KKKCEQ-----IPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEY-KTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLC-SDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKN------GICKNTYGSFQCQCNSGYISSNKKQD---CVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            RC C PGFTG  C EI   EC  +  L+ G C     G + S   C   F  A      RC++    C+       GIC D                     IN+C  S  C  GKCI++  SF+CLC   Y            + +P Q D  C  R              K CE        N C  G  C+   I ++ C+C+PG+     G+ C K      D C        + G CI     YKCEC +G+  +     C   VD C     V    G+C    N++IC C  GYT     K+C    D    + C  G       N + C+C+PG+     G++C                      + +ID C  +   +   GG CI+  N Y+C C   F     G+ C+ +++   +N+  + A       +C    +FL            + C C  GY     G+ C  DIDECS++    +  +C+N PGSY+C C  G            Y+  +C   T  C +      G C +  G + C C  G+   + + D   C+S           +P +    CS Y       + C+CP G   +
Sbjct:  511 RCVCMPGFTGTQC-EIDIDECQSNPCLNDGTCHDKINGFKCS---CALGFTGA------RCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCD-SNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCID-GINSYKCQCVPGFT----GQHCEK----NVDEC--ISSPCANNGVCIDQVNGYKCECPRGFYDAH----CLSDVDECASNPCVN--EGRCEDGINEFICHCPPGYTG----KRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYT----GQKC----------------------ETNIDDCVTNPCGN---GGTCIDKVNGYKCVCKVPFT----GRDCESKMDPCASNRCKNEA-------KCTPSSNFL-----------DFSCTCKLGYT----GRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKG------------YEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLS-----------QPCQNGATCSQYVNS----YTCTCPLGFSGI 1017          

HSP 2 Score: 86.6557 bits (213), Expect = 7.973e-17
Identity = 141/519 (27.17%), Postives = 197/519 (37.96%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNG-ECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQ-DINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLC-NNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC C  GFTG  C   +N  E     + G C+  P           G F+              C  GF      C+ DI+ECQ +     G C ++   F+C C+  +      A C      C+  P  C     C   SI  + C+C PGY     G SC + + N  D         CH GKCI D  ++KC C+ GY     G  C+K ++ C         +G C      Y CQC +G +     K C    +    + C +G       N Y+C+C+PGF     G+ C +                      ++D C  S   +    G CI+  N Y+CEC  GF              Y  + ++DV          D+  S  C N GRC +  + + C C  GY     GK C  DIDECS NP  C   GTC +   ++ C C  G+T      G KC    +   T      G C +    ++C C   +      +DC S  D
Sbjct:  473 RCNCSQGFTGPRCETNINECESHPCQNEGSCLDDP-----------GTFRCV------------CMPGFTGTQ--CEIDIDECQSNPCLNDGTCHDKINGFKCSCALGF----TGARCQINIDDCQSQP--CRNRGICHD-SIAGYSCECPPGYT----GTSC-EININDCDS------NPCHRGKCIDDVNSFKCLCDPGYT----GYICQKQINECESNPCQF--DGHCQDRVGSYYCQCQAGTSG----KNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFT----GQHCEK----------------------NVDECISSPCANN---GVCIDQVNGYKCECPRGF--------------YDAHCLSDV----------DECASNPCVNEGRCEDGINEFICHCPPGYT----GKRCELDIDECSSNP--CQHGGTCYDKLNAFSCQCMPGYT------GQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTG----RDCESKMD 869          

HSP 3 Score: 81.6481 bits (200), Expect = 2.414e-15
Identity = 124/478 (25.94%), Postives = 179/478 (37.45%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGK-CVSLSNDYICQCDSGYTS---SYDRKKCTSICDLYPRS-------------------LC------------PDGQCIPQPNNG-YECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLC-NNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISS 2006
            C  GF   D    DI ECQ +     G C+N  GS++C+C + Y       DC  + K C   P+ C  G  C S  + ++ CKC  G+    +GK+C +     YD C   G    + G CI    +Y C C   +     G+ C+  VD C + +  VC NG  C +    Y C C +G+     S +   C      Y  +                   LC             D  C   P NG Y C C  G+    KG  C   + +  +  P   N                        G C+N    YRC C  GF     G  C+  +                  +C+   S  C N G C++   +++C C  G+     G  C  DIDEC  NP + D GTC +    ++CSC  GFT      G +C    +  ++      GIC ++   + C+C  GY  +
Sbjct:  205 CPPGFTG-DTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGY----TGKDCDTKYKPCS--PSPCQNGGICRSNGL-SYECKCPKGF----EGKNCEQ----NYDDC--LGHLCQNGGTCIDGISDYTCRCPPNFT----GRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGY----KGVDCSEDIDECDQGSPCEHN------------------------GICVNTPGSYRCNCSQGFT----GPRCETNI-----------------NECE---SHPCQNEGSCLDDPGTFRCVCMPGFT----GTQCEIDIDECQSNPCLND-GTCHDKINGFKCSCALGFT------GARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGT 597          

HSP 4 Score: 80.1073 bits (196), Expect = 8.615e-15
Identity = 122/448 (27.23%), Postives = 182/448 (40.62%), Query Frame = 3
Query:  735 ECQWSQICKSGKCINE--------RGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNG-KCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKC-YDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN 2042
             C+   +C S  C N           SF C C   +  D     C    ++C+  P  C  G  CV+ +  ++ C C  GY     GK C      KY  C    P  C  G  C ++G +Y+C+C +G+    +GK+C++  D C    G +C NG  C+   +DY C+C   +T  + +      C      +C +G      +  Y C C+ G+A    G  C            +++ +D K +      CFY        G  CI+    + C+C  G    K G  C          ++D  +S             +C+         SY C C TGY+    G  CS DIDEC         G C+N+PGSY+C+C  GFT      GP+C  + NEC E+      G C +  G+F+C C  G+  +  + D    Q N
Sbjct:  174 RCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGD----TCSYDIEECQSNP--CKYGGTCVN-THGSYQCMCPTGYT----GKDCDT----KYKPCS---PSPCQNGGICRSNGLSYECKCPKGF----EGKNCEQNYDDCL---GHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDD-VDECAQRDHPVCQNGATCTNTHGSYSCICVNGWA----GLDC------------SNNTDDCKQAA-----CFY--------GATCIDGVGSFYCQCTKG----KTGLLC---------HLDDACTSNPCHAD------AICDTS---PINGSYACSCATGYK----GVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFT------GPRCETNINEC-ESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSN 533          

HSP 5 Score: 70.0922 bits (170), Expect = 8.605e-12
Identity = 148/572 (25.87%), Postives = 225/572 (39.34%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLS--LSRGVCMKHPYGLQLSKE-LCCGAFQVAWGDPCQR----CELGRCEKGFIEIDGI---------------CQ-DINECQWSQ--ICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCP-NGKCVSLSNDYICQCDSGYTSSYDRKKC-TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSS-----------------QGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE-------YKTNQMNDVASSFSLKTQCDK-FGSFLCN-------------NGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQG-TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSN 2009
            +C C  G+TGK C       C  S   + G+C  +     LS E  C   F+   G  C++    C    C+ G   IDGI               CQ D++EC      +C++G  C N  GS+ C+C + +       DC      C+Q    C  G  C+   + +  C+C  G    L    C    A   + C  +   +C          +Y C C  GY     G  C + +D C +  G  C  NG CV+    Y C C  G+T      +C T+I +        +G C+  P   + C C+PGF     G QC  I  D+ +  P  ++                       Q +ID C     R++   G C +    Y CEC PG+     G +C+  +        ++   ++DV    S K  CD  +  ++C              +G C +   SY CQC    QA   GK C  +++EC  NP  C+ G TCI+   SY+C C  GFT      G  C    +   ++    NG+C +    ++C+C  G+  ++
Sbjct:  240 QCMCPTGYTGKDCDTKYK-PCSPSPCQNGGICRSN----GLSYECKCPKGFE---GKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGW----AGLDCSNNTDDCKQA--ACFYGATCID-GVGSFYCQCTKGKTGLL----CHLDDACTSNPC--HADAICDTSPING---SYACSCATGY----KGVDCSEDIDECDQ--GSPCEHNGICVNTPGSYRCNCSQGFTG----PRCETNINECESHPCQNEGSCLDDPGT-FRCVCMPGFT----GTQC-EIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNR---GICHDSIAGYSCECPPGYT----GTSCEININDCDSNPCHRGKCIDDVN---SFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQC----QAGTSGKNCEVNVNECHSNP--CNNGATCIDGINSYKCQCVPGFT------GQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAH 749          

HSP 6 Score: 53.9138 bits (128), Expect = 7.684e-7
Identity = 98/401 (24.44%), Postives = 144/401 (35.91%), Query Frame = 3
Query: 1008 MCRFYGPYVCHFGKCIADGY-------NYKCECNQGYIASSDGKSCKKTVDFCTR---YNGVVCPNGKCVSLSNDYICQCDSGYTS---SYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSD-IDECS-INPSICDQG-TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGY--ISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            +C    P  C    C+  G         Y C C  GY     G+ C+ T + C      NG  C     ++ S+ + C C  G+T    SYD ++C S       + C  G      +  Y+C C  G+     GK C                 D+K        C          GG C +    Y C+C  GF    +G+ C++  +                   D  G    N G CI+  S Y C+C   +     G+ C D +DEC+  +  +C  G TC N+ GSY C C +G+       G  C +  +  +  +      C +  GSF CQC  G   +  +    C S   +++   DT P              NG + CSC  G   V
Sbjct:  134 LCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYT----GERCE-TKNLCASSPCRNGATC---TALAGSSSFTCSCPPGFTGDTCSYDIEECQS-------NPCKYGGTCVNTHGSYQCMCPTGYT----GKDC-----------------DTKYKPCSPSPCQ--------NGGICRSNGLSYECKCPKGF----EGKNCEQNYD-------------------DCLGHLCQNGGTCIDGISDYTCRCPPNFT----GRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWA------GLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPI-------------NGSYACSCATGYKGV 444          

HSP 7 Score: 51.2174 bits (121), Expect = 5.022e-6
Identity = 113/457 (24.73%), Postives = 165/457 (36.11%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINE-CQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGY---IASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINP-SICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSN---KKQDCVS 2030
            C  GF  I+  CQ  +E C  S     G CI+    + C C + Y      A+C  +  KC+  P  C  G  C   +   + C C  G+     GK CS+      D C   G   C  G  C    + + C+C+ G+   +      SC+   D        +C NG C    N ++C C  GY  SY +K+    C   P   C +G         YEC+C  GF    +G+ C                        +ID C  +  ++   GG C +   ++ C C PG +    G  C+                   K  C        NNG CI+    ++C C  G+   +  +   DI+EC  NP S      C+    +Y C+C  G        G  C  + +    +     G C        C CN+G+   N     QDC S
Sbjct: 1010 CPLGFSGIN--CQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYS----GANCQYKLNKCDSNP--CLNGATCHEQN-NEYTCHCPSGFT----GKQCSEY----VDWC---GQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDE-CQSQP---CQNGGTCRDLIGAYECQCRQGF----QGQNCEL----------------------NIDDCAPNPCQN---GGTCHDRVMNFSCSCPPGTM----GIICEIN-----------------KDDCKPGACH--NNGSCIDRVGGFECVCQPGF---VGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHM------GRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDS 1381          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 88.9669 bits (219), Expect = 1.687e-17
Identity = 161/621 (25.93%), Postives = 233/621 (37.52%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLS--LSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG--RCEKGFIEIDGICQD---------------------INECQWSQICKSGKCINERGSFRCLCSSSY------------QFDPVQAD--CVQR-------------KKKCEQ-----IPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEY-KTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLC-SDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKN------GICKNTYGSFQCQCNSGYISSNKKQD---CVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            RC C PGFTG  C EI   EC  +  L+ G C     G + S   C   F  A      RC++    C+       GIC D                     IN+C  S  C  GKCI++  SF+CLC   Y            + +P Q D  C  R              K CE        N C  G  C+   I ++ C+C+PG+     G+ C K      D C        + G CI     YKCEC +G+  +     C   VD C     V    G+C    N++IC C  GYT     K+C    D    + C  G       N + C+C+PG+     G++C                      + +ID C  +   +   GG CI+  N Y+C C   F     G+ C+ +++   +N+  + A       +C    +FL            + C C  GY     G+ C  DIDECS++    +  +C+N PGSY+C C  G            Y+  +C   T  C +      G C +  G + C C  G+   + + D   C+S           +P +    CS Y       + C+CP G   +
Sbjct:  511 RCVCMPGFTGTQC-EIDIDECQSNPCLNDGTCHDKINGFKCS---CALGFTGA------RCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCD-SNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCID-GINSYKCQCVPGFT----GQHCEK----NVDEC--ISSPCANNGVCIDQVNGYKCECPRGFYDAH----CLSDVDECASNPCVN--EGRCEDGINEFICHCPPGYTG----KRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYT----GQKC----------------------ETNIDDCVTNPCGN---GGTCIDKVNGYKCVCKVPFT----GRDCESKMDPCASNRCKNEA-------KCTPSSNFL-----------DFSCTCKLGYT----GRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKG------------YEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLS-----------QPCQNGATCSQYVNS----YTCTCPLGFSGI 1017          

HSP 2 Score: 86.6557 bits (213), Expect = 7.973e-17
Identity = 141/519 (27.17%), Postives = 197/519 (37.96%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNG-ECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQ-DINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLC-NNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC C  GFTG  C   +N  E     + G C+  P           G F+              C  GF      C+ DI+ECQ +     G C ++   F+C C+  +      A C      C+  P  C     C   SI  + C+C PGY     G SC + + N  D         CH GKCI D  ++KC C+ GY     G  C+K ++ C         +G C      Y CQC +G +     K C    +    + C +G       N Y+C+C+PGF     G+ C +                      ++D C  S   +    G CI+  N Y+CEC  GF              Y  + ++DV          D+  S  C N GRC +  + + C C  GY     GK C  DIDECS NP  C   GTC +   ++ C C  G+T      G KC    +   T      G C +    ++C C   +      +DC S  D
Sbjct:  473 RCNCSQGFTGPRCETNINECESHPCQNEGSCLDDP-----------GTFRCV------------CMPGFTGTQ--CEIDIDECQSNPCLNDGTCHDKINGFKCSCALGF----TGARCQINIDDCQSQP--CRNRGICHD-SIAGYSCECPPGYT----GTSC-EININDCDS------NPCHRGKCIDDVNSFKCLCDPGYT----GYICQKQINECESNPCQF--DGHCQDRVGSYYCQCQAGTSG----KNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFT----GQHCEK----------------------NVDECISSPCANN---GVCIDQVNGYKCECPRGF--------------YDAHCLSDV----------DECASNPCVNEGRCEDGINEFICHCPPGYT----GKRCELDIDECSSNP--CQHGGTCYDKLNAFSCQCMPGYT------GQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTG----RDCESKMD 869          

HSP 3 Score: 81.6481 bits (200), Expect = 2.414e-15
Identity = 124/478 (25.94%), Postives = 179/478 (37.45%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGK-CVSLSNDYICQCDSGYTS---SYDRKKCTSICDLYPRS-------------------LC------------PDGQCIPQPNNG-YECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLC-NNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISS 2006
            C  GF   D    DI ECQ +     G C+N  GS++C+C + Y       DC  + K C   P+ C  G  C S  + ++ CKC  G+    +GK+C +     YD C   G    + G CI    +Y C C   +     G+ C+  VD C + +  VC NG  C +    Y C C +G+     S +   C      Y  +                   LC             D  C   P NG Y C C  G+    KG  C   + +  +  P   N                        G C+N    YRC C  GF     G  C+  +                  +C+   S  C N G C++   +++C C  G+     G  C  DIDEC  NP + D GTC +    ++CSC  GFT      G +C    +  ++      GIC ++   + C+C  GY  +
Sbjct:  205 CPPGFTG-DTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGY----TGKDCDTKYKPCS--PSPCQNGGICRSNGL-SYECKCPKGF----EGKNCEQ----NYDDC--LGHLCQNGGTCIDGISDYTCRCPPNFT----GRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGY----KGVDCSEDIDECDQGSPCEHN------------------------GICVNTPGSYRCNCSQGFT----GPRCETNI-----------------NECE---SHPCQNEGSCLDDPGTFRCVCMPGFT----GTQCEIDIDECQSNPCLND-GTCHDKINGFKCSCALGFT------GARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGT 597          

HSP 4 Score: 80.1073 bits (196), Expect = 8.615e-15
Identity = 122/448 (27.23%), Postives = 182/448 (40.62%), Query Frame = 3
Query:  735 ECQWSQICKSGKCINE--------RGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNG-KCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKC-YDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN 2042
             C+   +C S  C N           SF C C   +  D     C    ++C+  P  C  G  CV+ +  ++ C C  GY     GK C      KY  C    P  C  G  C ++G +Y+C+C +G+    +GK+C++  D C    G +C NG  C+   +DY C+C   +T  + +      C      +C +G      +  Y C C+ G+A    G  C            +++ +D K +      CFY        G  CI+    + C+C  G    K G  C          ++D  +S             +C+         SY C C TGY+    G  CS DIDEC         G C+N+PGSY+C+C  GFT      GP+C  + NEC E+      G C +  G+F+C C  G+  +  + D    Q N
Sbjct:  174 RCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGD----TCSYDIEECQSNP--CKYGGTCVN-THGSYQCMCPTGYT----GKDCDT----KYKPCS---PSPCQNGGICRSNGLSYECKCPKGF----EGKNCEQNYDDCL---GHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDD-VDECAQRDHPVCQNGATCTNTHGSYSCICVNGWA----GLDC------------SNNTDDCKQAA-----CFY--------GATCIDGVGSFYCQCTKG----KTGLLC---------HLDDACTSNPCHAD------AICDTS---PINGSYACSCATGYK----GVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFT------GPRCETNINEC-ESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSN 533          

HSP 5 Score: 70.0922 bits (170), Expect = 8.605e-12
Identity = 148/572 (25.87%), Postives = 225/572 (39.34%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLS--LSRGVCMKHPYGLQLSKE-LCCGAFQVAWGDPCQR----CELGRCEKGFIEIDGI---------------CQ-DINECQWSQ--ICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCP-NGKCVSLSNDYICQCDSGYTSSYDRKKC-TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSS-----------------QGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE-------YKTNQMNDVASSFSLKTQCDK-FGSFLCN-------------NGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPSICDQG-TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSN 2009
            +C C  G+TGK C       C  S   + G+C  +     LS E  C   F+   G  C++    C    C+ G   IDGI               CQ D++EC      +C++G  C N  GS+ C+C + +       DC      C+Q    C  G  C+   + +  C+C  G    L    C    A   + C  +   +C          +Y C C  GY     G  C + +D C +  G  C  NG CV+    Y C C  G+T      +C T+I +        +G C+  P   + C C+PGF     G QC  I  D+ +  P  ++                       Q +ID C     R++   G C +    Y CEC PG+     G +C+  +        ++   ++DV    S K  CD  +  ++C              +G C +   SY CQC    QA   GK C  +++EC  NP  C+ G TCI+   SY+C C  GFT      G  C    +   ++    NG+C +    ++C+C  G+  ++
Sbjct:  240 QCMCPTGYTGKDCDTKYK-PCSPSPCQNGGICRSN----GLSYECKCPKGFE---GKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGW----AGLDCSNNTDDCKQA--ACFYGATCID-GVGSFYCQCTKGKTGLL----CHLDDACTSNPC--HADAICDTSPING---SYACSCATGY----KGVDCSEDIDECDQ--GSPCEHNGICVNTPGSYRCNCSQGFTG----PRCETNINECESHPCQNEGSCLDDPGT-FRCVCMPGFT----GTQC-EIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNR---GICHDSIAGYSCECPPGYT----GTSCEININDCDSNPCHRGKCIDDVN---SFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQC----QAGTSGKNCEVNVNECHSNP--CNNGATCIDGINSYKCQCVPGFT------GQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAH 749          

HSP 6 Score: 53.9138 bits (128), Expect = 7.684e-7
Identity = 98/401 (24.44%), Postives = 144/401 (35.91%), Query Frame = 3
Query: 1008 MCRFYGPYVCHFGKCIADGY-------NYKCECNQGYIASSDGKSCKKTVDFCTR---YNGVVCPNGKCVSLSNDYICQCDSGYTS---SYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSD-IDECS-INPSICDQG-TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGY--ISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            +C    P  C    C+  G         Y C C  GY     G+ C+ T + C      NG  C     ++ S+ + C C  G+T    SYD ++C S       + C  G      +  Y+C C  G+     GK C                 D+K        C          GG C +    Y C+C  GF    +G+ C++  +                   D  G    N G CI+  S Y C+C   +     G+ C D +DEC+  +  +C  G TC N+ GSY C C +G+       G  C +  +  +  +      C +  GSF CQC  G   +  +    C S   +++   DT P              NG + CSC  G   V
Sbjct:  134 LCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYT----GERCE-TKNLCASSPCRNGATC---TALAGSSSFTCSCPPGFTGDTCSYDIEECQS-------NPCKYGGTCVNTHGSYQCMCPTGYT----GKDC-----------------DTKYKPCSPSPCQ--------NGGICRSNGLSYECKCPKGF----EGKNCEQNYD-------------------DCLGHLCQNGGTCIDGISDYTCRCPPNFT----GRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWA------GLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPI-------------NGSYACSCATGYKGV 444          

HSP 7 Score: 51.2174 bits (121), Expect = 5.022e-6
Identity = 113/457 (24.73%), Postives = 165/457 (36.11%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINE-CQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGY---IASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINP-SICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSN---KKQDCVS 2030
            C  GF  I+  CQ  +E C  S     G CI+    + C C + Y      A+C  +  KC+  P  C  G  C   +   + C C  G+     GK CS+      D C   G   C  G  C    + + C+C+ G+   +      SC+   D        +C NG C    N ++C C  GY  SY +K+    C   P   C +G         YEC+C  GF    +G+ C                        +ID C  +  ++   GG C +   ++ C C PG +    G  C+                   K  C        NNG CI+    ++C C  G+   +  +   DI+EC  NP S      C+    +Y C+C  G        G  C  + +    +     G C        C CN+G+   N     QDC S
Sbjct: 1010 CPLGFSGIN--CQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYS----GANCQYKLNKCDSNP--CLNGATCHEQN-NEYTCHCPSGFT----GKQCSEY----VDWC---GQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDE-CQSQP---CQNGGTCRDLIGAYECQCRQGF----QGQNCEL----------------------NIDDCAPNPCQN---GGTCHDRVMNFSCSCPPGTM----GIICEIN-----------------KDDCKPGACH--NNGSCIDRVGGFECVCQPGF---VGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHM------GRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDS 1381          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0290277)

HSP 1 Score: 87.4261 bits (215), Expect = 4.477e-17
Identity = 143/539 (26.53%), Postives = 211/539 (39.15%), Query Frame = 3
Query:  687 CEKGFI--EIDGICQDINECQWSQICKS--GKCINERGSFRCLCSSSYQFDPVQADCVQRK-KKCEQIPNLCGPGMDCVSLSIYNHLCK-CLPGYVKSLDGKSCSKQSANKYDMCRFYGP------YVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSND-----YICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE---SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPG-GPKCYDRNECTETTSLCKNG-ICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN---SNQKYDTEPSKIC----------KKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C++G+   E    C DINEC   ++  +  G C N  GS+RC+     + +P   + V+   +K  ++P         V++S      K C  G+  S DG  C  Q  N+   C   GP       VC   KC     +++C C +GY    D +SC   +D CT          +C     D     Y C C  GY  S D+  C     L   S C           G E +C PG     +        +  S I PT    ++ S Q DID C    +   C    C N    Y+C+C  G  L ++     E +                   C+       NN  C +   +     C C  G++ S DGK C D+DEC +N   C Q  C N PGSY C C  G+ +  + G    C+D +EC++ T  C +  +C+N  GS+ C C  GY          S+  +    +   +T  +  C            CSH+C+   G F C+CP G     +   C  + + +D
Sbjct:  318 CQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCV--EPLEENPEITEVVENPIEKTNEVP---------VNVSESQPAGKTCNSGFQLSADGTDC--QDINE---CEVDGPEDLDNNAVCQ-QKCENTIGSFRCTCVEGYHLLEDQRSC--ALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSC-----LVQESPC-------STEKGVE-KCSPGTCLASEDN------TSFSCICPTGYRSEAFSCQ-DIDECAEDTHL--C-SHTCQNTPGGYQCQCPEGLNLVEEYTCLAENL-------------------CE------VNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQ-VCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD 788          

HSP 2 Score: 86.2705 bits (212), Expect = 8.191e-17
Identity = 136/531 (25.61%), Postives = 200/531 (37.66%), Query Frame = 3
Query:  783 RGSFRCLCSSSYQFDPVQADCVQRKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL----DGKSCSKQSANKYDMCR-FYGPYVCHFGK---------CIADGY----NYKCE------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTS-SYD--RKKCTSICDLYPRSL-CPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYI------------------SSNKKQDCVSVQDNSNQKYDTEPSKI----CKK----CSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
             GS+RC+C   Y+    Q  C+ ++  C  E+    C PG    S    +  C C  GY        D   C++ +      C+   G Y C   +         C+A+      N  CE            C +G+  S+DGKSC+  VD C   NG       C +L   Y C C +GY     D  R  C  I +   R+  C D       N  Y C C PG+A +G        ++       TSS   S  +  DID C  S     C    C N    ++C C  G+ L +  + C+           D+        QC +          C+     + C C TG++ + DG  C+DIDECS +   C    CIN  G++ C+C  G+ +        C D +EC    S   +  C N  G+F+C C  GYI                  +      C  ++ N      ++   +    C+K    CSH C  + G F CSCP G +   +   C  + +
Sbjct:  485 EGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCED-VDECLVNNGGC--QQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYA-LGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDEC--SLANGNC-SHFCQNEPGGFQCACPLGYALSEDMRTCQ-----------DIDECLDSNGQCSQL---------CLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSD-ICINLLGTHACACERGYELAK--DKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDE 985          

HSP 3 Score: 63.929 bits (154), Expect = 7.485e-10
Identity = 123/517 (23.79%), Postives = 183/517 (35.40%), Query Frame = 3
Query:  597 PYGLQLSKELCCGAFQV--AWGDPCQR-CELGR-----CEKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQF---DPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGK------------SCSKQSANKY-----DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSS----------------NEDSKSSQGDIDFCFYSYYRDQCKG-------GACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNG------------------------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF-------TIHNMPGGPK 1895
            P GL L +E  C A  +     + C++ C   R     C +GF +  DG  C+D++EC  +       C N  GS+ C+C++ Y+    D ++  C     +C Q  + C   M C +L+  ++ C C PGY   LD              S S ++ + +     D C        HF  C  +   ++C C  GY  S D ++C+  +D C   N      G+C  L                                     C+ QP  G+ C C  GF     G  C  I     + G  S                  E +K     +D        D+C G         CIN    + C C  G++L+  G++C   +         V      +   D      CN G                        RC  +  S++C C  GY+   D K C DIDEC  + + C  GTCIN  G ++C  F  F       T  ++P  PK
Sbjct:  579 PEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFD-IDECSQRTHGCSDQMLCENLN-GSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHF--CQNEPGGFQCACPLGYALSEDMRTCQD-IDECLDSN------GQCSQL-------------------------------------CLNQPG-GFACACETGFELTPDGFGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLDV-------DECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPAL---------VGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRCE-FPKFPVLPEIPTASSLPESPK 1029          

HSP 4 Score: 58.9214 bits (141), Expect = 2.506e-8
Identity = 79/318 (24.84%), Postives = 124/318 (38.99%), Query Frame = 3
Query: 1455 DIDFCFYSYYRDQCKGG---ACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN--------DVASSFS--------------LKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI-------NPSICDQGTCINSPGSYQCSCFDGFTI-----------------------------HNMPGG------PKCY----DRNECTETTSLC--KNGICKNTYG---------SFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLE 2162
            DID C  S       GG    C N+   Y+C C  G+ LD+ G++C +  E    +++        ++  S+               ++   +K      N      +G +    CN+G+Q S DG  C DI+EC +       N ++C Q  C N+ GS++C+C +G+ +                              ++P G      PK Y    D++ C    S C  + G+ K + G         SF C C +GY     + +  S QD      DT        CSH C+ + G + C CP GL+ V E
Sbjct:  292 DIDECLES------NGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKT----CNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQ-KCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGY-----RSEAFSCQDIDECAEDTH------LCSHTCQNTPGGYQCQCPEGLNLVEE 587          

HSP 5 Score: 55.4546 bits (132), Expect = 2.928e-7
Identity = 86/315 (27.30%), Postives = 120/315 (38.10%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQ------ADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN---GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGF-VLDKQGQAC----KERVEYKTNQMND 1622
            CQDI+EC  S    S  C+N+ G F C C + ++  P         +C Q    C  I         C++L +  H C C  GY  + D  SC        D C       C   +CI     ++C C  GYI + DG+SC   +        V CP G   S       +C+ GYT   D  KC  I +   +    +G C  + +N    ++C C PG+      K C+                       DID C     +  C  G CIN    +RCE  P F VL +   A       ++E KT +  D
Sbjct:  780 CQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDI---------CINL-LGTHACACERGYELAKDKLSCL-----DVDECAGLLSGGCSH-ECINKAGTFECGCPLGYILNDDGRSCSPAL--------VGCPPGTQRSADGCAPIECNPGYTLGSD-DKCVDIDECQKQ----NGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQ-----------------------DIDEC--DQDKTSCITGTCINEIGGFRCE-FPKFPVLPEIPTASSLPESPKIELKTPKYPD 1039          

HSP 6 Score: 54.299 bits (129), Expect = 5.482e-7
Identity = 70/258 (27.13%), Postives = 96/258 (37.21%), Query Frame = 3
Query: 1533 RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE----SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD--QGTCINSPGSYQC------------------------------------SCFDGFTIHNMPGGPKCYDRNEC-------TETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV--SVQDNSNQKYDTEPSKICKKCSHYCK-YSNGLFVCSCPNGLD 2150
            +C+C  G+ LD                 ND AS       C      L +NG C E        Y+C C  GY     GK C DI+EC+ NP +    QG C N PGSY+C                                    +C  GF +     G  C D NEC        +  ++C+   C+NT GSF+C C  GY     ++ C   S  D  N + +        +C+H C+    G + C CP G +
Sbjct:  273 KCDCREGYTLDP----------------NDYAS-------CLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECA-NPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSA--DGTDCQDINECEVDGPEDLDNNAVCQQK-CENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNR------TRCAHECQDLPEGSYRCVCPKGYE 497          

HSP 7 Score: 54.299 bits (129), Expect = 5.966e-7
Identity = 91/376 (24.20%), Postives = 141/376 (37.50%), Query Frame = 3
Query: 1074 KCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPD--GQCIPQPNNGYECRCLPGFA-----------PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG----DIDFCFYSYYRDQCKGGACI----NMKNHYRCECLPGFVLDKQGQACKER--VEYKTNQMN----------------------------DVASSFSLKTQCD-KFGSFLCNNGRCI--ESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            KC+C +GY    +  +    +D C   NG    +  C +L  +Y C C  GY      K C  I +     L  +  G C   P +    RC+               P+ K  +    +S+    G T ++    S+ G    DI+ C      D      C     N    +RC C+ G+ L +  ++C      + +  Q+N                            D  S    ++ C  + G   C+ G C+  E  +S+ C C TGY++  +   C DIDEC+ +  +C   TC N+PG YQC C +G    N+     C   N C    + C+  IC    G   C C  G+  S   + C  V +
Sbjct:  273 KCDCREGYTLDPNDYASCLDIDECLESNGGC--SEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGS---YRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRS--EAFSCQDIDECAEDTHLCSH-TCQNTPGGYQCQCPEGL---NLVEEYTCLAENLCEVNNNGCEQ-ICLTARGGV-CACREGFRLSADGKSCEDVDE 635          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301222)

HSP 1 Score: 87.4261 bits (215), Expect = 4.477e-17
Identity = 143/539 (26.53%), Postives = 211/539 (39.15%), Query Frame = 3
Query:  687 CEKGFI--EIDGICQDINECQWSQICKS--GKCINERGSFRCLCSSSYQFDPVQADCVQRK-KKCEQIPNLCGPGMDCVSLSIYNHLCK-CLPGYVKSLDGKSCSKQSANKYDMCRFYGP------YVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSND-----YICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE---SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPG-GPKCYDRNECTETTSLCKNG-ICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN---SNQKYDTEPSKIC----------KKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C++G+   E    C DINEC   ++  +  G C N  GS+RC+     + +P   + V+   +K  ++P         V++S      K C  G+  S DG  C  Q  N+   C   GP       VC   KC     +++C C +GY    D +SC   +D CT          +C     D     Y C C  GY  S D+  C     L   S C           G E +C PG     +        +  S I PT    ++ S Q DID C    +   C    C N    Y+C+C  G  L ++     E +                   C+       NN  C +   +     C C  G++ S DGK C D+DEC +N   C Q  C N PGSY C C  G+ +  + G    C+D +EC++ T  C +  +C+N  GS+ C C  GY          S+  +    +   +T  +  C            CSH+C+   G F C+CP G     +   C  + + +D
Sbjct:  318 CQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCV--EPLEENPEITEVVENPIEKTNEVP---------VNVSESQPAGKTCNSGFQLSADGTDC--QDINE---CEVDGPEDLDNNAVCQ-QKCENTIGSFRCTCVEGYHLLEDQRSC--ALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSC-----LVQESPC-------STEKGVE-KCSPGTCLASEDN------TSFSCICPTGYRSEAFSCQ-DIDECAEDTHL--C-SHTCQNTPGGYQCQCPEGLNLVEEYTCLAENL-------------------CE------VNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQ-VCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD 788          

HSP 2 Score: 86.2705 bits (212), Expect = 8.191e-17
Identity = 136/531 (25.61%), Postives = 200/531 (37.66%), Query Frame = 3
Query:  783 RGSFRCLCSSSYQFDPVQADCVQRKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL----DGKSCSKQSANKYDMCR-FYGPYVCHFGK---------CIADGY----NYKCE------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTS-SYD--RKKCTSICDLYPRSL-CPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYI------------------SSNKKQDCVSVQDNSNQKYDTEPSKI----CKK----CSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
             GS+RC+C   Y+    Q  C+ ++  C  E+    C PG    S    +  C C  GY        D   C++ +      C+   G Y C   +         C+A+      N  CE            C +G+  S+DGKSC+  VD C   NG       C +L   Y C C +GY     D  R  C  I +   R+  C D       N  Y C C PG+A +G        ++       TSS   S  +  DID C  S     C    C N    ++C C  G+ L +  + C+           D+        QC +          C+     + C C TG++ + DG  C+DIDECS +   C    CIN  G++ C+C  G+ +        C D +EC    S   +  C N  G+F+C C  GYI                  +      C  ++ N      ++   +    C+K    CSH C  + G F CSCP G +   +   C  + +
Sbjct:  485 EGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCED-VDECLVNNGGC--QQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYA-LGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDEC--SLANGNC-SHFCQNEPGGFQCACPLGYALSEDMRTCQ-----------DIDECLDSNGQCSQL---------CLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSD-ICINLLGTHACACERGYELAK--DKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDE 985          

HSP 3 Score: 63.929 bits (154), Expect = 7.485e-10
Identity = 123/517 (23.79%), Postives = 183/517 (35.40%), Query Frame = 3
Query:  597 PYGLQLSKELCCGAFQV--AWGDPCQR-CELGR-----CEKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQF---DPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGK------------SCSKQSANKY-----DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSS----------------NEDSKSSQGDIDFCFYSYYRDQCKG-------GACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNG------------------------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF-------TIHNMPGGPK 1895
            P GL L +E  C A  +     + C++ C   R     C +GF +  DG  C+D++EC  +       C N  GS+ C+C++ Y+    D ++  C     +C Q  + C   M C +L+  ++ C C PGY   LD              S S ++ + +     D C        HF  C  +   ++C C  GY  S D ++C+  +D C   N      G+C  L                                     C+ QP  G+ C C  GF     G  C  I     + G  S                  E +K     +D        D+C G         CIN    + C C  G++L+  G++C   +         V      +   D      CN G                        RC  +  S++C C  GY+   D K C DIDEC  + + C  GTCIN  G ++C  F  F       T  ++P  PK
Sbjct:  579 PEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFD-IDECSQRTHGCSDQMLCENLN-GSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHF--CQNEPGGFQCACPLGYALSEDMRTCQD-IDECLDSN------GQCSQL-------------------------------------CLNQPG-GFACACETGFELTPDGFGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLDV-------DECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPAL---------VGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRCE-FPKFPVLPEIPTASSLPESPK 1029          

HSP 4 Score: 58.9214 bits (141), Expect = 2.506e-8
Identity = 79/318 (24.84%), Postives = 124/318 (38.99%), Query Frame = 3
Query: 1455 DIDFCFYSYYRDQCKGG---ACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN--------DVASSFS--------------LKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI-------NPSICDQGTCINSPGSYQCSCFDGFTI-----------------------------HNMPGG------PKCY----DRNECTETTSLC--KNGICKNTYG---------SFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLE 2162
            DID C  S       GG    C N+   Y+C C  G+ LD+ G++C +  E    +++        ++  S+               ++   +K      N      +G +    CN+G+Q S DG  C DI+EC +       N ++C Q  C N+ GS++C+C +G+ +                              ++P G      PK Y    D++ C    S C  + G+ K + G         SF C C +GY     + +  S QD      DT        CSH C+ + G + C CP GL+ V E
Sbjct:  292 DIDECLES------NGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKT----CNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQ-KCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGY-----RSEAFSCQDIDECAEDTH------LCSHTCQNTPGGYQCQCPEGLNLVEE 587          

HSP 5 Score: 55.4546 bits (132), Expect = 2.928e-7
Identity = 86/315 (27.30%), Postives = 120/315 (38.10%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQ------ADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN---GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGF-VLDKQGQAC----KERVEYKTNQMND 1622
            CQDI+EC  S    S  C+N+ G F C C + ++  P         +C Q    C  I         C++L +  H C C  GY  + D  SC        D C       C   +CI     ++C C  GYI + DG+SC   +        V CP G   S       +C+ GYT   D  KC  I +   +    +G C  + +N    ++C C PG+      K C+                       DID C     +  C  G CIN    +RCE  P F VL +   A       ++E KT +  D
Sbjct:  780 CQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDI---------CINL-LGTHACACERGYELAKDKLSCL-----DVDECAGLLSGGCSH-ECINKAGTFECGCPLGYILNDDGRSCSPAL--------VGCPPGTQRSADGCAPIECNPGYTLGSD-DKCVDIDECQKQ----NGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQ-----------------------DIDEC--DQDKTSCITGTCINEIGGFRCE-FPKFPVLPEIPTASSLPESPKIELKTPKYPD 1039          

HSP 6 Score: 54.299 bits (129), Expect = 5.482e-7
Identity = 70/258 (27.13%), Postives = 96/258 (37.21%), Query Frame = 3
Query: 1533 RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE----SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD--QGTCINSPGSYQC------------------------------------SCFDGFTIHNMPGGPKCYDRNEC-------TETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV--SVQDNSNQKYDTEPSKICKKCSHYCK-YSNGLFVCSCPNGLD 2150
            +C+C  G+ LD                 ND AS       C      L +NG C E        Y+C C  GY     GK C DI+EC+ NP +    QG C N PGSY+C                                    +C  GF +     G  C D NEC        +  ++C+   C+NT GSF+C C  GY     ++ C   S  D  N + +        +C+H C+    G + C CP G +
Sbjct:  273 KCDCREGYTLDP----------------NDYAS-------CLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECA-NPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSA--DGTDCQDINECEVDGPEDLDNNAVCQQK-CENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNR------TRCAHECQDLPEGSYRCVCPKGYE 497          

HSP 7 Score: 54.299 bits (129), Expect = 5.966e-7
Identity = 91/376 (24.20%), Postives = 141/376 (37.50%), Query Frame = 3
Query: 1074 KCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPD--GQCIPQPNNGYECRCLPGFA-----------PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG----DIDFCFYSYYRDQCKGGACI----NMKNHYRCECLPGFVLDKQGQACKER--VEYKTNQMN----------------------------DVASSFSLKTQCD-KFGSFLCNNGRCI--ESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            KC+C +GY    +  +    +D C   NG    +  C +L  +Y C C  GY      K C  I +     L  +  G C   P +    RC+               P+ K  +    +S+    G T ++    S+ G    DI+ C      D      C     N    +RC C+ G+ L +  ++C      + +  Q+N                            D  S    ++ C  + G   C+ G C+  E  +S+ C C TGY++  +   C DIDEC+ +  +C   TC N+PG YQC C +G    N+     C   N C    + C+  IC    G   C C  G+  S   + C  V +
Sbjct:  273 KCDCREGYTLDPNDYASCLDIDECLESNGGC--SEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGS---YRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRS--EAFSCQDIDECAEDTHLCSH-TCQNTPGGYQCQCPEGL---NLVEEYTCLAENLCEVNNNGCEQ-ICLTARGGV-CACREGFRLSADGKSCEDVDE 635          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301221)

HSP 1 Score: 87.4261 bits (215), Expect = 4.477e-17
Identity = 143/539 (26.53%), Postives = 211/539 (39.15%), Query Frame = 3
Query:  687 CEKGFI--EIDGICQDINECQWSQICKS--GKCINERGSFRCLCSSSYQFDPVQADCVQRK-KKCEQIPNLCGPGMDCVSLSIYNHLCK-CLPGYVKSLDGKSCSKQSANKYDMCRFYGP------YVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSND-----YICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE---SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPG-GPKCYDRNECTETTSLCKNG-ICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN---SNQKYDTEPSKIC----------KKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C++G+   E    C DINEC   ++  +  G C N  GS+RC+     + +P   + V+   +K  ++P         V++S      K C  G+  S DG  C  Q  N+   C   GP       VC   KC     +++C C +GY    D +SC   +D CT          +C     D     Y C C  GY  S D+  C     L   S C           G E +C PG     +        +  S I PT    ++ S Q DID C    +   C    C N    Y+C+C  G  L ++     E +                   C+       NN  C +   +     C C  G++ S DGK C D+DEC +N   C Q  C N PGSY C C  G+ +  + G    C+D +EC++ T  C +  +C+N  GS+ C C  GY          S+  +    +   +T  +  C            CSH+C+   G F C+CP G     +   C  + + +D
Sbjct:  318 CQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCV--EPLEENPEITEVVENPIEKTNEVP---------VNVSESQPAGKTCNSGFQLSADGTDC--QDINE---CEVDGPEDLDNNAVCQ-QKCENTIGSFRCTCVEGYHLLEDQRSC--ALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSC-----LVQESPC-------STEKGVE-KCSPGTCLASEDN------TSFSCICPTGYRSEAFSCQ-DIDECAEDTHL--C-SHTCQNTPGGYQCQCPEGLNLVEEYTCLAENL-------------------CE------VNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQ-VCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD 788          

HSP 2 Score: 86.2705 bits (212), Expect = 8.191e-17
Identity = 136/531 (25.61%), Postives = 200/531 (37.66%), Query Frame = 3
Query:  783 RGSFRCLCSSSYQFDPVQADCVQRKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL----DGKSCSKQSANKYDMCR-FYGPYVCHFGK---------CIADGY----NYKCE------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTS-SYD--RKKCTSICDLYPRSL-CPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYI------------------SSNKKQDCVSVQDNSNQKYDTEPSKI----CKK----CSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
             GS+RC+C   Y+    Q  C+ ++  C  E+    C PG    S    +  C C  GY        D   C++ +      C+   G Y C   +         C+A+      N  CE            C +G+  S+DGKSC+  VD C   NG       C +L   Y C C +GY     D  R  C  I +   R+  C D       N  Y C C PG+A +G        ++       TSS   S  +  DID C  S     C    C N    ++C C  G+ L +  + C+           D+        QC +          C+     + C C TG++ + DG  C+DIDECS +   C    CIN  G++ C+C  G+ +        C D +EC    S   +  C N  G+F+C C  GYI                  +      C  ++ N      ++   +    C+K    CSH C  + G F CSCP G +   +   C  + +
Sbjct:  485 EGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCED-VDECLVNNGGC--QQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYA-LGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDEC--SLANGNC-SHFCQNEPGGFQCACPLGYALSEDMRTCQ-----------DIDECLDSNGQCSQL---------CLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSD-ICINLLGTHACACERGYELAK--DKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDE 985          

HSP 3 Score: 63.929 bits (154), Expect = 7.485e-10
Identity = 123/517 (23.79%), Postives = 183/517 (35.40%), Query Frame = 3
Query:  597 PYGLQLSKELCCGAFQV--AWGDPCQR-CELGR-----CEKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQF---DPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGK------------SCSKQSANKY-----DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSS----------------NEDSKSSQGDIDFCFYSYYRDQCKG-------GACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNG------------------------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF-------TIHNMPGGPK 1895
            P GL L +E  C A  +     + C++ C   R     C +GF +  DG  C+D++EC  +       C N  GS+ C+C++ Y+    D ++  C     +C Q  + C   M C +L+  ++ C C PGY   LD              S S ++ + +     D C        HF  C  +   ++C C  GY  S D ++C+  +D C   N      G+C  L                                     C+ QP  G+ C C  GF     G  C  I     + G  S                  E +K     +D        D+C G         CIN    + C C  G++L+  G++C   +         V      +   D      CN G                        RC  +  S++C C  GY+   D K C DIDEC  + + C  GTCIN  G ++C  F  F       T  ++P  PK
Sbjct:  579 PEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFD-IDECSQRTHGCSDQMLCENLN-GSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHF--CQNEPGGFQCACPLGYALSEDMRTCQD-IDECLDSN------GQCSQL-------------------------------------CLNQPG-GFACACETGFELTPDGFGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLDV-------DECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPAL---------VGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRCE-FPKFPVLPEIPTASSLPESPK 1029          

HSP 4 Score: 58.9214 bits (141), Expect = 2.506e-8
Identity = 79/318 (24.84%), Postives = 124/318 (38.99%), Query Frame = 3
Query: 1455 DIDFCFYSYYRDQCKGG---ACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN--------DVASSFS--------------LKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI-------NPSICDQGTCINSPGSYQCSCFDGFTI-----------------------------HNMPGG------PKCY----DRNECTETTSLC--KNGICKNTYG---------SFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLE 2162
            DID C  S       GG    C N+   Y+C C  G+ LD+ G++C +  E    +++        ++  S+               ++   +K      N      +G +    CN+G+Q S DG  C DI+EC +       N ++C Q  C N+ GS++C+C +G+ +                              ++P G      PK Y    D++ C    S C  + G+ K + G         SF C C +GY     + +  S QD      DT        CSH C+ + G + C CP GL+ V E
Sbjct:  292 DIDECLES------NGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKT----CNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQ-KCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGY-----RSEAFSCQDIDECAEDTH------LCSHTCQNTPGGYQCQCPEGLNLVEE 587          

HSP 5 Score: 55.4546 bits (132), Expect = 2.928e-7
Identity = 86/315 (27.30%), Postives = 120/315 (38.10%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQ------ADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN---GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGF-VLDKQGQAC----KERVEYKTNQMND 1622
            CQDI+EC  S    S  C+N+ G F C C + ++  P         +C Q    C  I         C++L +  H C C  GY  + D  SC        D C       C   +CI     ++C C  GYI + DG+SC   +        V CP G   S       +C+ GYT   D  KC  I +   +    +G C  + +N    ++C C PG+      K C+                       DID C     +  C  G CIN    +RCE  P F VL +   A       ++E KT +  D
Sbjct:  780 CQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDI---------CINL-LGTHACACERGYELAKDKLSCL-----DVDECAGLLSGGCSH-ECINKAGTFECGCPLGYILNDDGRSCSPAL--------VGCPPGTQRSADGCAPIECNPGYTLGSD-DKCVDIDECQKQ----NGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQ-----------------------DIDEC--DQDKTSCITGTCINEIGGFRCE-FPKFPVLPEIPTASSLPESPKIELKTPKYPD 1039          

HSP 6 Score: 54.299 bits (129), Expect = 5.482e-7
Identity = 70/258 (27.13%), Postives = 96/258 (37.21%), Query Frame = 3
Query: 1533 RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE----SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD--QGTCINSPGSYQC------------------------------------SCFDGFTIHNMPGGPKCYDRNEC-------TETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV--SVQDNSNQKYDTEPSKICKKCSHYCK-YSNGLFVCSCPNGLD 2150
            +C+C  G+ LD                 ND AS       C      L +NG C E        Y+C C  GY     GK C DI+EC+ NP +    QG C N PGSY+C                                    +C  GF +     G  C D NEC        +  ++C+   C+NT GSF+C C  GY     ++ C   S  D  N + +        +C+H C+    G + C CP G +
Sbjct:  273 KCDCREGYTLDP----------------NDYAS-------CLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECA-NPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSA--DGTDCQDINECEVDGPEDLDNNAVCQQK-CENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNR------TRCAHECQDLPEGSYRCVCPKGYE 497          

HSP 7 Score: 54.299 bits (129), Expect = 5.966e-7
Identity = 91/376 (24.20%), Postives = 141/376 (37.50%), Query Frame = 3
Query: 1074 KCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPD--GQCIPQPNNGYECRCLPGFA-----------PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG----DIDFCFYSYYRDQCKGGACI----NMKNHYRCECLPGFVLDKQGQACKER--VEYKTNQMN----------------------------DVASSFSLKTQCD-KFGSFLCNNGRCI--ESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            KC+C +GY    +  +    +D C   NG    +  C +L  +Y C C  GY      K C  I +     L  +  G C   P +    RC+               P+ K  +    +S+    G T ++    S+ G    DI+ C      D      C     N    +RC C+ G+ L +  ++C      + +  Q+N                            D  S    ++ C  + G   C+ G C+  E  +S+ C C TGY++  +   C DIDEC+ +  +C   TC N+PG YQC C +G    N+     C   N C    + C+  IC    G   C C  G+  S   + C  V +
Sbjct:  273 KCDCREGYTLDPNDYASCLDIDECLESNGGC--SEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGS---YRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRS--EAFSCQDIDECAEDTHLCSH-TCQNTPGGYQCQCPEGL---NLVEEYTCLAENLCEVNNNGCEQ-ICLTARGGV-CACREGFRLSADGKSCEDVDE 635          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Zebrafish
Match: fbn2b (fibrillin 2b [Source:ZFIN;Acc:ZDB-GENE-090112-3])

HSP 1 Score: 195.667 bits (496), Expect = 1.198e-50
Identity = 174/581 (29.95%), Postives = 256/581 (44.06%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDG-ICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC-------EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEY-------KTNQMNDVASSF------SLKTQCDKFGSF------LCNNG---RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDA 2153
            T   C + + G C+L++  G C  +  G  L  E CC     AWG PC+RCE+   C KGF  + G +C+DINEC+ +  +C +G+C+N +GSFRC C      D     CV  R ++C       E +  L  PG   V +      C C  G    +D ++C K + N++         +C  G  IA         N+G I +  G+   K V+ C  + G+ C +G C +    + C+CDSG+  + + + CT I  C + P  LC  G C+  P + +EC C  G+ +     K C  I  D+ E  P                         C+GG C+N +  Y C+C PG  L  +  AC++  E        K  Q  ++  ++        +   D+ G        + N G    C  S  SY+C C+ GY    D + C+DIDEC   P ICD G C N PG Y+C C+DGF    +M     C D NEC    ++C +G C+NT GSF C C  GY        C  V +     ++ +    C         + G F C C +G + 
Sbjct:  846 TNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSE-CCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFPGVCTNGRCVNTQGSFRCECPEGLTLDGAGRTCVDVRSEQCYMKWDEDECVEPL--PGRYRVDM------CCCTVGAAWGVDCEACPKPNTNEFKT-------ICPRGPGIA---------NRGDILT--GRPFYKDVNECKVFRGL-CTHGTCRNTIGSFKCRCDSGFALTMEERNCTDIDECTISP-DLCGHGVCVNTPGS-FECECFDGYESGFMMMKNCMDI--DECERDPL-----------------------LCRGGTCLNTEGSYECDCPPGHQLSTEASACEDVNECQLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQGCVDIDECTIMNGGCDTHCTNSEGSYECSCSEGYALMPDLRTCADIDECEDTPDICDGGQCTNIPGEYRCLCYDGFMASMDM---RTCIDVNECDLNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGAHNCDLHAACVN-------APGSFKCRCRDGWEG 1361          

HSP 2 Score: 175.252 bits (443), Expect = 3.394e-44
Identity = 198/696 (28.45%), Postives = 281/696 (40.37%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----------------EED-----QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVS-LSNDYI---CQCDSG--YTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQ------SEIGPTSSNED-------SKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS+G +A SC                   ED     +                 N G      RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ                                           +P LC  G +C++ ++ ++ CKC  G+ +S      + Q     D C      VC  G+C     +Y C C +GYI S+DG  C   VD           NG+C S LS  Y    C CD+G  +   +  + C        R LC         N G       G    G GK   +  +        SE   T+ N +       S+ ++  ID C   ++ + C  G CI     YRCEC  G+  D +G+                          D+  S  C NG C+ +  SY C+C+ GYQ +   + C DIDEC +N  +C  G C+N+ GS+QC C  GF I   P G  C D +EC  TT++C NG+C N  GSF+C C  G+  +   + C  +        +   S IC   +  C  + G F C CP GL   ++  +C   
Sbjct:   56 NVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSSGHLAPSCGAAAVQSCSVRCMNGGMCNEDACSCQKGYTGTHCGQPVCESGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQ------------------------------------------AVPGLCA-GGNCIN-TVGSYECKCPAGHRQSE-----TNQKCEDIDECATIS-GVCDGGECTNTAGSYVCTCPRGYITSTDGSRC---VDHRIGTCFSSLANGRCASELSGQYTKMQCCCDTGRCWALGHIPEMCPVRGSDEYRRLCIQRLPFGTGNGGIIHDGNGGLNIGGYGKGPSQNGNGGGGYIYGSEHTFTNGNGNGGQKIQISQLNETTIDVC--KHFTNLCLNGRCIPTPTSYRCECNMGYRQDVRGEC----------------------IDVDECVSNPCVNGDCVNTQGSYHCKCHEGYQGTPTKQACIDIDECIVNGVMCRNGRCVNTDGSFQCICNAGFEIS--PDGKNCIDHDECA-TTNMCLNGMCINEDGSFKCICKPGFALAPNGRYCTDID-------ECHTSGICM--NGRCVNTEGSFRCECPPGLAIDVDGRVCVDT 660          

HSP 3 Score: 157.532 bits (397), Expect = 1.318e-38
Identity = 145/523 (27.72%), Postives = 228/523 (43.59%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-------CEKG--------FIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNEC-TETTSLCKNGICKNTYGSFQCQCNSGY 1997
            RC+C  G T    G++C ++ + +C++      C++ P   +   ++CC     AWG  C+ C           C +G         +      +D+NEC+ +  +C  G C N  GSF+C C S +     + +C     +C   P+LCG G+ CV+ +  +  C+C  GY    +  K+C      + D      P +C  G C+    +Y+C+C  G+  S++  +C+  V+ C + +  +C +G+CV++   Y C C++GY  + DR+ C  I +    +   D  C       YEC C  G+A M   + C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E   N                     +C +G C  +  S+ C C  GY        C+D+DEC I    CD    C+N+PGS++C C DG+       G KC D +EC TE  +   N  C NT GS++C C  G+
Sbjct:  939 RCECPEGLTLDGAGRTCVDVRSEQCYMKWDEDECVE-PLPGRYRVDMCCCTVGAAWGVDCEACPKPNTNEFKTICPRGPGIANRGDILTGRPFYKDVNECKVFRGLCTHGTCRNTIGSFKCRCDSGFALTMEERNCTD-IDECTISPDLCGHGV-CVN-TPGSFECECFDGYESGFMMMKNCMDIDECERD------PLLCRGGTCLNTEGSYECDCPPGHQLSTEASACED-VNEC-QLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQGCVDIDECTIMNGGCDTHCT-NSEGSYECSCSEGYALMPDLRTCADI--DECEDTP-----------------------DICDGGQCTNIPGEYRCLCYDGFMASMDMRTCIDVNECDLNPN-------------------ICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGAHNCDLHAACVNAPGSFKCRCRDGWEGD----GIKCIDVDECVTEEHNCNPNAECLNTPGSYRCSCKEGF 1400          

HSP 4 Score: 156.377 bits (394), Expect = 3.086e-38
Identity = 167/659 (25.34%), Postives = 266/659 (40.36%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKG-FIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYR---CECLPGFVLDKQGQACKE--RVEYKT--------NQMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------PG------GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDV 2201
            RC+C PG      G+ C +  +   C+ ++  GVC +   G     E CC   +  +G+PCQ C           C  G  I  DG  +DINEC     IC++G C N RGS+RC+C+  Y+ D    +CV    +C     LC  GM     +  ++ C C  G+    D ++C  +  N+ D         C  G C     ++ CEC+ G    S    C  ++                 NG    +  C +L   +      C+ D   +  + R K   C  I  C+++P  +C +G+C+      + C C  G    G G+ C  + S+Q                     C+  +  D+C       +   YR   C C  G       +AC +    E+KT            D+ +        ++   F  LC +G C  +  S++C+C++G+  +++ + C+DIDEC+I+P +C  G C+N+PGS++C CFDG+    M                                   PG         C D NEC  + +LCK+G C N  G++QC C +GY  +  +Q CV +          E + +   C  +C  S G + CSC  G   + +   CA + +  D 
Sbjct:  641 RCECPPGLAIDVDGRVCVDTHMRTTCYGAIKMGVCSRPFPGAVTKSECCCANPEHGFGEPCQPCPAFNSAEFQAVCSSGPGITTDG--RDINECALDPDICQNGICENLRGSYRCICNIGYESDASGKNCVD-INECLVNRLLCDNGM--CRNTPGSYTCSCPKGFSFKADSETC--EDINECDS------NPCINGICRNIAGSFNCECSHGSKLDSTNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSECCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFP-GVCTNGRCV-NTQGSFRCECPEGLTLDGAGRTCVDVRSEQ---------------------CYMKWDEDECV----EPLPGRYRVDMCCCTVGAAWGVDCEACPKPNTNEFKTICPRGPGIANRGDILTGRPFYKDVNECKVFRGLCTHGTCRNTIGSFKCRCDSGFALTMEERNCTDIDECTISPDLCGHGVCVNTPGSFECECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCLNTEGSYECDCPPGHQLSTEASACEDVNECQLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQGCVDID---------ECTIMNGGCDTHCTNSEGSYECSCSEGYALMPDLRTCADIDECEDT 1250          

HSP 5 Score: 152.14 bits (383), Expect = 7.313e-37
Identity = 149/525 (28.38%), Postives = 214/525 (40.76%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI------------------------------------MSDQSEIGPTSSNEDS------------KSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQ----------CDKFGSFLCN----NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RCE   C  GF +   G C D NECQ    +C  G+CI+ +GSFRCLC + ++  P Q  C+    +C++ P  CG G    ++  YN  C C PG+  +              D C  +   VC  G+CI +  ++KC C  GY  + DGK+C   ++ C    G  C  G C +L   + C C  GY    D+    + C++ P ++C  G C   P + ++C C PGF     G++C                                         D  E+ P  + E +               +G  D        + C  G CIN    +RCEC  G+ LD  G  C +  E            ++V   F    Q          C+       N      RC+ +  SY+C C TGY    D ++C D DEC+     C      C N  G++ C C  G T    P G  C D NEC     +CKNG C NT GS++C+CN G+ +S    +C+
Sbjct: 1835 RCE---CSAGFKLSPSGACIDRNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMD-IDECDRQP--CGNGTCKNTVGSYN--CLCFPGFELT------HNNDCMDIDECSVHASQVCRNGQCINNMGSFKCLCLDGYNLTPDGKNCVD-INECVTLPGA-CQPGTCQNLDGSFRCICPPGYEVQNDKCVDINECNVEP-NICQFGTCKNTPGS-FQCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGREDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCSNVPGGFECSCQEGFEPGPMMTCEDINECAVNPLLCAFRCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMT--RRPDGEGCMDLNECRSKPGICKNGRCVNTVGSYRCECNEGFEASATGTECI 2339          

HSP 6 Score: 146.747 bits (369), Expect = 3.614e-35
Identity = 161/605 (26.61%), Postives = 234/605 (38.68%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFL-SLSRG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC----------------------------------EL-GRCEKG------------------FIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---------CE-QIPNLCGPGMDCVSLSI---YNHLCKCLPGYVKSLDGKSCSKQSAN-----------KYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN 2042
            C C P F    +G  C +   G CFL +L RG   +      G+ +++  CC +   AWG+PC+ C                                  EL G C+ G                    E   IC+DI+EC     IC  G C N  G++ C+C   Y       +C+  +K          CE ++       M C + ++   +N  C+  P    S     C  Q+               D CR   P +C  G CI    +++CEC  G+  ++    C+  +D C   + +   N  C+++   Y C+C +G+  S      DR +C  I      ++C  G+CI      + C C  GF        C                        DID C     R  C  G C N    Y C C PGF L               N   D+        +C    S +C NG+CI +  S++C C  GY  + DGK C DI+EC   P  C  GTC N  GS++C C  G+ + N     KC D NEC    ++C+ G CKNT GSFQC C  G++ S+  + C   +++
Sbjct: 1516 CNCPPDFELNPSGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPSVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNRPCEACPTPATSEYQLLCGNQAPGFIIDIHTGKPIDIDECREI-PGICANGVCINQIGSFRCECPMGFSYNNILLICED-IDECNSGDNLCQRNANCINIPGSYRCECSAGFKLSPSGACIDRNECQEI-----PNVCSHGECI-DTQGSFRCLCHNGFKTTPDQTMCM-----------------------DIDEC----DRQPCGNGTCKNTVGSYNCLCFPGFEL------------THNNDCMDI-------DECSVHASQVCRNGQCINNMGSFKCLCLDGYNLTPDGKNCVDINECVTLPGACQPGTCQNLDGSFRCICPPGYEVQN----DKCVDINECNVEPNICQFGTCKNTPGSFQCICQPGFVLSDNGRRCFDTRES 2062          

HSP 7 Score: 146.362 bits (368), Expect = 4.258e-35
Identity = 129/435 (29.66%), Postives = 198/435 (45.52%), Query Frame = 3
Query:  741 QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDK------FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
             ++ +C +G+CI    S+RC C+  Y+ D V+ +C+      E + N C  G DCV+     H CKC  GY  +      +KQ+    D C   G  +C  G+C+    +++C CN G+  S DGK+C    D C   N  +C NG C++    + C C  G+  + + + CT I + +   +C +G+C+      + C C PG A    G+ C       +  G       S+   G +        + +C    C N ++ +             G+ C+    + + +   V SS    T   +          +C NG C     SY+C CN GY++   GK C DI+EC +N  +CD G C N+PGSY CSC  GF+         C D NEC   ++ C NGIC+N  GSF C+C+ G    +    CV
Sbjct:  460 HFTNLCLNGRCIPTPTSYRCECNMGYRQD-VRGECIDVD---ECVSNPCVNG-DCVNTQGSYH-CKCHEGYQGTP-----TKQACIDIDECIVNG-VMCRNGRCVNTDGSFQCICNAGFEISPDGKNCIDH-DECATTN--MCLNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECHTSGICMNGRCV-NTEGSFRCECPPGLAIDVDGRVCVDTHMRTTCYGAIKMGVCSRPFPGAV-------TKSEC---CCANPEHGF-------------GEPCQPCPAFNSAEFQAVCSSGPGITTDGRDINECALDPDICQNGICENLRGSYRCICNIGYESDASGKNCVDINECLVNRLLCDNGMCRNTPGSYTCSCPKGFSFK--ADSETCEDINEC--DSNPCINGICRNIAGSFNCECSHGSKLDSTNTVCV 851          

HSP 8 Score: 139.428 bits (350), Expect = 6.103e-33
Identity = 158/582 (27.15%), Postives = 237/582 (40.72%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCELGRCEKGFIEI-----------DGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPR-SLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGAC-INMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK----TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGL 2171
            +C C+PGF     G+ C +     CF     G C   P     +K  CC +      WGDPC+ C     E  F  +           +G  +D+NEC +  +IC +G CIN  GSFRC C   Y  D    +CV   +    I N CG G    S       C C  G+     G   + +  N+  +     P +C F +C+    +Y+C C  GY+   D + C+   +     +        C +    ++C C  G T   D + C  + +   +  +C +G+C+    + Y C C  GF     G +C                 D++       FCF    +  C+  +   N      C C  G       + C      +  +M  +   ++       +C+   + LC NG+CI S  S++C CN GY     G  C D+DECS +P  C+   C N+ GSY CSC  G+ +   P G  C D +EC+     C+  +C NT G F C+C SG+  +  +  C+   + SNQ        IC      C  S G F C C  G  ++  TGL
Sbjct: 2040 QCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKC-SVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGR-EDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNCVDTDEC--SIGNPCGNGT--CSNVPGGFECSCQEGFEP---GPMMTCEDINECAV----NPLLCAF-RCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMTRRPDGEGCMDLNECRSKPGICKNGRCVNTVGS-YRCECNEGFEASATGTECI----------------DNRKG-----FCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDGRDINECEVMPN-LCKNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDECSQSPKPCNF-LCKNTEGSYLCSCPRGYILQ--PDGKTCKDLDECSTKQHNCQF-LCVNTIGGFTCKCPSGF--TQHQTACIDNNECSNQP------NICGS-RASCLNSPGSFNCECQKGF-SLDATGL 2570          

HSP 9 Score: 138.658 bits (348), Expect = 1.184e-32
Identity = 182/702 (25.93%), Postives = 265/702 (37.75%), Query Frame = 3
Query:  252 NENSF--VCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----EEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQV--AWGDPCQRCELGRCEKGFIEI-----------DGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPR-SLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEIGPTSSNEDSKSS------------------QGDIDF--------CFYSYYRD---------QCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            N  SF  +C  GY L  +G   + I  N C       +P TCQ  +G     C      + D+  +    N E           T  + +C C+PGF     G+ C +     CF     G C   P     +K  CC +      WGDPC+ C     E  F  +           +G  +D+NEC +  +IC +G CIN  GSFRC C   Y  D    +CV   +    I N CG G    S       C C  G+     G   + +  N+  +     P +C F +C+    +Y+C C  GY+   D + C+   +     +        C +    ++C C  G T   D + C  + +   +  +C +G+C+    + Y C C  GF     G +C           ++    +   T+ N  +KS                    G I +         + +  RD          CK G CIN    +RC C  G+  D  G +C +  E                +Q  K  +FLC N     +  SY C C  GY    DGK C D+DECS     C Q  C+N+ G + C C  GFT H       C D NEC+   ++C     C N+ GSF C+C  G+       +C  V +               +C H C+   G + C CP G
Sbjct: 1953 NMGSFKCLCLDGYNLTPDGKNCVDI--NECVTLPGACQPGTCQNLDGSFRCICPPGYEVQNDKCVDINECNVEPNICQFGTCKNTPGSFQCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKC-SVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGR-EDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNCVDTDEC--SIGNPCGNGT--CSNVPGGFECSCQEGFEP---GPMMTCEDINECAV----NPLLCAF-RCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQIGTFMCICPPGMTRRPDGEGCMDLNECRSKPGICKNGRCVNTVGS-YRCECNEGFEASATGTECIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDGRDINECEVMPNLCKNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDEC---------------SQSPKPCNFLCKN-----TEGSYLCSCPRGYILQPDGKTCKDLDECSTKQHNC-QFLCVNTIGGFTCKCPSGFTQHQT----ACIDNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCDDVDECGGN----------HRCQHGCQNMMGGYRCGCPQG 2602          

HSP 10 Score: 128.257 bits (321), Expect = 1.686e-29
Identity = 138/526 (26.24%), Postives = 214/526 (40.68%), Query Frame = 3
Query:  687 CEKGFIEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--------TSICDLYP-------RSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQC-RRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            C++GF     + C+DINEC  + +  + +C+N  GS+ C+C + Y        C  + +  E + +    GM C +  I   +C C PG  +  DG+ C        + CR   P +C  G+C+    +Y+CECN+G+ AS+ G  C                 G C +     +CQ  S   ++  + +C         S+C+L P       + +CP G           EC  +P      K  QC   + S +       +N+ + +S  D+D C  S     C    C N +  Y C C  G++L   G+ CK+  E  T Q N      +    F+ K                +C    +   +   C+ S  S+ C+C  G+     G  C D+DEC  N     Q  C N  G Y+C C  G+  H      +C D NECT    +C +  C NT GS++C C SG+        C  V + S              CS+ C  ++G ++C CP G 
Sbjct: 2199 CQEGFEPGPMMTCEDINECAVNPLLCAFRCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKN-QIGTFMCICPPGMTRRPDGEGCMD-----LNECRSK-PGICKNGRCVNTVGSYRCECNEGFEASATGTECIDNR------------KGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDGRDINECEVMPNLC---KNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDEC--SQSPKPCNF-LCKNTEGSYLCSCPRGYILQPDGKTCKDLDECSTKQHNCQFLCVNTIGGFTCKCPSGFTQHQTACIDNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCDDVDECGGNHRC--QHGCQNMMGGYRCGCPQGYVQHYQWN--QCVDENECT-GNQVCGSASCYNTLGSYKCVCPSGFDFEATAGGCQDVNECSMGN---------NPCSYGCSNTDGGYLCGCPGGF 2685          

HSP 11 Score: 119.783 bits (299), Expect = 7.259e-27
Identity = 142/538 (26.39%), Postives = 221/538 (41.08%), Query Frame = 3
Query:  720 CQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDR---NECTETTSLCKNGI-CKNTYG----SFQCQCNSGYISSNKKQDCVSVQDNS-------NQKYDTEPSKI-------CKKCSHYCKYSN-----GLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C+D+NECQ S  +CK G+C+N  G+++C C + YQ  P +  CV    +C  +   C     C + S  ++ C C  GY    D ++C+       D C    P +C  G+C      Y+C C  G++AS D ++C   V+ C   N  +C +G C +    +IC C  GY        CT +  C++   +      C+  P + ++CRC  G+   G G +C  +    +E    + N +  ++ G                  D+D C  +   + C+ G C+N    YRCEC  GF   +  +AC++  E                         +C  G C      ++C C+ GY+    G  C+DI+EC  +P  C  G C+N PGSY C+C   F ++  P G  C D    N   +T      GI C    G       C C+ G    N  + C SV            + +   P  +       C++    C+  N     G F C CP G     ET +C  + +
Sbjct: 1158 CEDVNECQLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQGCVD-IDECTIMNGGCD--THCTN-SEGSYECSCSEGYALMPDLRTCAD-----IDECEDT-PDICDGGQCTNIPGEYRCLCYDGFMASMDMRTCID-VNECD-LNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGAHNCDLHAACVNAPGS-FKCRCRDGWE--GDGIKCIDVDECVTEEHNCNPNAECLNTPGSYRCSCKEGFNGDGFSCSDMDECADNV--NLCENGQCLNAPGGYRCECEMGFTPTEDSKACQDIDECNFQN--------------------ICVFGSCQNLPGMFRCVCDYGYELDRSGGNCTDINEC-FDPVNCINGVCVNLPGSYLCNCPPDFELN--PSGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPSVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDE 1655          

HSP 12 Score: 118.627 bits (296), Expect = 1.513e-26
Identity = 151/565 (26.73%), Postives = 233/565 (41.24%), Query Frame = 3
Query:  498 RCQCKPGFTGK--SCSEIVNGECFLSLS---RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFI--EIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGY------------------VKSLD----GKSCSKQSANKYDM----CRFYGPY--VCHFGKCI-ADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPR-SLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSD--QSEIGPTSSNEDSKSSQGDIDFCFYSY---YRDQCKGGAC-INMKNHYRCEC---LPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQ 2051
            RC CK GF G   SCS++   EC  +++    G C+  P G                     RCE   CE GF   E    CQDI+EC +  IC  G C N  G FRC+C   Y+ D    +C    +  + +  + G    CV+L   ++LC C P +                  + +LD    G SCS +           C   G +   C     + +  Y   C   +G+  +       + +D C    G+ C  G CV+    + C+C +GY  + + + C  I +      +C  G C     N Y C C P +  +  G  C  +           T  NE S +    +  C Y+    +   C+  AC     + Y+  C    PGF++D             T +  D+     +          +C NG CI    S++C+C  G+  +    +C DIDEC+   ++C +   CIN PGSY+C C  GF +   P G  C DRNEC E  ++C +G C +T GSF+C C++G+ ++  +  C+ + +   Q
Sbjct: 1393 RCSCKEGFNGDGFSCSDM--DECADNVNLCENGQCLNAPGGY--------------------RCE---CEMGFTPTEDSKACQDIDECNFQNICVFGSCQNLPGMFRCVCDYGYELDRSGGNCTDINECFDPVNCINGV---CVNLP-GSYLCNCPPDFELNPSGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPSVNSTEYKTLCPGGEGFRPNPI-TVILEDIDECQELPGL-CQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGICGPGTCYNTLGN-YTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNRPCE--ACPTPATSEYQLLCGNQAPGFIID-----------IHTGKPIDIDECREIPG--------ICANGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQRNANCINIPGSYRCECSAGFKLS--PSG-ACIDRNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMDIDECDRQ 1901          

HSP 13 Score: 109.383 bits (272), Expect = 1.143e-23
Identity = 111/414 (26.81%), Postives = 176/414 (42.51%), Query Frame = 3
Query:  684 RCEKGFIEIDGI--CQDINECQW-SQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQC---KGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
             C+ G+    G   C D++EC+  +  C     C+N  GSF+C C   ++ D ++  C+    +C    + C P  +C++ +  ++ C C  G+  + DG SCS       ++       +C  G+C+     Y+CEC  G+  + D K+C+  +D C   N  +C  G C +L   + C CD GY        CT I + +    C +G C+  P + Y C C P F     G  C         +      +   S   +I        R  C    GGA  N      CE  P     +    C     ++ N +  +        +C +    LC  G C+ +  S+QC+C  GY  + + ++C DIDEC+ +  IC  GTC N+ G+Y C C   +   N  GG  C D
Sbjct: 1311 HCQLGYFVKKGSTGCTDVDECEIGAHNCDLHAACVNAPGSFKCRCRDGWEGDGIK--CID-VDECVTEEHNCNPNAECLN-TPGSYRCSCKEGF--NGDGFSCSDMDECADNV------NLCENGQCLNAPGGYRCECEMGFTPTEDSKACQD-IDECNFQN--ICVFGSCQNLPGMFRCVCDYGYELDRSGGNCTDINECFDPVNCINGVCVNLPGS-YLCNCPPDFELNPSGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGV---GVTRASCCCSLGGAWGN-----PCELCPSVNSTEYKTLCPGGEGFRPNPITVILEDID---ECQELPG-LCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGICGPGTCYNTLGNYTCVCPPEYMQVN--GGNNCMD 1694          

HSP 14 Score: 102.449 bits (254), Expect = 1.380e-21
Identity = 101/399 (25.31%), Postives = 163/399 (40.85%), Query Frame = 3
Query:  684 RCEKGF--IEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            +C +G+        C DI+EC  + + C++G+C+N  GSF+C+C++ ++  P   +C+   +      N+C  GM C++    +  C C PG+  + +G+ C+       D C   G  +C  G+C+    +++CEC  G     DG+ C  T    T Y  +              +  C   +  +  + +C                C   P +G+   C P   P     + + + S  S  G T+   D      D D          C+ G C N++  YRC C  G+  D  G+ C +  E   N++                   LC+NG C  +  SY C C  G+    D + C DI+EC  NP I   G C N  GS+ C C  G  +
Sbjct:  519 KCHEGYQGTPTKQACIDIDECIVNGVMCRNGRCVNTDGSFQCICNAGFEISPDGKNCIDHDEC--ATTNMCLNGM-CINED-GSFKCICKPGFALAPNGRYCT-----DIDECHTSG--ICMNGRCVNTEGSFRCECPPGLAIDVDGRVCVDTHMRTTCYGAI-------------KMGVCSRPFPGAVTKSEC----------------CCANPEHGFGEPCQP--CPAFNSAEFQAVCS--SGPGITTDGRDINECALDPDI---------CQNGICENLRGSYRCICNIGYESDASGKNCVDINECLVNRL-------------------LCDNGMCRNTPGSYTCSCPKGFSFKADSETCEDINECDSNPCI--NGICRNIAGSFNCECSHGSKL 843          

HSP 15 Score: 102.449 bits (254), Expect = 1.391e-21
Identity = 151/582 (25.95%), Postives = 227/582 (39.00%), Query Frame = 3
Query:  684 RCEKGFIEIDGI-CQDINEC--QWSQICKSGKCINERGSFRCLCSSSYQFDPV----QADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQC-----------------------------DSGYTSSYD------RKKC--------TSICDLYP-------RSLCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTS--SNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE------YKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC----IESGSSYQCQCNT---GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC  G+ E DGI C D++EC  +      + +C+N  GS+RC C   +  D        +C      CE    L  PG          + C+C  G+  + D K+C        D C F    +C FG C      ++C C+ GY     G +C    D    ++ V C NG CV+L   Y+C C                             D G + S +      R  C         + C+L P       ++LCP G+   P P      +  EC+ LPG     +G  C           P     NE+++  + DID C  + +   C  G C N   +Y C C P ++    G  C +  +      +     N+++ + + K  C  +      N  C      + S YQ  C     G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +N+     C D +EC    +LC +N  C N  GS++C+C++G+  S     C+            E  +I   CSH  C  + G F C C NG     +  +C  + +
Sbjct: 1354 RCRDGW-EGDGIKCIDVDECVTEEHNCNPNAECLNTPGSYRCSCKEGFNGDGFSCSDMDECADNVNLCENGQCLNAPG---------GYRCECEMGFTPTEDSKACQD-----IDECNFQN--ICVFGSCQNLPGMFRCVCDYGYELDRSGGNC---TDINECFDPVNCINGVCVNLPGSYLCNCPPDFELNPSGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPSVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLC---QGGNCVNTFGSFQCECPAGYYLNEETRICE-DIDEC--TAHIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNRPCEACPTPATSEYQLLCGNQAPGFIIDIHTGKPIDIDECREIPGICANGVCINQIGSFRCECPMGFSYNNIL--LICEDIDECNSGDNLCQRNANCINIPGSYRCECSAGFKLSPSGA-CID---------RNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMDIDE 1897          

HSP 16 Score: 88.5817 bits (218), Expect = 2.460e-17
Identity = 118/461 (25.60%), Postives = 171/461 (37.09%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQ-LSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC+C  GF    TG  C +   G CF  + + +C +       ++K  CC      WG  C+ C L     G I            Q+ ++C  G      G                    +   +CE +PNLC  G  C++ S+ +  C C  GY     G SC        D C    P  C+F  C     +Y C C +GYI   DGK+CK   +  T+ +        CV+    + C+C SG+T         + C   P        C+  P + + C C  GF+    G  C                        D+D C  ++   +C+ G C NM   YRC C  G+V   Q   C +  E   NQ                    +C +  C  +  SY+C C +G+        C D++ECS+  + C  G C N+ G Y C C  GF
Sbjct: 2322 RCECNEGFEASATGTECIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPL----PGTI------------QYKKMCPLGPGYTTDG--------------------RDINECEVMPNLCKNGQ-CIN-SVGSFRCHCNVGYTNDFTGTSCIDM-----DECS-QSPKPCNF-LCKNTEGSYLCSCPRGYILQPDGKTCKDLDECSTKQHNC---QFLCVNTIGGFTCKCPSGFTQHQTACIDNNECSNQPNICGSRASCLNSPGS-FNCECQKGFSLDATGLNCD-----------------------DVDECGGNH---RCQHG-CQNMMGGYRCGCPQGYVQHYQWNQCVDENECTGNQ--------------------VCGSASCYNTLGSYKCVCPSGFDFEATAGGCQDVNECSMGNNPCSYG-CSNTDGGYLCGCPGGF 2685          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Zebrafish
Match: fbn2a (fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4])

HSP 1 Score: 182.57 bits (462), Expect = 1.570e-46
Identity = 177/633 (27.96%), Postives = 268/633 (42.34%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC--------------------QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI---------CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            +CQC    T    G+ C ++ +  CFL+    VC + P   +   ++CC    +AWG  C  C     E G  + D +C                     DINEC+  Q IC  GKC N  GSFRC C S +  D  + +C     +C   P++CG G  CV+ ++ +  C C PGY    +  K+C      + ++       +C+ G C     +YKC C  G+  S DG +C+  V+ C   +  +CPNG CV+L   Y C C+SGY ++ D K CT I         C+LY    C + +        Y C C  G++     + C                        D++ C      D C+GG C N+   Y C C  GF+     + C   ++    ++ND   +F    +C+   GSF+C+                             +  C+ +   Y C C  G+    DG  C+D+DEC+   S+C     C+N+ GSY C C DGF    +  G  C D +EC E   LC+NG C N  GS++C+C  G+  ++ ++ C  + + S Q        IC      C+   G+F C C  G +     G C  V + +D
Sbjct:  895 KCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCTQ-PVPGRFRMDMCCCTVGLAWGKDCDLCP----EPGTRQFDTLCPRGPGFANKGDFINGAIPSSSDINECKVFQSICVHGKCRNTIGSFRCRCDSGFALDTNEKNCTD-IDECMISPDVCGHGT-CVN-TLGSFQCDCFPGYESGIMMMKNCMDIDECERNL------SLCNGGTCENTDGSYKCVCPPGHHLSVDGSACED-VNECD-LSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGCTDIDECTIENGGCELY----CSNSE------GSYSCSCGQGYSLTPDQRTCS-----------------------DVNEC--EEVLDICEGGQCTNVPGAYHCLCYEGFMASVDMKTC---IDVNECELNDNICAFG---ECENTKGSFICHCDMGYAVKKGTSGCTDVNECEINSHNCDTHATCVNTPGHYHCSCGDGWFG--DGVKCADVDECANRTSVCSADAECVNTAGSYHCECSDGF----IGDGVICSDLDECAEDVDLCENGQCLNVPGSYRCECEMGFTHTSNRKTCRDIDECSFQN-------ICV--FGTCQNIPGMFRCICDEGYELDRTGGNCTDVDECLD 1455          

HSP 2 Score: 178.333 bits (451), Expect = 3.347e-45
Identity = 195/685 (28.47%), Postives = 279/685 (40.73%), Query Frame = 3
Query:  165 ILSVGLLSIFGLFFAHLQTVHG--ESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----------------EED-----QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL--GRCEKGFIE--IDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCP---NGKCVSL----------SNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYE--------------CRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNS 2045
            +++  +++ +G  F  L  V      ++CG    SF CC G++    G+ C +PIC + CG +G C RPN C C  G  A++C                  E+D     +             +N  N G      RC C  GFTG  C  +   G CF+ +    C         SK LCC     AWG  C++C      C +GFI     G CQD++EC+    +CK G+CIN  GS++C C   YQ       C +   +C  I   C  G  C++ S  +  C C  GYV S D   C  Q                H G C A   N +C        +     C +   +  R    +CP   +G  ++L           ND I    +G      + + T     +P+   P    IP+ +NG++              CR LP     G+   C  + SD      T   ED++    D+D C +    D C  G CIN    Y C C  GF+       C +                            LC NGRC+ +  S+QC CN+G++ S DG+ C D DEC+   ++C  G CIN  GS++C C  GFT+++   G  C D +EC  T  +C NG C NT GSF+C+C +G       + CV     S
Sbjct:    9 LVNHEIITTYGWLFGWLDVVFSFLSPNVCGSRLQSF-CCPGWKTLPGGNQCVVPICRSDCG-DGFCSRPNMCTCPGGQTATTCFTKSSKQCNIRCMNGGVCEDDYCQCPKGYTGSFCGQPVCEKNCQNGGHCIGPNRCACGYGFTGPQCERDYRTGPCFIQVHSRKCAGQSSEFVCSKALCCATVGQAWGHSCEQCPPISSPCTRGFIPNTRTGACQDVDECKVVPDLCKGGRCINTLGSYQCTCPVGYQQHVSILKC-EDVDECSTIERACEAGH-CIN-SAGSFSCVCPSGYVLSADRTRCLDQ----------------HTGICFASVVNGRCAHEISGRFNKIQCCCDRGRCWSQRTTHEMCPVPGSGDYITLFNLCFVFFVSPNDQILHPHNGNGQIKPQIRQTPQILQFPQI--PQ---IPRHDNGFKPQRPVVSVNETVNRCRLLPNLCLNGR---CIPMESDYRCDCNTGFKEDNRGECSDVDECEF----DPCANGNCINTPGSYYCRCHTGFLRVPDIDECLQN-------------------------GVLCKNGRCLNTEGSFQCICNSGFKLSPDGRNCVDHDECAAT-NMCLNGMCINEDGSFKCVCKPGFTLNS--SGRYCTDIDEC-RTPGVCMNGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRS 631          

HSP 3 Score: 150.214 bits (378), Expect = 2.768e-36
Identity = 157/560 (28.04%), Postives = 226/560 (40.36%), Query Frame = 3
Query:  717 ICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSY-QFDPVQADCVQRKKKCEQIPNLCGPGMDC---VSLSIYNHLCKCLPGYVKSLDG--KSCSKQSANKYD-MCRFYGPY--------------------VCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD------------NSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNN 2261
            IC+DI+EC  S  +C  G C N  G++ C+C   Y Q +        RK  C +  N    G  C   ++ +I + LC C     K+ +    +C     + Y  +C     +                    VC  G CI    ++ CEC  G++ +     C+  +D C+    V   N  C++    Y C+C  GY  +      DR +C     L   S+C  G C+  P  GYEC C  GF      + C                        DI+ C +      C  G C N    + C C  GF L               N   D+        +C  F S LC NGRC+ +  S+QC C  GY+ + DGK C D++EC+I P IC  GTC+N  GS++C C DG+ + +      C D NEC+E   +C  G C N+ GSF+C C  G++ S  K+ C   ++            +  Q ++T  +K C  CS   K   G     CP   DA  +  LC     I      IP     R D+N  + N
Sbjct: 1604 ICEDIDECVLSLGVCGPGTCYNTLGNYTCVCPQDYIQVNGGHRCMDMRKSLCYRSYN----GSACEHQLNFNITHRLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDECHEILGVCAHGVCINHMGSFHCECPTGFLYNDLLLICED-IDECSSREPVCQRNADCINRPGGYQCECSDGYILTPNGDCNDRNEC-----LETPSVCRHGDCVDIPG-GYECMCHTGFTVTPNRRMCV-----------------------DINECSHQ----PCGNGTCKNSVGSFNCICHHGFEL------------ATNNYCTDI-------DECAVFHSQLCRNGRCVNNVGSFQCLCREGYELTFDGKTCMDVNECTIIPGICAPGTCLNLDGSFRCVCPDGYIVQS----DHCVDVNECSEEPGICTYGTCFNSLGSFECVCKPGFVLSEDKRRCYDTRESFCFTRFENSKCSVPQAFNTTKAKCC--CSIMAKEGWGDPCELCPKEHDAAFQD-LCPFGHGI------IPGVGDTRVDLNECVEN 2093          

HSP 4 Score: 147.132 bits (370), Expect = 2.282e-35
Identity = 163/652 (25.00%), Postives = 261/652 (40.03%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSK-ELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQ----CDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER--------------VEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF--------------------------TIHNMPG---------------GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDV 2201
            RC+C  G T    G++C +  +   C+ ++ RG+C++ P+   ++K + CC     A+G+PC  C                 DINEC     IC +G C N RG+FRC+C+  Y+ D    +C+    +C     LC  G+ C ++   ++ C C  G++   D ++C   +      C          G C     ++ CEC+QG    S G  C  +V                 NG    +  C +L   +      CQ    C+ G+  S     C  +  C+++P  +C +G C+      ++C+C         G+ C  + S+                      CF +Y  D C        +    C C  G    K    C E                  K + +N    S S   +C  F S +C +G+C  +  S++C+C++G+    + K C+DIDEC I+P +C  GTC+N+ GS+QC CF G+                          T  N  G               G  C D NEC  +++LC NG C N  G++QC CNSGY ++   + C  + + + +            C  YC  S G + CSC  G     +   C+ V++  +V
Sbjct:  608 RCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLR-PFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSGTAITH-----ADINECALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLD-IDECVVNSLLCDNGL-CRNVP-GSYSCTCPAGFIFRHDTETCEDVNECVSSPCVN--------GVCKNSAGSFYCECSQGSKLDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCERGFAQSRG-ASCEDVNECEVFP-GVCHNGHCV-NTRGSFKCQCPESLTLDVTGRLCVDVRSEP---------------------CFLTYEEDVCTQPVPGRFRMDMCC-CTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGDFINGAIPSSSDINECKVFQS-ICVHGKCRNTIGSFRCRCDSGFALDTNEKNCTDIDECMISPDVCGHGTCVNTLGSFQCDCFPGYESGIMMMKNCMDIDECERNLSLCNGGTCENTDGSYKCVCPPGHHLSVDGSACEDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGCTDIDECTIEN---------GGCELYCSNSEGSYSCSCGQGYSLTPDQRTCSDVNECEEV 1207          

HSP 5 Score: 133.65 bits (335), Expect = 3.584e-31
Identity = 154/574 (26.83%), Postives = 220/574 (38.33%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQV--AWGDPCQRCELGR-------CEKGFIEIDGICQ---DINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCK-GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK-TQCD--KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKK--QDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
             C CKPGF      + C +     CF       C   P     +K  CC +      WGDPC+ C           C  G   I G+     D+NEC +  +IC +G+CIN  GSFRC C + Y  D     C    +    + N CG G    S  I    C C  G+     G   S +  N+        P +C F +CI    +Y+C C  GY    DG+ C+   +     +       +C +L   ++C C +G       + C    + L    +C +G+C+      Y C C  GF       QC                           FCF       C+   +     +  +C C  G     Q + C         ++      +++  T  D  K    +C NG CI    SY+C C  GY AS  G  C D+DEC ++P  C+   C N+ GSY CSC  G+T+ N      C D +EC      C+   C NT G F C+C +G+   ++    +C+S         D  P  +       C+ S G F C CP G 
Sbjct: 1995 ECVCKPGFVLSEDKRRCYDTRESFCFTRFENSKC-SVPQAFNTTKAKCCCSIMAKEGWGDPCELCPKEHDAAFQDLCPFGHGIIPGVGDTRVDLNECVENPEICVNGRCINMDGSFRCECPAGYTLDYTGTHCDDIDEC--SVRNPCGNGT--CSNVIGAFECLCEEGFEP---GPMMSCEDVNECGQ----NPLLCAF-RCINTFGSYECSCPSGYTLREDGRMCQDVDECAEDLHNCDSRGMECSNLIGTFMCVCPAGMIRRMSDEACQDENECLTQPGVCENGRCV-NTVGSYTCECGVGFKTDSSATQCLDYRKG---------------------FCFTEVLHTMCQMSSSSRVPVSRSQCCCNGGHGWGDQCELCPLPATANYKKLCPYGHGYAIDGTDIDECKLIPDVCANGACINMMGSYRCHCKPGYIASTAGTACVDVDECGMSPKPCNF-ICKNTEGSYACSCPRGYTLQN--DNRSCKDVDECQSRRHNCQFS-CMNTIGGFTCKCPAGFSQHHRAYIDECLS---------DLTPCGL----QGACQNSVGSFSCECPQGF 2516          

HSP 6 Score: 130.954 bits (328), Expect = 2.367e-30
Identity = 155/607 (25.54%), Postives = 249/607 (41.02%), Query Frame = 3
Query:  525 GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQV--AWGDPCQRCEL----------GRCEKGFIEI-DGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGP------TSSNEDSK-----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE-----YKTNQMNDVASSF-SLKTQC-------DKFGS--FLCNNGRCIESGSSYQCQCNTGYQASLD-GKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            G  C ++    C+ S +   C +H     ++  LCC ++ V  AW  PC  C +          G     +I+I  G  +DI+EC +   +C  G CIN  GSF C C + + ++ +   C +   +C     +C    DC++     + C+C  GY+ + +G        N  + C    P VC  G C+     Y+C C+ G+  + + + C   ++ C+      C NG C +    + C C  G+  + +   CT I  C ++   LC +G+C+    + ++C C  G+     GK C  +  ++  I P      T  N D              S   +D    S     C  G C N    + C C PGFVL +  + C +  E        N    V  +F + K +C       + +G    LC      E  +++Q  C  G+      G    D++EC  NP IC  G CIN  GS++C C  G+T+     G  C D +EC+   + C NG C N  G+F+C C  G+        C  V +                C+  C  + G + CSCP+G     +  +C  V +  +
Sbjct: 1644 GHRCMDMRKSLCYRSYNGSAC-EHQLNFNITHRLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDECHEILGVCAHGVCINHMGSFHCECPTGFLYNDLLLIC-EDIDECSSREPVCQRNADCINRP-GGYQCECSDGYILTPNGD------CNDRNEC-LETPSVCRHGDCVDIPGGYECMCHTGFTVTPNRRMCVD-INECSHQ---PCGNGTCKNSVGSFNCICHHGFELATN-NYCTDIDECAVFHSQLCRNGRCVNNVGS-FQCLCREGYELTFDGKTCMDV--NECTIIPGICAPGTCLNLDGSFRCVCPDGYIVQSDHCVDVNECSEEPGICTYGTCFNSLGSFECVCKPGFVLSEDKRRCYDTRESFCFTRFENSKCSVPQAFNTTKAKCCCSIMAKEGWGDPCELCPK----EHDAAFQDLCPFGHGIIPGVGDTRVDLNECVENPEICVNGRCINMDGSFRCECPAGYTLDYT--GTHCDDIDECS-VRNPCGNGTCSNVIGAFECLCEEGF-EPGPMMSCEDVNECGQNPL---------LCAFRCINTFGSYECSCPSGYTLREDGRMCQDVDECAE 2215          

HSP 7 Score: 117.472 bits (293), Expect = 3.236e-26
Identity = 134/536 (25.00%), Postives = 213/536 (39.74%), Query Frame = 3
Query:  687 CEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECL--PGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSF--------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGT-CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINS 2249
            C++G+ E+D   G C D++EC  S  C +G C N  GS++C C   ++ +P    CV  +              +C     YN    C       +   SC         + R +G    H        YN  C   +G+   +      + +D C    G VC  G CV+    + C+C +G+  +   + C  I + +    +C  G C     N Y C C   +  +  G +C                 D + S      C+ SY    C+     N+  H  C C    G   +K   AC        + +    + F +     K            +C +G CI    S+ C+C TG+  +    +C DIDECS    +C +   CIN PG YQC C DG+ +   P G  C DRNEC ET S+C++G C +  G ++C C++G+  +  ++ CV + + S+Q             +  CK S G F C C +G + +     C  + +       +  N R   ++ S
Sbjct: 1434 CDEGY-ELDRTGGNCTDVDECLDSLNCVNGHCENTAGSYQCNCPIDFELNPTGIGCVDTRVG------------NCFLEVAYNSKLACSAEIGFGVSRSSCC------CSLGRVWGYPCDHCPTLNTSEYNTLCPGGEGF-KPNPVTIILEDIDECQELPG-VCQGGNCVNTFGSFQCECPAGFYLNTQSRICEDIDECVLSLGVCGPGTCYNTLGN-YTCVCPQDYIQVNGGHRCM----------------DMRKS-----LCYRSYNGSACEHQLNFNIT-HRLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDECHEILGVCAHGVCINHMGSFHCECPTGFLYNDLLLICEDIDECSSREPVCQRNADCINRPGGYQCECSDGYIL--TPNG-DCNDRNECLETPSVCRHGDCVDIPGGYECMCHTGFTVTPNRRMCVDINECSHQPCG----------NGTCKNSVGSFNCICHHGFE-LATNNYCTDIDECAVFHSQLCRNGRCVNNVGS 1911          

HSP 8 Score: 112.464 bits (280), Expect = 1.370e-24
Identity = 162/683 (23.72%), Postives = 239/683 (34.99%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI--------VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRC-----------EKGF-IEIDG-ICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSAN------KYDMCRFYGPYVCHFGKC-----IADGYNYKCE-------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLC----------------------------NNGRCIESGSSYQCQCNTGYQASLDGKLCSDI--------------------------------------DECSINPSICDQGTCINSPGSYQ--CSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
             C C  GFT     + C +I         NG C  S+    C+ H +G +L+    C           Q C  GRC            +G+ +  DG  C D+NEC     IC  G C+N  GSFRC+C   Y    VQ+D      +C + P +C  G    SL  +  +CK  PG+V S D + C     +      +   C     +     KC       +G+   CE             C  G+         +  ++ C   N  +C NG+C+++   + C+C +GYT  Y    C  I +   R+ C +G C       +EC C  GF P                 GP  S ED      +   C +           CIN    Y C C  G+ L + G+ C++  E       D+ +  S   +C    G+F+C                             NGRC+ +  SY C+C  G++       C D                                       D+C + P        + +  +Y+  C    G+ I          D +EC     +C NG C N  GS++C C  GYI+S     CV V +              K C+  CK + G + CSCP G     +   C  V +
Sbjct: 1831 ECMCHTGFTVTPNRRMCVDINECSHQPCGNGTCKNSVGSFNCICH-HGFELATNNYCTDIDECAVFHSQLCRNGRCVNNVGSFQCLCREGYELTFDGKTCMDVNECTIIPGICAPGTCLNLDGSFRCVCPDGYI---VQSDHCVDVNECSEEPGICTYGTCFNSLGSFECVCK--PGFVLSEDKRRCYDTRESFCFTRFENSKCSVPQAFNTTKAKCCCSIMAKEGWGDPCELCPKEHDAAFQDLCPFGHGIIPGVGDTRVDLNECVE-NPEICVNGRCINMDGSFRCECPAGYTLDYTGTHCDDIDECSVRNPCGNGTC-SNVIGAFECLCEEGFEP-----------------GPMMSCEDVNECGQNPLLCAFR----------CINTFGSYECSCPSGYTLREDGRMCQDVDECA----EDLHNCDSRGMECSNLIGTFMCVCPAGMIRRMSDEACQDENECLTQPGVCENGRCVNTVGSYTCECGVGFKTDSSATQCLDYRKGFCFTEVLHTMCQMSSSSRVPVSRSQCCCNGGHGWGDQCELCP--------LPATANYKKLCPYGHGYAIDGT-------DIDECKLIPDVCANGACINMMGSYRCHCKPGYIASTAGTACVDVDECGMSP---------KPCNFICKNTEGSYACSCPRGYTLQNDNRSCKDVDE 2450          

HSP 9 Score: 110.538 bits (275), Expect = 5.093e-24
Identity = 128/523 (24.47%), Postives = 207/523 (39.58%), Query Frame = 3
Query:  702 IEIDG-ICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQCDK-----------------FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDID------ECSINPSI--------------------------CDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            + +DG  C+D+NEC  S  +C +G C+N  G+++C C+S YQ  P    C    +    I N  G  + C S S  ++ C C  GY  + D ++CS  +  +  +       +C  G+C      Y C C +G++AS D K+C    +     N  +C  G+C +    +IC CD GY        CT +  C++   +      C+  P + Y C C  G+   G G +C  +    +     S++ +  ++ G                  D+D C      D C+ G C+N+   YRCEC  GF      + C++  E     +       ++   F  +  CD+                   S  C NG C  +  SYQC C   ++ +  G  C D        E + N  +                          CD    +N+   Y   C  G      P      D +EC E   +C+ G C NT+GSFQC+C +G+  + + + C  + +
Sbjct: 1108 LSVDGSACEDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGCTDIDEC--TIENG-GCELYC-SNSEGSYSCSCGQGYSLTPDQRTCSDVNECEEVL------DICEGGQCTNVPGAYHCLCYEGFMASVDMKTCIDVNE--CELNDNICAFGECENTKGSFICHCDMGYAVKKGTSGCTDVNECEINSHNCDTHATCVNTPGH-YHCSCGDGW--FGDGVKCADVDECANRTSVCSADAECVNTAGSYHCECSDGFIGDGVICSDLDECAEDV--DLCENGQCLNVPGSYRCECEMGFTHTSNRKTCRDIDECSFQNICVFGTCQNIPGMF--RCICDEGYELDRTGGNCTDVDECLDSLNCVNGHCENTAGSYQCNCPIDFELNPTGIGCVDTRVGNCFLEVAYNSKLACSAEIGFGVSRSSCCCSLGRVWGYPCDHCPTLNT-SEYNTLCPGGEGFKPNPVTIILEDIDECQELPGVCQGGNCVNTFGSFQCECPAGFYLNTQSRICEDIDE 1610          

HSP 10 Score: 108.612 bits (270), Expect = 1.813e-23
Identity = 145/564 (25.71%), Postives = 211/564 (37.41%), Query Frame = 3
Query:  687 CEKGFIE--IDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLC---------------------GPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQ--SEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQD--CVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYF 2270
            C  G I    D  CQD NEC     +C++G+C+N  GS+ C C   ++ D     C+  +K     E +  +C                     G G  C      + + Y  LC    GY  ++DG           D C+   P VC  G CI    +Y+C C  GYIAS+ G +C   VD C         N  C +    Y C C  GYT   D + C  + +   R       C+     G+ C+C  GF+      Q  R   D+  S++ P                            GAC N    + CEC  GF LD  G  C +  E   +             +C +FG        C      ++C C  GY        C D +EC +N   C   +C N+ GS++C C  GFT    P    C D +EC    + C+ G C NT G F C C +GY  + + ++  C    D++  +      K  +      K S+ L      N ++ V    +C  +     V    P+++   R I+  L  V F
Sbjct: 2238 CPAGMIRRMSDEACQDENECLTQPGVCENGRCVNTVGSYTCECGVGFKTDSSATQCLDYRKGFCFTEVLHTMCQMSSSSRVPVSRSQCCCNGGHGWGDQCELCPLPATANYKKLCPYGHGY--AIDGT--------DIDECKLI-PDVCANGACINMMGSYRCHCKPGYIASTAGTACVD-VDECGMSPKPC--NFICKNTEGSYACSCPRGYTLQNDNRSCKDVDECQSRRHNCQFSCM-NTIGGFTCKCPAGFS------QHHRAYIDECLSDLTPCGLQ------------------------GACQNSVGSFSCECPQGFSLDSLGHNCDDVDECARDH------------RC-QFG--------CQNVAGGFRCSCPQGYTQHQQWNQCVDDNEC-LNADNCGSASCFNTLGSFKCGCPSGFTFD--PASTSCEDVDECGSFMNPCRYG-CSNTQGGFACGCPAGYYRAGQGRNLICADWTDDNPLRLVVAILKKLRPALDRVKCSSWLL-----NNIEVVRVQSVCVSIPANTVV---FPESLPHFRPISHHLPIVLF 2723          

HSP 11 Score: 105.531 bits (262), Expect = 1.632e-22
Identity = 108/394 (27.41%), Postives = 160/394 (40.61%), Query Frame = 3
Query:  684 RCEKGFIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDG 1862
            RC  GF+ +     DI+EC Q   +CK+G+C+N  GSF+C+C+S ++  P   +CV   +      N+C  GM C++    +  C C PG+  +  G+ C+       D CR   P VC  G+C+    +++CEC  G     DG++C  T    T Y  V    G C+                 + R    S C            C   P+  +             G+ C    +  S    T           DI+ C  +   D C  G C N++ ++RC C  G+  D+ G+ C +  E   N                   S LC+NG C     SY C C  G+    D + C D++EC  +P  C  G C NS GS+ C C  G
Sbjct:  492 RCHTGFLRV----PDIDECLQNGVLCKNGRCLNTEGSFQCICNSGFKLSPDGRNCVDHDEC--AATNMCLNGM-CINED-GSFKCVCKPGFTLNSSGRYCT-----DIDECRT--PGVCMNGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAV--KRGLCL---------------RPFQRAVTKSQC------------CCANPDYAF-------------GEPCHPCPAKHSGTAIT---------HADINEC--ALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLDIDECVVN-------------------SLLCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVSSP--CVNGVCKNSAGSFYCECSQG 796          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Zebrafish
Match: fbn2a (fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4])

HSP 1 Score: 169.859 bits (429), Expect = 1.195e-42
Identity = 196/722 (27.15%), Postives = 289/722 (40.03%), Query Frame = 3
Query:  177 GLLSIFGLFFAHLQTVHGES-------------------HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----------------EED-----QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL--GRCEKGFIE--IDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDY--ICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY-----ECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCA 2177
            G +++ G+    +  +HG++                   ++CG    SF CC G++    G+ C +PIC + CG +G C RPN C C  G  A++C                  E+D     +             +N  N G      RC C  GFTG  C  +   G CF+ +    C         SK LCC     AWG  C++C      C +GFI     G CQD++EC+    +CK G+CIN  GS++C C   YQ       C +   +C  I   C  G  C++ S  +  C C  GYV S D   C  Q                H G C A   N +C        +     C +   +  R    +CP    V  S++Y  IC   S  +   +     S       S+ P+ Q I  P+NG      + R  P      +  Q  R  +      P  S  ++      ++ C      + C  G CI M++ YRC+C  GF  D +G+ C +  E + +                      C NG CI +  SY C+C+TG+      + C DIDEC  N  +C  G C+N+ GS+QC C  GF +   P G  C D +EC   T++C NG+C N  GSF+C C  G+  ++  + C  +        +     +C   +  C  + G F C C  GL   ++   C 
Sbjct:   12 GFVALLGILTGKISGIHGKATVHIDGSQRRQKQESLRGPNVCGSRLQSF-CCPGWKTLPGGNQCVVPICRSDCG-DGFCSRPNMCTCPGGQTATTCFTKSSKQCNIRCMNGGVCEDDYCQCPKGYTGSFCGQPVCEKNCQNGGHCIGPNRCACGYGFTGPQCERDYRTGPCFIQVHSRKCAGQSSEFVCSKALCCATVGQAWGHSCEQCPPISSPCTRGFIPNTRTGACQDVDECKVVPDLCKGGRCINTLGSYQCTCPVGYQQHVSILKC-EDVDECSTIERACEAGH-CIN-SAGSFSCVCPSGYVLSADRTRCLDQ----------------HTGICFASVVNGRCAHEISGRFNKIQCCCDRGRCWSQRTTHEMCP----VPGSDEYLRICLVGSALSGYNEEDPEMSPHHHSSFSVSPNDQ-ILHPHNGNGQIKPQIRQTPQILQFPQIPQIPRHDNGFKPQRPVVSVNET------VNRC--RLLPNLCLNGRCIPMESDYRCDCNTGFKEDNRGE-CSDVDECEFDP---------------------CANGNCINTPGSYYCRCHTGFLRVPGKQTCIDIDECLQNGVLCKNGRCLNTEGSFQCICNSGFKLS--PDGRNCVDHDECA-ATNMCLNGMCINEDGSFKCVCKPGFTLNSSGRYCTDID-------ECRTPGVCM--NGRCVNTQGSFRCECFAGLTVGIDGRTCV 665          

HSP 2 Score: 139.428 bits (350), Expect = 3.947e-33
Identity = 166/595 (27.90%), Postives = 241/595 (40.50%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSK-ELCCGAFQVAWGDPCQRCELGR-------CEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKK-----------KCEQIPN----LCGPGM-------------DCVSLSIYNHLCKCLPG--YVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKC----------------IADGYNYKCE-------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI----CDL-YPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC-------RRIMSDQSEIGPTSSNE----DSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQAS-LDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RC+C  G T    G++C +  +   C+ ++ RG+C++ P+   ++K + CC     A+G+PC  C           C  G     DG  +DINEC     IC +G C N RG+FRC+C+  Y+ D    +C+   +            C  +P      C  G              +CVS    N +CK   G  Y +   G           D  +         G+C                +   +   CE       C +G+ A S G SC+  V+ C  + GV C NG CV+    + CQC    T     + C  +    C L Y   +C   Q +P       C C  G A    GK C        R        GP  +N+      ++   DI+ C    ++  C  G C N    +RC C  GF LD   + C +  E                         +C +G C+ +  S+QC C  GY++  +  K C DIDEC  N S+C+ GTC N+ GSY+C C  G   H    G  C D NEC  +++LC NG C N  G++QC CNSGY ++   + C 
Sbjct:  648 RCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLR-PFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSAEFQVLCASGVGFSADG--KDINECALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLDIDECVVNSLLCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVSSPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCERGF-AQSRGASCED-VNECEVFPGV-CHNGHCVNTRGSFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCT--QPVPGRFRMDMCCCTVGLA---WGKDCDLCPEPGTRQFDTLCPRGPGFANKGDVLTGRAVYKDINEC--KVFQSICVHGKCRNTIGSFRCRCDSGFALDTNEKNCTDIDECM-------------------ISPDVCGHGTCVNTLGSFQCDCFPGYESGIMMMKNCMDIDECERNLSLCNGGTCENTDGSYKCVCPPGH--HLSVDGSACEDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGCT 1208          

HSP 3 Score: 129.028 bits (323), Expect = 7.161e-30
Identity = 120/429 (27.97%), Postives = 181/429 (42.19%), Query Frame = 3
Query:  861 KCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSL--------KTQC------DKFGS--------------FLCNNG-----------------------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSG 1994
            +C  +PNLC  G  C+ +   ++ C C  G+ +   G+ CS     ++D C          G CI    +Y C C+ G++     ++C   +D C + NGV+C NG+C++    + C C+SG+  S D + C    +    ++C +G CI + +  ++C C PGF     G+ C                        DID C        C  G C+N +  +RCEC  G  +   G+ C +    ++     V     L        K+QC        FG                LC +G                        C     +++C CN GY++   G+ C DIDEC +N  +CD G C N PGSY C+C  GF   +      C D NEC   +S C NG+CKN+ GSF C+C+ G
Sbjct:  464 RCRLLPNLCLNGR-CIPME-SDYRCDCNTGFKEDNRGE-CSDVDECEFDPCAN--------GNCINTPGSYYCRCHTGFLRVPGKQTCID-IDECLQ-NGVLCKNGRCLNTEGSFQCICNSGFKLSPDGRNCVDHDECAATNMCLNGMCINE-DGSFKCVCKPGFTLNSSGRYCT-----------------------DIDECRTPGV---CMNGRCVNTQGSFRCECFAGLTVGIDGRTCVD-THMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSAEFQVLCASGVGFSADGKDINECALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLDIDECVVNSLLCDNGLCRNVPGSYSCTCPAGFIFRH--DTETCEDVNEC--VSSPCVNGVCKNSAGSFYCECSQG 847          

HSP 4 Score: 112.079 bits (279), Expect = 1.334e-24
Identity = 145/521 (27.83%), Postives = 221/521 (42.42%), Query Frame = 3
Query:  687 CEKGFIEID-GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQS-EIGPTSSNEDSKSSQG-DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICK-NTYGSF---QCQCNSGYISSNKKQDCVS--------VQDNSNQKYDTEPSKICKKCSH--YCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            C  GF E + G C D++EC++   C +G CIN  GS+ C C + +   P +  C+    +C Q   LC  G  C++    +  C C  G+  S DG++C       +D C      +C  G CI +  ++KC C  G+  +S G+ C   +D C R  GV C NG+CV+    + C+C +G T   D + C    D + RS C      G C+ P      + +C         G+ C    +  S E     ++    S+ G DI+ C  +   D C  G C N++ ++RC C  G+  D+ G+ C +  E   N                   S LC+NG C     SY C C  G+    D + C D++EC  +P  C  G C NS GS+ C C  G  + +   G  C D  + +   +L ++G C+ N  G+    QC    G    +  + C +         Q       D    ++     H  +C  + G F C CP  L   +   LC  V
Sbjct:  488 CNTGFKEDNRGECSDVDECEFDP-CANGNCINTPGSYYCRCHTGFLRVPGKQTCID-IDECLQNGVLCKNGR-CLNTE-GSFQCICNSGFKLSPDGRNCVD-----HDEC--AATNMCLNGMCINEDGSFKCVCKPGFTLNSSGRYCTD-IDEC-RTPGV-CMNGRCVNTQGSFRCECFAGLTVGIDGRTCV---DTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSAEFQVLCASGVGFSADGKDINEC--ALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLDIDECVVN-------------------SLLCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVSSP--CVNGVCKNSAGSFYCECSQGSKLDST--GLLCVDSVKGSCWLTL-QDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCERGFAQSRGASCEDVNECEVFPGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCVDV 965          

HSP 5 Score: 110.538 bits (275), Expect = 3.453e-24
Identity = 110/396 (27.78%), Postives = 166/396 (41.92%), Query Frame = 3
Query:  684 RCEKGFIEIDG--ICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDG 1862
            RC  GF+ + G   C DI+EC Q   +CK+G+C+N  GSF+C+C+S ++  P   +CV   +      N+C  GM C++    +  C C PG+  +  G+ C+       D CR   P VC  G+C+    +++CEC  G     DG++C  T    T Y  V    G C+                 + R    S C            C   P+  +   C P   P     + + + +  S +G ++  +D      D D          C  G C N++ ++RC C  G+  D+ G+ C +  E   N                   S LC+NG C     SY C C  G+    D + C D++EC  +P  C  G C NS GS+ C C  G
Sbjct:  526 RCHTGFLRVPGKQTCIDIDECLQNGVLCKNGRCLNTEGSFQCICNSGFKLSPDGRNCVDHDEC--AATNMCLNGM-CINED-GSFKCVCKPGFTLNSSGRYCT-----DIDECRT--PGVCMNGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAV--KRGLCL---------------RPFQRAVTKSQC------------CCANPDYAFGEPCHP--CPAKHSAEFQVLCA--SGVGFSADGKDINECALDPDI---------CSNGVCENLRGNFRCVCNIGYESDQSGRNCLDIDECVVN-------------------SLLCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVSSP--CVNGVCKNSAGSFYCECSQG 847          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Zebrafish
Match: FP102018.1 (latent transforming growth factor beta binding protein 3 [Source:NCBI gene;Acc:562912])

HSP 1 Score: 150.599 bits (379), Expect = 1.181e-36
Identity = 152/562 (27.05%), Postives = 234/562 (41.64%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVN-----GECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERG-----SFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCL------PGYV---KSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGY---TSSYDRKKCTSICDLYPRSLC-PDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMS-DQSEIGPTSSNEDS-------------KSSQG---DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKY 2057
            RC CKPG+  K  +  V      G CF  ++     +H    +LS+E+CC     AWG  C+RC            DG         +++IC +GK ++ +      +F+   +S    +P        + K  ++P      M    +S +      +      P  V      D    S+   +  D C+     +C  G C      + C C  GY + +  K C+         +   C  G C+++   Y C C  GY     S  ++ C+ I +     +C   GQCI Q    Y+C CLPGF   + K   C  I    + +I P    E++             ++ +G   DID C        C  G C N+   YRC C  GF+ +   + C++  E + N+                    LC NG CI +  S++CQC  GYQ + +G  C DI+EC    + C +G CIN+ GSY+C C  G+T+ N   G  C D NEC    SLC+ +G+C+N  G + C CN G+  S  K  C  ++ +  + Y
Sbjct:  313 RCTCKPGYVLKERTRCVAATVELGYCFRMVTETGKCEHALSTRLSQEMCCCTVGKAWGSNCERCPQ----------DGTAS------FNKICPAGKGMSLQTYHGTLTFQPFLTSIEHINP------DTEVKPPEVPIQTTTPMHLSPISTHGPRRPVIVAKPTTPPIVLVPPEADSHEVSQTQVSPMDECKL-NSNICGHGVCANTQNGFMCHCYPGYRSHALTKRCEDE----NECDAQPCGRGVCLNVLGSYKCNCHHGYRLSEISSGKRSCSDINECLNTEICGVGGQCINQ-QGSYKCECLPGFRKKIQKPPHCEDINECLEPDICPNEQCENTLGSYECLPCQPGYRAERGVCHDIDEC---KKHGVCLNGRCENLAGSYRCLCNEGFLPEANRKGCRDINECQDNR--------------------LCANGHCINTDGSFRCQCYAGYQPTQEGSHCEDINECK-RAANCQRGRCINTMGSYRCECQKGYTLEN---GRHCKDINECDGERSLCQPHGVCENRQGGYVCVCNDGFRLSEDKHSCEKIESDKKECY 819          

HSP 2 Score: 111.309 bits (277), Expect = 2.267e-24
Identity = 125/485 (25.77%), Postives = 190/485 (39.18%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKC-ECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLC----SDIDECSIN---PSICDQGTCINSPGS----------------YQCSCFDGFTIHNM-PGGPKCYDRNECTE---------------TTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+D NEC  +Q C  G C+N  GS++C C   Y+   + +     K+ C  I       +CG G  C++    ++ C+CLPG+ K +      ++  +  D+     P +C   +C     +Y+C  C  GY A    +     +D C ++   VC NG+C +L+  Y C C+ G+    +RK C  I +     LC +G CI   +  + C+C  G+ P  +G  C  I            NE  +++               C+ G CIN    YRCEC  G+ L+  G+ CK+  E                  CD   S    +G C      Y C CN G++ S D   C    SD  EC +N      CD     N                    Y C  +     H++ P G   Y   E  E               +  +CK G C NT   F+C C  G+   +   +C+ V +
Sbjct:  517 CEDENECD-AQPCGRGVCLNVLGSYKCNCHHGYRLSEISSG----KRSCSDINECLNTEICGVGGQCINQQ-GSYKCECLPGFRKKI------QKPPHCEDINECLEPDICPNEQCENTLGSYECLPCQPGYRAE---RGVCHDIDECKKHG--VCLNGRCENLAGSYRCLCNEGFLPEANRKGCRDINECQDNRLCANGHCI-NTDGSFRCQCYAGYQPTQEGSHCEDI------------NECKRAAN--------------CQRGRCINTMGSYRCECQKGYTLEN-GRHCKDINE------------------CDGERSLCQPHGVCENRQGGYVCVCNDGFRLSEDKHSCEKIESDKKECYLNLDDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVYRSAEYHSLCPIGRGFYHDQEKIEYGFVAHRDIDECVLFSNEICKEGRCMNTQPGFECYCQQGFYYDSNLLECIDVDE 938          

HSP 3 Score: 103.605 bits (257), Expect = 4.652e-22
Identity = 132/496 (26.61%), Postives = 188/496 (37.90%), Query Frame = 3
Query:  687 CEKGFIEIDGI--CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC----------------TSICDLYPRSLCPDGQCIPQPNNGY--ECRCLP----------GFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCS-----DIDECSINPSICDQGTCINSPGSYQCSCFDGFTI---HNMPGGPK-----------CYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            C +GF+       C+DINECQ +++C +G CIN  GSFRC C + YQ         Q    CE I N C                                K++AN            C  G+CI    +Y+CEC +GY    +G+ CK  ++ C     +  P+G C +    Y+C C+ G+  S D+  C                T  CD    +     +C      G+   C   P             P+G+G        DQ +I      E    +  DID C   +  + CK G C+N +  + C C  GF  D     C +      ++ +D +               LC NG C+ +  S+ C C+  +      K C       IDEC  +P+ C  G C+N+  SY C C   +T+    N    P+             D NEC E  S C+NG C NT GSF C C      S   + CV
Sbjct:  671 CNEGFLPEANRKGCRDINECQDNRLCANGHCINTDGSFRCQCYAGYQP-------TQEGSHCEDI-NEC--------------------------------KRAAN------------CQRGRCINTMGSYRCECQKGYTL-ENGRHCKD-INECDGERSLCQPHGVCENRQGGYVCVCNDGFRLSEDKHSCEKIESDKKECYLNLDDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVYRSAEYHSLCPIGRG-----FYHDQEKI------EYGFVAHRDIDECVL-FSNEICKEGRCMNTQPGFECYCQQGFYYDSNLLECID-----VDECHDES---------------LCINGHCVNTRGSFYCVCDPPWVPDAYNKKCVFPTIIGIDECQ-DPANCKNGQCVNTQDSYYCLCSPPWTLASDRNSCVTPEEQAVMGVSVVHLTDVNEC-EDPSYCRNGRCVNTPGSFHCICTQPLTFSAALKQCV 1078          

HSP 4 Score: 73.1738 bits (178), Expect = 1.138e-12
Identity = 118/548 (21.53%), Postives = 204/548 (37.23%), Query Frame = 3
Query:  669 RCELGRCEKGFIEIDG-ICQDINECQWSQ-ICKS-GKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMD------------------CVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT-----SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAK 2180
            RCE   C+KG+   +G  C+DINEC   + +C+  G C N +G + C+C+  ++    +  C    +K E     C   +D                  C S+ +                  Y+ LC    G+    +       +    D C  +   +C  G+C+     ++C C QG+   S+   C   VD C  ++  +C NG CV+    + C CD  +      KKC       I +    + C +GQC+    + Y C C P +        C     +Q+ +G       S     D++ C    Y   C+ G C+N    + C C          + C    + +T    D+        + D+    +C   R   + +  +C C+ G     + + C   +    N  +C+      S G  +      F+ +N  G     D +EC+     C NG C  +Y    C+CN+G++  + +  C  + + + +     P K  +     C  + G F C C  G  A     +C +
Sbjct:  750 RCE---CQKGYTLENGRHCKDINECDGERSLCQPHGVCENRQGGYVCVCNDGFRLSEDKHSC----EKIESDKKECYLNLDDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVYRSAEYHSLCPIGRGFYHDQEKIEYGFVAHRDIDECVLFSNEICKEGRCMNTQPGFECYCQQGFYYDSNLLECID-VDEC--HDESLCINGHCVNTRGSFYCVCDPPWVPDAYNKKCVFPTIIGIDECQDPANCKNGQCV-NTQDSYYCLCSPPWTLASDRNSCV-TPEEQAVMGV------SVVHLTDVNECEDPSY---CRNGRCVNTPGSFHCICTQPLTFSAALKQCV--YDDRTAAHKDICFQ-----EVDE--DHMCTMPRNELTVTYSECCCHYGRGWGPECRTCPMRNTVLFN-RLCEMHLETESDG--EGDFLAAFSTYNPEGDSSEEDSDECS-----CANGRCVRSYLGTMCECNTGFVLDHSRTRCTDIDECAGRGTGQSPCKNAR-----CINTFGSFRCQCKLGFVAARRPHVCLR 1254          

HSP 5 Score: 56.9954 bits (136), Expect = 9.968e-8
Identity = 36/107 (33.64%), Postives = 53/107 (49.53%), Query Frame = 3
Query:  552 GECFLSLS-RGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRCEL---------------GRCEKGFIEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSY 818
            G CF   + +  C  +P     ++E CCG+   +WG + C +C L                 C +G+  ++   CQDINEC  S +C +G+C+N RGSFRC C   Y
Sbjct:  214 GRCFQETTPKQACSSNPLPGLTNQEDCCGSVGNSWGQNKCYKCPLLPYTEKHQAIVEDFASTCPQGYKRLNSTHCQDINECMMSGVCWNGECLNTRGSFRCTCKPGY 320          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Zebrafish
Match: BX663503.3 (latent-transforming growth factor beta-binding protein 4 [Source:NCBI gene;Acc:100333499])

HSP 1 Score: 130.568 bits (327), Expect = 2.732e-30
Identity = 155/537 (28.86%), Postives = 224/537 (41.71%), Query Frame = 3
Query:  687 CEKGFI--EIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKC-ECNQGYIAS----SDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYEC-RCLPGFAPMGKGKQCRRIMSDQSEIGPTS-SNEDSKSSQGDIDFCFYSYYR---------------DQCKGGACINMKNHYRC-ECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQC-SCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIP 2216
            C  GFI     G CQD NEC  + + C  G+C+N  GSFRC+C + YQ +  Q  CV    +C Q+PN C  G      ++ +  C C  GY   L   SC        D+     P  C   +C+    +Y+C  C  G+       SD   C++T           CP+G+C + +  + C C +GY        C  + +    S CP  +C+      Y C  C PGF    +   C  I  D+    P+   N   +++ G       + YR                QC G  C+N +  YRC  C PGF L  +  AC +  E +  Q  D                 LC NGRC  +  SY C C  G++  L+  +C D++EC  N   C    C+NS GS++C SC  GF + +     +C D +EC+ T   C NG CKNT GSF+C C+ G+           +QD      D   S         C  ++G + C C  G  A      C  +++ ++  F  P
Sbjct:  576 CNTGFILNPQQGHCQDKNECVLTPRPCSVGECVNTPGSFRCVCPAGYQTNSQQTLCVD-LDECRQVPNPCINGR--CENTLGSFRCVCRTGY--KLQDNSC-------IDIDECVDPLRCPGKECVNSQGSYRCVSCRPGFDLLNGQCSDIDECRRTPS--------PCPDGRCENTAGSFRCSCRTGY--RLQANTCVDVNECEDPSQCPGQECL-NSQGSYRCVSCRPGFGL--RNGACSDI--DECRQTPSPCQNGLCENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGL--RNGACSDIDECR--QTPD-----------------LCVNGRCENTMGSYSCSCRPGFR--LEENICKDVNECE-NELQCPGMECVNSVGSFKCVSCKPGFQLLDG----QCQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGF----------HLQDGVCTDIDECVSDQVCGAQSVCVNTDGSYRCDCAPGYRAAGAGRQCRDINECLEGDFCFP 1047          

HSP 2 Score: 118.242 bits (295), Expect = 1.706e-26
Identity = 133/483 (27.54%), Postives = 193/483 (39.96%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGY---------------------------IASSDGKSCK----------KTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQC--QCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSG 1994
            C  GF   +G C DI+EC Q    C++G C N  GSFRC+C + Y+    Q        +CE  P+ C PG +C++         C PG+   L   +CS       D CR   P +C  G+C     +Y C C  G+                           + S    SCK          + VD C+R     C NG+C +    + C CD G+        CT I +     +C         +  Y C C PG+   G G+QCR I            NE  +      DFCF          G C+N    Y+C C  G+     G +C++  E   + +      ++   SF    +C      +C + RC  +  S+ C   C  GYQ +   + C D++EC+ N ++C     C N  G+Y C C  G+   +   G  C D NEC     +C +  C N  GSF C+C +G
Sbjct:  780 CRPGFGLRNGACSDIDECRQTPSPCQNGLCENTLGSFRCVCRTGYRL---QGGTCTDVNECED-PSQC-PGQECLNSQGSYRCVSCRPGF--GLRNGACSD-----IDECR-QTPDLCVNGRCENTMGSYSCSCRPGFRLEENICKDVNECENELQCPGMECVNSVGSFKCVSCKPGFQLLDGQCQDVDECSR-TPRRCTNGQCKNTPGSFRCVCDVGF--HLQDGVCTDIDECVSDQVCGAQSVCVNTDGSYRCDCAPGYRAAGAGRQCRDI------------NECLEG-----DFCF--------PRGECVNTDGSYKCVCSQGYKSVANGTSCQDVDECALDGVCQDGRCSNTEGSFLYVNECQDSTGLICGSQRCENTIGSFHCVASCEPGYQITSTAE-CVDVNECA-NETVCGAHAFCQNLIGTYHCLCDQGY--ESTGDGKICVDINECEAMQGVCGSARCWNVEGSFTCECENG 1217          

HSP 3 Score: 116.701 bits (291), Expect = 4.930e-26
Identity = 143/503 (28.43%), Postives = 207/503 (41.15%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYEC-RCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDS-KSSQGDIDFCFYSYYR---------------DQCKGGACINMKNHYRC-ECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQC-SCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGY------------------------ISSNKKQDCVS------VQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQF 2207
            Q  + CE  P +CGPG  C+ L    H C C  G++ +     C  Q  N+  +     P  C  G+C+    +++C C  GY  +S    C   +D C R     C NG+C +    + C C +GY        C  I +      CP  +C+      Y C  C PGF  +    QC  I  D+    P+   +   +++ G       + YR                QC G  C+N +  YRC  C PGF L  +  AC +  E +                        C NG C  +  S++C C TGY+  L G  C+D++EC  +PS C    C+NS GSY+C SC  GF + N      C D +EC +T  LC NG C+NT GS+ C C  G+                        ++S     CVS      + D   Q  D E S+  ++C++  CK + G F C C  G    L+ G+C  + + V  Q 
Sbjct:  547 QDVRVCESRPQVCGPGR-CIDLPGGRHTCVCNTGFILNPQQGHC--QDKNECVL----TPRPCSVGECVNTPGSFRCVCPAGYQTNSQQTLCVD-LDEC-RQVPNPCINGRCENTLGSFRCVCRTGY--KLQDNSCIDIDECVDPLRCPGKECV-NSQGSYRCVSCRPGFDLL--NGQCSDI--DECRRTPSPCPDGRCENTAGSFRCSCRTGYRLQANTCVDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGL--RNGACSDIDECRQTPSP-------------------CQNGLCENTLGSFRCVCRTGYR--LQGGTCTDVNECE-DPSQCPGQECLNSQGSYRCVSCRPGFGLRNG----ACSDIDECRQTPDLCVNGRCENTMGSYSCSCRPGFRLEENICKDVNECENELQCPGMECVNSVGSFKCVSCKPGFQLLDGQCQDVD-ECSRTPRRCTNGQCKNTPGSFRCVCDVGFH--LQDGVCTDIDECVSDQV 1002          

HSP 4 Score: 100.138 bits (248), Expect = 7.351e-21
Identity = 145/594 (24.41%), Postives = 236/594 (39.73%), Query Frame = 3
Query:  507 CKPGFTGK--SCSEI----------VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE----LGR-----CEKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQF-DPVQAD---CVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT-----------------------VDFCTRYNGVVCPNGKCVSLSNDYIC--QCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCEC---------LPGFVLDKQGQACKERVEYKTNQMND---------------VASSFSLKTQCDKFGS---FLCNNGRCIESGSS-YQCQC--NTGYQASLDGKL-CSDIDECSI-NPSICDQGTCINSPGSYQCSCFDG--FTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
            C+PGF  +  +CS+I          VNG C  ++    C   P G +L + +C    +      C   E    +G      C+ GF  +DG CQD++EC  + + C +G+C N  GSFRC+C   +   D V  D   CV  +        +CG    CV+    ++ C C PGY  +  G+ C        + C   G +    G+C+    +YKC C+QGY + ++G SC+                         V+ C    G++C + +C +    + C   C+ GY  +    +C  + +    ++C            Y C C  G+   G GK C                        DI+ C     +  C    C N++  + CEC         + G  L ++G A   R   ++                    +A + +L+  C   G     +C    C E+G++ +Q  C    GY  +  G     D+DEC + +P +C  GTC+N+   Y C C  G  +    +    +C D +EC E+   C  G C NT G+F C C    +  + +++CV+ 
Sbjct:  860 CRPGFGLRNGACSDIDECRQTPDLCVNGRCENTMGSYSCSCRP-GFRLEENICKDVNECENELQCPGMECVNSVGSFKCVSCKPGFQLLDGQCQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGFHLQDGVCTDIDECVSDQ--------VCGAQSVCVNTD-GSYRCDCAPGYRAAGAGRQC-----RDINEC-LEGDFCFPRGECVNTDGSYKCVCSQGYKSVANGTSCQDVDECALDGVCQDGRCSNTEGSFLYVNECQDSTGLICGSQRCENTIGSFHCVASCEPGYQIT-STAECVDVNECANETVCGAHAFCQNLIGTYHCLCDQGYESTGDGKICV-----------------------DINEC--EAMQGVCGSARCWNVEGSFTCECENGQEEFDPIAGRCLSREGTASASRSLPQSRPGEQKECYYGISQPYSCKILAVNTTLQECCCTAGQGWGLMCKYDICPEAGTAEFQTLCPNGKGYVTTEAGAFNYKDVDECKLFDPEVCKGGTCVNNIPGYACYCRSGSYYDTELL----ECTDNDEC-ESEDTCSGGRCVNTQGTFYCTCEPPLVLDDTQRNCVNA 1406          

HSP 5 Score: 63.5438 bits (153), Expect = 1.009e-9
Identity = 40/114 (35.09%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  558 CFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRCE-------LGRCEKGFIEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQ 872
            CF  +  G C     GL+ S+E+CC     AWG + C  C        L  C KGF  ++G  C DINEC     C++G C+N RGS+ C+C+  +  D     C+ +K   E+
Sbjct:  233 CFREVRNGQCSSPLPGLR-SQEMCCRGVGKAWGINECTLCPAISGESILSDCPKGFDRVNGTQCVDINECLQPGFCENGNCVNTRGSYSCVCNEGFLLDASHGICISQKVISEE 345          

HSP 6 Score: 59.6918 bits (143), Expect = 1.615e-8
Identity = 30/70 (42.86%), Postives = 37/70 (52.86%), Query Frame = 3
Query: 1677 CNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSI-CDQGTCINSPGSYQCSCFDGFTIHNMP 1883
            C NGRCI     Y C C  GYQ  +    C D+DEC    S+ C  G C+N+ GSY+C C  GF +   P
Sbjct: 1603 CENGRCIRVEEGYTCDCYDGYQLDITTMTCIDVDECEDEDSLDCINGRCVNTEGSYRCVCLRGFILSRRP 1672          

HSP 7 Score: 51.6026 bits (122), Expect = 4.719e-6
Identity = 84/356 (23.60%), Postives = 125/356 (35.11%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCE-QIPNLCG----PGMDCVSLSIYNHL----CKCLPGYVKSLDGKSCSKQSANKYD-MCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY-PRSLCPDGQCIPQPNNGYECRCLPGF--APMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQAS 1748
            C D +EC+    C  G+C+N +G+F C C      D  Q +CV      E +  N C      G+ C S  +   L    C CL G    L    C ++    Y+ +C  +GP            Y+ +      Y              +       + P G+   +  DY       Y+ +  R       D Y P    P G   P+    ++ R LP    A   +      +  D+ E GP    E    S G +        R  C+ G CI ++  Y C+C  G+ LD     C +  E                  C+   S  C NGRC+ +  SY+C C  G+  S
Sbjct: 1362 CTDNDECESEDTCSGGRCVNTQGTFYCTCEPPLVLDDTQRNCVNASGLTEDESLNFCWRHVTAGLVCQSPLLGAQLSFSECCCLYGEAWGLQCALCPRRDEEAYEALCNEFGP----------PPYSPR------YYERFGPGPLPGRGGY-------LPPYGRPDYIPTDY-----DDYSPAGGRSGVRYYEDDYDPAPGPPFGVPDPRGERMFDARPLPEAEEAESWRAPPPFPMFPDRRE-GPRRLYERRYDSYGSLSSEECGIVRG-CENGRCIRVEEGYTCDCYDGYQLDITTMTCIDVDE------------------CEDEDSLDCINGRCVNTEGSYRCVCLRGFILS 1669          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Xenopus
Match: abi1 (abl interactor 1 [Source:Xenbase;Acc:XB-GENE-942152])

HSP 1 Score: 228.409 bits (581), Expect = 3.752e-61
Identity = 214/790 (27.09%), Postives = 316/790 (40.00%), Query Frame = 3
Query:  162 MILSVGLLSIFGLFFAHLQTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSC-------------------DEE---DQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC--------------------------------------SKQSANKYDMCRFYGP-------------------YVCHFGKCIADGYNYKCECNQGYIASSDGK------------------------SCK--------------KTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE-------YKTNQ-----MNDVASS--------FSLKTQCD----------------------KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
             +L   +  +FG   + L+      ++CG   N++ CC G++    G+ C +PIC + CG +G C RPN C C  G IA SC                   DE+    +        +    +   N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GSF C C++ ++F+ +   C +   +C  IP +C  G +C + ++ ++ CKC PG+  S DG  C                                      S       DMC   G                     +C  G+CI    +Y+CECN+G+     G+                         CK              + +D C + NG +C NG+CV+    + C C++G+  S D K C  + +   R++C +G CI + +  ++C C PGF     G+ C                        DID C  +     C  G C+N +  +RCEC PG  +   G+ C +          YK  Q     +  V  S        F+    C                          S +C NG C     +Y+C CN GY  ++ GK C DIDEC++N  +CD G C N+PGS+ C+C  GF     P    C D +EC   ++ C NG+C+N  GSF C+C +G      K  C+  
Sbjct:   18 WLLESLVARLFGSSPSFLRVFSFRPNVCGSRYNAY-CCPGWKTLPGGNQCIVPICRHSCG-DGFCSRPNMCTCPTGQIAPSCGSKSIQQCNIRCMNGGTCSDEQCHCQKGYAGAHCGHPVCEQGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCQGGTCINTVGSFECKCAAGHRFNDITQKC-EDIDECSIIPGICESG-ECAN-TVGSYFCKCPPGFYTSADGSRCVDIRPGYCFTSLANGRCINQQPQTVTKTQCCCDSGRCWSPGPTTPPDMCPIRGTGKNFSLILQQITDYCALFRNLCLHGRCIPTPGSYRCECNKGFTLDGRGECIDVDECENNPCLHADCVNTPGSYICKCYPGFQSTSTRTECRDIDECLQ-NGRICNNGRCVNTDGSFHCVCNAGFQVSADGKNCEDMDECSVRNMCLNGMCINE-DGSFKCICKPGFQLAPNGRFCT-----------------------DIDECETAGI---CMNGHCVNTEGSFRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVRPLLGAVTKSECCCASTDFAFGEPCQPCPAKMSVSEQHFLLSIDINECALDSEICPNGICENLRGTYKCICNAGYDVAITGKSCVDIDECALNTLLCDNGQCRNTPGSFSCTCPSGFVYK--PDLKTCEDIDEC--ESNPCINGVCRNIPGSFVCECPTGSTLDKTKTICIET 770          

HSP 2 Score: 184.496 bits (467), Expect = 6.558e-47
Identity = 169/577 (29.29%), Postives = 244/577 (42.29%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK------------------------CEQIPNLCGPGMDCV---SLSIYNHLCKCLPGYVKS--LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            T   C E + G C+ ++  G C  +  G  L  + CC     AWG PC  CE    C KGF    G  C+D+NEC  +  +C +G+C+N  GSF C C S    D  +  C+  + +                        C  +    GP  D       + +  LC   PG+       GK+ SK      + CR   P +C +GKC     ++KC C+ G+   ++ ++C   +D C R +  VC  G CV+   D+ C C  GY S +   K C  I  C+  P  LC  G C+      ++C C PG                  E+ P        S+  DI+ C  S   D C+ G CIN+   Y+C C PG+ L     +C +     TN+ +           CD F         C  S  SY+C C  G+    D + C+DIDEC  NP+ICD G C N PG Y+C CF+G+   +      C D +EC    ++C +G C+NT GSF C C+ GY     +  C  + +     ++ +    C         + G F CSC  G 
Sbjct:  763 TKTICIETIKGTCWQNIVNGRCEININGGTLRSQ-CCSTLGAAWGSPCMPCEADPVCAKGFARSRGTTCEDVNECDVFPGLCTNGQCVNTMGSFVCQCPSGMTLDASKRTCLDIRLEICYLKHEDEECSAQIAGRHRMDACCCSVGAAWGPDCDECPEKGTTEFETLCPRGPGFASKEIAPGKTFSKD----INECRMI-PSLCKYGKCKNTIGSFKCRCDNGFALDAEERNCTD-IDEC-RISPDVCGQGNCVNTPGDFECDCFEGYESGFMMMKNCMDIDECERNPL-LCRGGICL-NTEGSFKCECPPGH-----------------EVAP------DNSACIDINECELS--TDLCRHGRCINLIGRYQCACEPGYQLTPDKLSCVD-----TNECD------FFNGGCDTF---------CTNSEGSYECHCRDGFALMPDHRSCTDIDECETNPNICDGGQCTNIPGEYRCLCFEGYMASD--DMKTCLDVDECELHLNICLSGSCENTKGSFICHCDPGYSGKKGQTGCTDINECEIGAHNCDRHATCTN-------TPGSFKCSCSPGW 1275          

HSP 3 Score: 159.844 bits (403), Expect = 3.718e-39
Identity = 172/624 (27.56%), Postives = 250/624 (40.06%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC------------------QDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--TSICDLYPRSLCPDGQC---IPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKK-QDCVSVQDNSN-----QKYDTE------------PSKICKKCSHY-------------CKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            CQC  G T     ++C +I    C+L      C     G     + CC +   AWG  C  C     EKG  E + +C                  +DINEC+    +CK GKC N  GSF+C C + +  D  + +C     +C   P++CG G +CV+ +  +  C C  GY           ++    D C    P +C  G C+    ++KCEC  G+  + D  +C    +     +  +C +G+C++L   Y C C+ GY  + D+  C  T+ CD +      +G C          YEC C  GFA M   + C  I  D+ E  P                       + C GG C N+   YRC C  G++     + C +  E +   +N                  +C +G C  +  S+ C C+ GY        C+DI+EC I    CD+  TC N+PGS++CSC  G+    +  G KC D +EC+  T LC  N  CKNT GS++C C  GY+       D     +N N     Q  +T             PS   K C                C+   GLF C C  G +     G C  V +
Sbjct:  857 CQCPSGMTLDASKRTCLDIRLEICYLKHEDEECSAQIAGRH-RMDACCCSVGAAWGPDCDECP----EKGTTEFETLCPRGPGFASKEIAPGKTFSKDINECRMIPSLCKYGKCKNTIGSFKCRCDNGFALDAEERNCTD-IDECRISPDVCGQG-NCVN-TPGDFECDCFEGYESGFM----MMKNCMDIDECE-RNPLLCRGGICLNTEGSFKCECPPGHEVAPDNSACIDINE--CELSTDLCRHGRCINLIGRYQCACEPGYQLTPDKLSCVDTNECDFF------NGGCDTFCTNSEGSYECHCRDGFALMPDHRSCTDI--DECETNP-----------------------NICDGGQCTNIPGEYRCLCFEGYMASDDMKTCLDVDECEL-HLN------------------ICLSGSCENTKGSFICHCDPGYSGKKGQTGCTDINECEIGAHNCDRHATCTNTPGSFKCSCSPGW----VGNGIKCSDLDECSNGTHLCSPNADCKNTMGSYRCLCKEGYVGDGFTCTDVDECSENLNLCGNGQCLNTPGGYRCDCDMGFLPSVDGKACEDIDECTLPNICVFGTCRNLPGLFRCDCDTGYELDRTGGNCTDVDE 1411          

HSP 4 Score: 159.844 bits (403), Expect = 4.091e-39
Identity = 144/474 (30.38%), Postives = 221/474 (46.62%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDF---CFYSYY--------RDQCKGGA--------CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNS 2045
            E GF+ +   C DI+EC+ + + C+ G C+N  GSF+C C   ++  P  + C+    +CE   +LC  G  C++L I  + C C PGY  + D  SC   +      C F+      F  C     +Y+C C  G+    D +SC   +D C   N  +C  G+C ++  +Y C C  GY +S D K C  +  C+L+  ++C  G C       + C C PG++  GK  Q      ++ EIG  + +  +  +     F   C   +          D+C  G         C N    YRC C  G+V D  G  C +  E   N +N                  LC NG+C+ +   Y+C C+ G+  S+DGK C DIDEC++ P+IC  GTC N PG ++C C  G+ +     G  C D +EC+E T +C +G C+NT GS+ C+C   +  +  +  CV  +  +
Sbjct: 1023 ESGFMMMKN-CMDIDECERNPLLCRGGICLNTEGSFKCECPPGHEVAPDNSACID-INECELSTDLCRHGR-CINL-IGRYQCACEPGYQLTPDKLSCVDTNE-----CDFFNGGCDTF--CTNSEGSYECHCRDGFALMPDHRSCTD-IDEC-ETNPNICDGGQCTNIPGEYRCLCFEGYMASDDMKTCLDVDECELH-LNICLSGSC-ENTKGSFICHCDPGYS--GKKGQTGCTDINECEIGAHNCDRHATCTNTPGSFKCSCSPGWVGNGIKCSDLDECSNGTHLCSPNADCKNTMGSYRCLCKEGYVGD--GFTCTDVDECSEN-LN------------------LCGNGQCLNTPGGYRCDCDMGFLPSVDGKACEDIDECTL-PNICVFGTCRNLPGLFRCDCDTGYELDRT--GGNCTDVDECSEPT-MCISGTCQNTPGSYTCECPPDFELNPTRVGCVDTRSGT 1454          

HSP 5 Score: 145.206 bits (365), Expect = 1.219e-34
Identity = 142/560 (25.36%), Postives = 233/560 (41.61%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKC-VSLSNDYI------------------CQCDSGYTSSYDRKKCTSI-----CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDV--------------ASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC+C PG      G+ C +  +   C+    RG C++   G     E CC +   A+G+PCQ C  ++   E+ F+    +  DINEC   S+IC +G C N RG+++C+C++ Y        CV    +C     LC  G      +  +  C C  G+V   D K+C        D C       C  G C     ++ CEC  G         C +T+   T +  +V  NG+C ++++   +                  C+ D      + R + T+      CD++P  LC +GQC+      + C+C  G       + C  I                      ++ C+  +  ++C       +   +R +     V    G  C E  E  T +   +                +FS      +    LC  G+C  +  S++C+C+ G+    + + C+DIDEC I+P +C QG C+N+PG ++C CF+G+    M     C D +EC     LC+ GIC NT GSF+C+C  G+  +     C+ + +
Sbjct:  566 RCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVRPLLGAVTKSECCCASTDFAFGEPCQPCPAKMSVSEQHFL----LSIDINECALDSEICPNGICENLRGTYKCICNAGYDVAITGKSCVD-IDECALNTLLCDNGQ--CRNTPGSFSCTCPSGFVYKPDLKTCED-----IDECE---SNPCINGVCRNIPGSFVCECPTGSTLDKTKTICIETIKG-TCWQNIV--NGRCEININGGTLRSQCCSTLGAAWGSPCMPCEADPVCAKGFARSRGTTCEDVNECDVFP-GLCTNGQCV-NTMGSFVCQCPSGMTLDASKRTCLDIR---------------------LEICYLKHEDEECSA----QIAGRHRMDACCCSVGAAWGPDCDECPEKGTTEFETLCPRGPGFASKEIAPGKTFSKDINECRMIPSLCKYGKCKNTIGSFKCRCDNGFALDAEERNCTDIDECRISPDVCGQGNCVNTPGDFECDCFEGYESGFMM-MKNCMDIDECERNPLLCRGGICLNTEGSFKCECPPGHEVAPDNSACIDINE 1079          

HSP 6 Score: 134.035 bits (336), Expect = 3.624e-31
Identity = 150/608 (24.67%), Postives = 224/608 (36.84%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQI----------CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCK-GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK----TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD----------------------------------------QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            C C  GF    TGK C ++    CF     G C          +E CC      WG PC+ C         ++ D   Q I       I          CK+G+CIN  GS+RC CS  Y       +C+   +    + N CG G  C ++ I    C C  G+     G   S +  N+        P +C F +C+    +Y+C+C  GY+   D + CK   +     +        C +L   Y+C C  GY    D + C  + +     +C +G+C+      Y+C CL GF                      +S  +++     + +CF       C+ G +  N      C C  G       + C  +   +  ++      F+       +C      +C NG+C+    +Y+C+CN GY   + G  C D+DECS +P  C+                                        Q  C+N+ G + C C  GFT H+      C D NEC    SLC   GIC+NT GS+ C C  G+        C  V +               +C H C+   G + CSCP G
Sbjct: 1942 CLCPEGFVLSSTGKRCQDLRVSFCFTKFEDGQCTSPKARNHSKQECCCALNGAGWGTPCELCP--------VDGDAALQQICPFGMGVIVGPDDERVDKCKNGQCINTDGSYRCECSFGYVLS--VDECIDIDEC--SVGNPCGNGT-CKNI-IGGFECTCEEGFEP---GPMMSCEDVNECAQ----NPLLCAF-RCVNTYGSYECKCPAGYVLREDKRMCKDQDECEDGTHDCESKQMTCKNLIGTYMCICGPGYQRRLDGEGCMDLNECLKPGICDNGKCV-NTMGSYKCDCLEGF---------------------NASATETECIDNRLGYCFTEVLHTMCQIGSSNRNSVTKSECCCNSGRGWGINCEICPFQGTVQFKKLCPYGKGFTTGGEDIDECQVLHG-ICRNGQCVNERGTYRCECNPGYTPDITGTSCIDLDECSQSPKPCNFICKNTDGSFQCSCPRGYILQEDGRSCKDLDECATKQHNCQFICVNTIGGFTCKCPPGFTQHHT----ACIDNNECASDVSLCGAKGICQNTPGSYSCDCQRGFTLDQSGAACEDVDECDGS----------HRCQHGCQNIVGGYRCSCPQG 2490          

HSP 7 Score: 120.553 bits (301), Expect = 5.269e-27
Identity = 136/516 (26.36%), Postives = 209/516 (40.50%), Query Frame = 3
Query:  720 CQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKT----------QCDKFGS-----------FLCNNGRCIESGSSYQCQCNTGYQAS---------------LDGKLCSDIDECSINPSI----------CDQGTCINSP---------GSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C DINEC+ S  +C+ G+CIN  G ++C C   YQ  P +  CV    +C+     C       + S  ++ C C  G+    D +SC+       D C    P +C  G+C      Y+C C +GY+AS D K+C   VD C  +  + C +G C +    +IC CD GY+    +  CT I  C++   +      C   P + ++C C PG+  +G G +C  +    +     S N D K++ G                  D+D C  S   + C  G C+N    YRC+C  GF+    G+AC++  E     +    +  +L            + D+ G             +C +G C  +  SY C+C   ++ +               LD K   D  + S +  I          C  G    +P           Y+  C  G      P      D +EC E   LC+ G C NT+GSFQC+C  GY  + + + C  V +
Sbjct: 1074 CIDINECELSTDLCRHGRCINLIGRYQCACEPGYQLTPDKLSCVD-TNECDFFNGGCDTF---CTNSEGSYECHCRDGFALMPDHRSCTD-----IDECE-TNPNICDGGQCTNIPGEYRCLCFEGYMASDDMKTCLD-VDECELHLNI-CLSGSCENTKGSFICHCDPGYSGKKGQTGCTDINECEIGAHNCDRHATCTNTPGS-FKCSCSPGW--VGNGIKCSDLDECSNGTHLCSPNADCKNTMGSYRCLCKEGYVGDGFTCTDVDEC--SENLNLCGNGQCLNTPGGYRCDCDMGFLPSVDGKACEDIDECTLPNICVFGTCRNLPGLFRCDCDTGYELDRTGGNCTDVDECSEPTMCISGTCQNTPGSYTCECPPDFELNPTRVGCVDTRSGTCYLDVKPRGDNGDVSCSNEIGVSVPKASCCCSLGKAWGTPCELCPAVNSSEYKVLCPGGEGFRPNPITVILEDIDECLELPGLCQGGKCINTFGSFQCRCPPGYYLNEETRVCDDVNE 1572          

HSP 8 Score: 117.472 bits (293), Expect = 4.574e-26
Identity = 131/548 (23.91%), Postives = 220/548 (40.15%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLS---RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFI-EIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGY------VKSLDGKSCS-------------KQSANKYDMCRFYGPYVCHFGKC---------IADGYNYKCECNQGY-IASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC CK G+ G   +     EC  +L+    G C+  P G                     RC+   C+ GF+  +DG  C+DI+EC    IC  G C N  G FRC C + Y+ D    +C    +  E  P +C  G      +  ++ C+C P +      V  +D +S +                +N+  +        C  GK            +   YK  C  G     +      + +D C    G+ C  GKC++    + C+C  GY  + + + C  + +     +C  G C     N Y C C P +  +  G  C   M  +  +   +   ++++  G++    Y+  +  C     I    H  CE  P    D+    C      +   + D+ +   +     +    +C NG CI    S++C+C  G+  +    +C DIDEC   P       C+N+PGSY+C C  G+   +     +C DRNEC E  ++C +G C +T G + C C++G+ ++  +  C+ + +
Sbjct: 1309 RCLCKEGYVGDGFTCTDVDECSENLNLCGNGQCLNTPGGY--------------------RCD---CDMGFLPSVDGKACEDIDECTLPNICVFGTCRNLPGLFRCDCDTGYELDRTGGNCTDVDECSE--PTMCISGT--CQNTPGSYTCECPPDFELNPTRVGCVDTRSGTCYLDVKPRGDNGDVSCSNEIGVSVPKASCCCSLGKAWGTPCELCPAVNSSEYKVLCPGGEGFRPNPITVILEDIDECLELPGL-CQGGKCINTFGSFQCRCPPGYYLNEETRVCDDVNECDQPGICGPGTCFNTVGN-YTCICPPDYMQVNGGNNC---MDMRRSLCFRNYYAENQTCDGEL---LYNMTKKMCCCSYNIGRAWHRPCEECPLPSTDEFASLCGSA---RPGFLIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPMGFFYNDKLLICEDIDECQNGPVCQRNADCVNTPGSYRCDCKPGYKFTST---GQCVDRNECQEIPNICSHGECTDTTGGYYCVCHNGFKTNEDQTMCLDINE 1815          

HSP 9 Score: 115.161 bits (287), Expect = 2.770e-25
Identity = 144/523 (27.53%), Postives = 206/523 (39.39%), Query Frame = 3
Query:  498 RCQCKPGF----TGK-----SCSEIVN----GECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQ----RCELG----RCEKGFI-EIDGICQDINECQW--SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT-VDFC-TRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCP------------------DGQCIPQPNNGYECRCLPGFA----------------PMGKGKQCRRIM-------SDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC CKPG+    TG+      C EI N    GEC  +     C+ H        +  C        DPC     +  +G    RC  GFI   +  C DI+EC     Q+C++G+C N  GSF CLC+  Y+             KC   P  C PG  C +L    + C C PGYV   D   C ++            P +C  G C     ++ C C +G++ SS GK C+   V FC T++    C + K  + S    C   +G       + C    D   + +CP                  +GQCI   +  Y C C  G+                 P G G  C+ I+        +  E GP  S ED      +   C +           C+N    Y C+C  G+VL +  + CK++ E +    +  +   + K                     +Y C C  GYQ  LDG+ C D++EC + P ICD G C+N+ GSY+C C +GF
Sbjct: 1753 RCDCKPGYKFTSTGQCVDRNECQEIPNICSHGECTDTTGGYYCVCHNGFKTNEDQTMCLDINECERDPCGNGTCKNTIGSYNCRCFDGFILSHNNDCIDIDECTTLNGQLCRNGQCNNTVGSFVCLCNEGYE-------------KCALDPGKCAPGT-CQNLD-GAYRCICPPGYVLE-DIDECVEE------------PEICALGTCSNVPGSFTCLCPEGFVLSSTGKRCQDLRVSFCFTKFEDGQCTSPKARNHSKQECCCALNGAGWGTPCELCPVDGDAALQQICPFGMGVIVGPDDERVDKCKNGQCI-NTDGSYRCECSFGYVLSVDECIDIDECSVGNPCGNGT-CKNIIGGFECTCEEGFEPGPMMSCEDVNECAQNPLLCAFR----------CVNTYGSYECKCPAGYVLREDKRMCKDQDECEDGTHDCESKQMTCKNLI-----------------GTYMCICGPGYQRRLDGEGCMDLNEC-LKPGICDNGKCVNTMGSYKCDCLEGF 2217          

HSP 10 Score: 111.694 bits (278), Expect = 3.258e-24
Identity = 147/587 (25.04%), Postives = 230/587 (39.18%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSL-SRG----VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE---------LGRCEKGFIE--IDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMC--RFYGPYVCHFGKCIAD------------GYNYKCECNQGYIASSDG-----------------KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCP-DGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDEC-SINPSICDQGTCINSPGSYQCSCFDGF-------------TIHNMPGGPKCY--------DRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C+C P F    T   C +  +G C+L +  RG    V   +  G+ + K  CC +   AWG PC+ C          L    +GF    I  I +DI+EC +   +C+ GKCIN  GSF+C C   Y  +     C     +C+Q P +CGPG  C + ++ N+ C C P Y++   G +C      +  +C   +Y       G+ + +            G  +   C +  + S+D                        +D C    GV C NG C+++   + C+C  G+  +     C  I +     +C  +  C+  P + Y C C PG+     G+   R  ++  EI                         + C  G C +    Y C C  GF  ++    C +  E + +                      C NG C  +  SY C+C  G+  S +   C DIDEC ++N  +C  G C N+ GS+ C C +G+             T  N+ G  +C         D +EC E   +C  G C N  GSF C C  G++ S+  + C  ++
Sbjct: 1432 CECPPDFELNPTRVGCVDTRSGTCYLDVKPRGDNGDVSCSNEIGVSVPKASCCCSLGKAWGTPCELCPAVNSSEYKVLCPGGEGFRPNPITVILEDIDECLELPGLCQGGKCINTFGSFQCRCPPGYYLNEETRVC-DDVNECDQ-PGICGPGT-CFN-TVGNYTCICPPDYMQVNGGNNCMDM---RRSLCFRNYYAENQTCDGELLYNMTKKMCCCSYNIGRAWHRPCEECPLPSTDEFASLCGSARPGFLIDIYTGLPVDIDECREIPGV-CENGVCINMVGSFRCECPMGFFYNDKLLICEDIDECQNGPVCQRNADCVNTPGS-YRCDCKPGYKFTSTGQCVDR--NECQEI------------------------PNICSHGECTDTTGGYYCVCHNGFKTNEDQTMCLDINECERDP---------------------CGNGTCKNTIGSYNCRCFDGFILSHNND-CIDIDECTTLNGQLCRNGQCNNTVGSFVCLCNEGYEKCALDPGKCAPGTCQNLDGAYRCICPPGYVLEDIDECVEEPEICALGTCSNVPGSFTCLCPEGFVLSSTGKRCQDLR 1961          

HSP 11 Score: 106.686 bits (265), Expect = 9.926e-23
Identity = 105/376 (27.93%), Postives = 159/376 (42.29%), Query Frame = 3
Query: 1083 CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMK----NHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGK-LCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C +G+I +    +C+  VD C    G+ C  G C++    + C+C +G+  +   +KC  I  C + P  +C  G+C       Y C+C PGF     G +C  I                        +CF S        G CIN +       +C C  G           +    +    N       +   C  F + LC +GRCI +  SY+C+CN G+  +LDG+  C D+DEC  NP  C    C+N+PGSY C C+ GF   +     +C D +EC +   +C NG C NT GSF C CN+G+  S   ++C  + + S +        +C   +  C   +G F C C  G         C  + +
Sbjct:  217 CRRGFIPNIRTGACQD-VDECQAIPGM-CQGGTCINTVGSFECKCAAGHRFNDITQKCEDIDECSIIP-GICESGECA-NTVGSYFCKCPPGFYTSADGSRCVDIRPG---------------------YCFTSL-----ANGRCINQQPQTVTKTQCCCDSGRCWSPGPTTPPDMCPIRGTGKNFSLILQQITDYCALFRN-LCLHGRCIPTPGSYRCECNKGF--TLDGRGECIDVDECENNP--CLHADCVNTPGSYICKCYPGF--QSTSTRTECRDIDECLQNGRICNNGRCVNTDGSFHCVCNAGFQVSADGKNCEDMDECSVR-------NMCL--NGMCINEDGSFKCICKPGFQLAPNGRFCTDIDE 546          

HSP 12 Score: 97.8265 bits (242), Expect = 6.065e-20
Identity = 150/580 (25.86%), Postives = 220/580 (37.93%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINEC-QWSQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC------TSICDLYPRS---------------------------------------------LCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQ---CKGGACINMKNHYRCECLPGFVLDKQGQACKE-------RVEYKTNQMND--VASSFSLKTQCDKFGSFLCNNGRCIE----SGSSYQCQCNT---GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C  G++     C D++EC   + +C  +  C N  GS+RCLC   Y  D      V    +C +  NLCG G  C++ +   + C C  G++ S+DGK+C        D C    P +C FG C      ++C+C+ GY     G +C   VD C+     +C +G C +    Y C+C   +  +  R  C      T   D+ PR                                              LCP G+   P P      +  EC  LPG      GK      S Q    P     +      D++ C      DQ   C  G C N   +Y C C P ++    G  C +       R  Y  NQ  D  +  + + K  C  +      +  C E    S   +   C +   G+   +   L  DIDEC   P +C+ G CIN  GS++C C  GF  ++      C D +EC       +N  C NT GS++C C  GY  ++  Q CV            E  +I   CSH  C  + G + C C NG     +  +C  +++
Sbjct: 1271 CSPGWVGNGIKCSDLDECSNGTHLCSPNADCKNTMGSYRCLCKEGYVGDGFTCTDVD---ECSENLNLCGNGQ-CLN-TPGGYRCDCDMGFLPSVDGKACED-----IDECTL--PNICVFGTCRNLPGLFRCDCDTGYELDRTGGNCTD-VDECSEP--TMCISGTCQNTPGSYTCECPPDFELNPTRVGCVDTRSGTCYLDVKPRGDNGDVSCSNEIGVSVPKASCCCSLGKAWGTPCELCPAVNSSEYKVLCPGGEGFRPNPITVILEDIDECLELPGLCQ--GGKCINTFGSFQCRCPPGYYLNEETRVCDDVNEC------DQPGICGPGTCFNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCFRNYYAENQTCDGELLYNMTKKMCCCSYNIGRAWHRPCEECPLPSTDEFASLCGSARPGFLIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPMGFFYNDKL--LICEDIDECQNGPVCQRNADCVNTPGSYRCDCKPGYKFTSTGQ-CVD---------RNECQEIPNICSHGECTDTTGGYYCVCHNGFKTNEDQTMCLDINE 1815          

HSP 13 Score: 89.7373 bits (221), Expect = 1.753e-17
Identity = 100/421 (23.75%), Postives = 156/421 (37.05%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPY----------------VCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE-----------------YKTNQMNDVASSFSLKTQCDK---FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            C D+NEC    IC +GKC+N  GS++C C   +     + +C+  +      E +  +C  G      S+    C C  G    ++ + C  Q   ++     YG                  +C  G+C+ +   Y+CECN GY     G SC   +D C++       N  C +    + C C  GY    D + C  + +   +       C+     G+ C+C PGF               Q       +NE       D+  C           G C N    Y C+C  GF LD+ G AC++  E                 Y+ +        +      D+     +  C    C  +  S++C C TG+Q       C D++ECS + + C  G C N+ G Y C C  G+
Sbjct: 2185 CMDLNECLKPGICDNGKCVNTMGSYKCDCLEGFNASATETECIDNRLGYCFTEVLHTMCQIGSS-NRNSVTKSECCCNSGRGWGINCEICPFQGTVQFKKLCPYGKGFTTGGEDIDECQVLHGICRNGQCVNERGTYRCECNPGYTPDITGTSCID-LDECSQSPKPC--NFICKNTDGSFQCSCPRGYILQEDGRSCKDLDECATKQHNCQFICV-NTIGGFTCKCPPGFT--------------QHHTACIDNNE----CASDVSLCGAK--------GICQNTPGSYSCDCQRGFTLDQSGAACEDVDECDGSHRCQHGCQNIVGGYRCSCPQGYLQHYQWNQCVDENECLNAHACGGASCHNTLGSFKCMCPTGFQFEQFAGACQDVNECSSSQAPCSFG-CSNTEGGYVCGCPPGY 2573          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Xenopus
Match: FBN2 (fibrillin 2 (congenital contractural arachnodactyly) [Source:NCBI gene;Acc:100494368])

HSP 1 Score: 192.971 bits (489), Expect = 1.282e-49
Identity = 161/543 (29.65%), Postives = 239/543 (44.01%), Query Frame = 3
Query:  501 CQCKPG----FTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGP-------------------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++  G C  +  G  L  E CC     AWG PC+RCE+   C +GF  + G+ C+D+NEC+ +  +C +G C+N +GSF C C      D     C+  + +   +       +  V        C C  G     + + C K  + ++++    GP           G+      N+G + S  G+   K ++ C  + G+ C NGKC +    + C+C++G+    + + CT I  C + P  LC  G CI  P + +EC C  GF +     K C  I  D+ E  P                    + +E + S    +D    +   + C+ G C+N+   Y+C C PG+      QA  +R+        D+     +   CD           C  S  SY+C C  GY    D + C+DIDEC  NP ICD G C N PG Y+C CFDGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  785 CECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSE-CCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNECEVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGP-----------GFT-----NRGDVLS--GRPFYKDINECKAFPGI-CTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISP-DLCGSGTCINTPGS-FECECFEGFESGFMMMKNCMDI--DECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGY------QATLDRL-----GCTDIDECTIMNGGCDT---------HCTNSEGSYECSCLEGYALMPDKRTCTDIDECEDNPDICDGGQCTNIPGEYRCLCFDGFMASMDM---KTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDE 1280          

HSP 2 Score: 167.162 bits (422), Expect = 1.654e-41
Identity = 163/579 (28.15%), Postives = 243/579 (41.97%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNE---------------DSKSSQGDIDFCFY----SYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN--------DVASSFSLKTQCDKFGSFL-------CNNG--------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C  G T    G+ C ++    CFL      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  IC +GKC N  GSF+C C++ +  D  + +C     +C   P+LCG G  C++ +  +  C+C  G+           ++    D C    P +C  G+CI    ++ C C  G+  +  G +C    +     N  +C NGKCV++   Y C C+ GY ++ DR  CT I +    +   D  C       YEC CL G+A M   + C  I  D+ E  P   +                D   +  D+  C          + C  G C N K  + C C  G+ + K    C +  E + +  N        +V  SF    +    G+ +       C NG         C+ +  SY C C  GY    DG  CSD+DEC+ N ++C+ G C+N PGSY+C C  GFT  +      C D +EC    ++C  G C N  G F+C CN GY       +C  V +
Sbjct:  890 CECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECV-HPVPGKFRLDACCCAVGAAWGTECEECP----KPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTD-IDECRISPDLCGSGT-CIN-TPGSFECECFEGFESGFM----MMKNCMDIDECE-RNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDN--LCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDIDECTIMNGGCDTHCT-NSEGSYECSCLEGYALMPDKRTCTDI--DECEDNPDICDGGQCTNIPGEYRCLCFDGFMASMDMKTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIGNGIKCNDLDECLNGTHRCSVSAHCLNTPGSYHCSCAEGYTG--DGFTCSDVDECTENINLCENGQCLNIPGSYRCECDMGFTPAS--DSRSCQDIDECA-FQNICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVDE 1445          

HSP 3 Score: 158.303 bits (399), Expect = 1.113e-38
Identity = 174/614 (28.34%), Postives = 235/614 (38.27%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVC-MKHPYGLQLSKELCCGAFQVAWGDPCQRCE-------LGRCEKGFIEIDGIC---QDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR------------------------------------RIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF     G C +   Y    +K  C       WGDPC+ C           C  G   I GI    +D+NEC +   IC +G CIN  GSFRC C   Y  D    +CV   +    I N CG G    + +I    C C  G+     G     +  N+        P +C F +CI     Y+C C  GYI   D K CK   +    ++        C +L   ++C C  G     D + C   + C   P  +C +G+C+      Y C C  GF     G +C                                     R   +Q EI P       K          +   DID C      + C+ G CIN    YRC C PG+  D  G AC +  E                +Q  K  +F+C N     +  SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC   +++C   G+C+N+ GSF C+C  GY   +   +C  V +               +C H C+   G + CSCP G
Sbjct: 1950 QCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDEC--SIGNPCGNGT--CTNAIGTFECLCDEGFEP---GPMMVCEDINEC----ILNPLLCAF-RCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKP-GICENGRCV-NTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDEC--KVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDEC---------------SQSPKPCNFICKN-----TEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGN----------HRCQHGCQNIVGGYRCSCPQG 2512          

HSP 4 Score: 141.739 bits (356), Expect = 1.567e-33
Identity = 149/525 (28.38%), Postives = 218/525 (41.52%), Query Frame = 3
Query:  687 CEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPG-MDC---VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR----RIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR------DQCK-------GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSF------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTET-TSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLE 2162
            C +G+ E+D   G C D++EC     C +G C+N  G + C C   +Q +P    CV  R   C       G G + C   + + +    C C  G       + C   ++  + MC+   P +C  G CI    +++CEC QGY  S + + C+  +D C  + GV  P G C +   +Y C C S Y        C  +     +S C       +  NG  C     F    K   C     +  S   E  PT    + K   G I    +  +       D+CK        G CIN    +RCEC  GF  +     C+         +  +   F L    D++ +       +C++G C+++  SY C CN G++ S D  +C DIDEC   P  C  GTC N+ GSY C C+ GF I HN      C D +EC+     +C+NG C N  GSF C CN GY  +   ++C+ + +         P          C+   G F C CP G +   E
Sbjct: 1427 CNEGY-ELDRTGGNCTDVDECADPINCVNGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSYIF-MCQEL-PGLCQGGNCINTFGSFQCECPQGYYLSEETRICED-IDECFTHPGVCGP-GTCYNTLGNYTCICPSEYMQVNGGHNCMDM----RKSFC------YRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLYIDEYRNECLEIPNVCSHGTCVDTEGSYHCVCNNGFKVSPDQTMCMDIDECERQP--CGNGTCKNTVGSYNCLCYPGFEITHNN----DCLDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNCIDINECVAFPGSCSPGT--------CQNLEGSFRCICPPGYEVERE 1922          

HSP 5 Score: 140.584 bits (353), Expect = 3.804e-33
Identity = 163/671 (24.29%), Postives = 242/671 (36.07%), Query Frame = 3
Query:  687 CEKGFIEIDG--ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK------------CEQIPNLCGPGMDCVSLSIYNHLCKCLP---------------GYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEI---GPTSSNE------------------DSKSSQG----------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-RVEY------KTNQMNDVASSFSLKT--------------QCDKFGS------------------------------------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------------PGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C+ GF+       C DI+ECQ   IC +G CIN  GSFRC C            CV    +                P        C +   Y     C P               G   ++DG+  ++ + +         P +C  G C     +++C CN G+ + S GK+C   +D C   N ++C NG C +    Y C C  GY    D + C  I +    S C +G C       + C C PG      G  C           I   + E+   G T  +E                  D    +G          D++ C    +   C  G C+N K  + CEC  G  LD  G+ C + R+E+      +   ++ V   F L                +C K GS                                     +C NG+C  +  S++C+CN G+   ++ + C+DIDEC I+P +C  GTCIN+PGS++C CF+GF    M                                         P G  C D NEC  + +LC+NG C N  G++QC CN GY ++  +  C  +          E + +   C  +C  S G + CSC  G   + +   C  + +  D
Sbjct:  553 CKPGFVLASNGRYCTDIDECQTPGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMRSTCYGGIKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAEFQGLCSGGVGITVDGRDINECALD---------PDICANGICENLRGSFRCNCNSGFESDSTGKNCID-IDECL-VNRLLCDNGLCRNTPGSYSCTCPKGYVFRSDSETCEDI-NECESSPCVNGACR-NILGSFNCECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNEC--EVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISPDLCGSGTCINTPGSFECECFEGFESGFMMMKNCMDIDECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDID---------ECTIMNGGCDTHCTNSEGSYECSCLEGYALMPDKRTCTDIDECED 1199          

HSP 6 Score: 130.568 bits (327), Expect = 4.367e-30
Identity = 156/588 (26.53%), Postives = 221/588 (37.59%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSL-SRG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC-----------EL-GRCEKG------------------FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV-QRKKKC----------EQIPNLCGPGMDCVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGY-------IASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L+  +RG   +      G+ +S+  CC +   AWG+PC+ C           EL G C+ G                    E   IC+DI+EC     +C  G C N  G++ C+C S Y       +C+  RK  C           ++P      M C + +I                  + HLC  +PG+   +         A   D C+   P +C  G CI    +++CEC  G+       +   +  S K+T+   T Y  ++                    Y   Y R +C  I      ++C  G C+      Y C C  GF          ++  DQ+                DID C     R  C  G C N    Y C C PGF +               N   D+    SL  Q       +C NG C     S+ C CN GY+ + DGK C DI+EC   P  C  GTC N  GS++C C  G+ +        C D +EC E  ++C  G C NT GSFQC C  G++ S   + C   +
Sbjct: 1465 ECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSYIFMCQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDI-----HTGKAVDIDECKEI-PGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLL-------------------YIDEY-RNECLEI-----PNVCSHGTCV-DTEGSYHCVCNNGF----------KVSPDQTMCM-------------DIDEC----ERQPCGNGTCKNTVGSYNCLCYPGFEITHN------------NDCLDIDECSSLYGQ-------VCRNGHCFNEIGSFICLCNEGYELTPDGKNCIDINECVAFPGSCSPGTCQNLEGSFRCICPPGYEVERE----NCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTR 1970          

HSP 7 Score: 128.642 bits (322), Expect = 1.766e-29
Identity = 137/518 (26.45%), Postives = 216/518 (41.70%), Query Frame = 3
Query:  717 ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--------TSICDLYP-------RSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQC-RRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            +C+DINEC  + +  + +CIN  G++ C C + Y     Q  C    +  E   +    GM C +L I   +C C PG V+  DG+ C  ++      CR   P +C  G+C+    +Y+C+CN+G+ ++  G  C  T              G C S     +CQ  S   +   + +C         + C++ P       + +CP G           EC+ +P     G   QC   I S +    P  + +   ++  D+D C  S     C    C N +  Y+C C  G++L + G++CK+  E +T Q N      +    F+ K                +C    +     G C  S  S+ C+C  GY     G  C D+DEC  N   C  G C N  G Y+CSC  G+  H      +C D NEC  + + C +  C NT GS++C C +G+  +     C  V + ++ K           C++ C  + G ++C CP G   V
Sbjct: 2120 VCEDINECILNPLLCAFRCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNL-IGTFMCICPPGMVRRPDGEGCMDENE-----CRTK-PGICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQ------------GFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNG---QCINNIGSYRCFCNPGYTTDIGGTACVDLDEC--SQSPKPCNF-ICKNTEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGN-HRCQHG-CQNIVGGYRCSCPQGYIQHYQWN--QCVDENECA-SQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSK---------NPCNYGCSNTEGGYLCGCPPGYYRV 2598          

HSP 8 Score: 106.301 bits (264), Expect = 1.600e-22
Identity = 89/282 (31.56%), Postives = 124/282 (43.97%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEE----------------------DQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSA 995
            ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS G I+ +C  +                       +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GS+ C C   ++       C +   +C  IP +C  G    S +I ++ C C  GYV S DG  C  Q +
Sbjct:   15 NVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSTGQISPNCGSKTIQQCSVRCMNGGTCVEDHCQCQKGYVGAHCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVSNQMCQGQVTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRSGACQDVDECQAIPGLCQGGNCINTDGSYECRCPVGHKQSETTQKC-EDIDECTTIPGVCNGGE--CSNTIGSYYCICPRGYVTSGDGSRCIDQRS 291          

HSP 9 Score: 100.138 bits (248), Expect = 1.146e-20
Identity = 116/474 (24.47%), Postives = 178/474 (37.55%), Query Frame = 3
Query:  687 CEKGF-IEIDGICQDINECQ--WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGM---------------------DCVSL-----------------SIYNHLCKCLPGYVKSLDGKSC--SKQSA--NKYD--MCRFYGPYVCHFGKC-----IADGYNYKCE-------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNE 1913
            C  GF I  +  C DI+EC   + Q+C++G C NE GSF CLC+  Y+  P   +C+    +C   P  C PG                      +C+ +                 +  +  C C PG+V S +G+ C  ++QS    +++   C     Y     KC       +G+   CE             C  G+         ++ V+ C    G+ C NG C++    + C+C  GY   Y    C    +    + C +G C       +EC C  GF P                 GP    ED      +   C +           CIN    Y C C  G++L +  + CK+        +++    F     C+  G        C     ++ C C  G     DG+ C D +EC   P IC+ G C+N+ GSY+C C +GF   + P G +C D  +
Sbjct: 1829 CYPGFEITHNNDCLDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNCID-INECVAFPGSCSPGTCQNLEGSFRCICPPGYEVERENCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGI-CANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDECSIGNPCGNGTCT-NAIGTFECLCDEGFEP-----------------GPMMVCEDINECILNPLLCAFR----------CINTYGAYECTCPAGYILREDQKMCKD--------LDECIEGFH---DCESRGMV------CKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKPGICENGRCVNTIGSYRCDCNEGF--QSTPSGTECLDTRQ 2253          

HSP 10 Score: 67.3958 bits (163), Expect = 1.278e-10
Identity = 98/412 (23.79%), Postives = 152/412 (36.89%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVC-MKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC----------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFY-----GPYVC--------HFGKCIADGY-------------------NYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI----------------------------------------PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE---IGPTSSNEDSKSSQG 1454
            RC C  GF    +G  C +   G CF  + + +C M       ++K  CC      WG+ C+ C L     G  +   +C          +DI+EC+    +C++G+CIN  GS+RC C+  Y  D     CV   + C Q P  C     C +    ++ C C  GY+   DGKSC    +   K   C+F      G + C        H   CI +                     ++ CEC +GY   S G +C+  VD C   +   C +G C ++   Y C C  GY   Y   +C    +   ++ C    C                                              GY C C PG+  +G+G     I  ++ +   +G  +S +++ S +G
Sbjct: 2232 RCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPL----PGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDE-CSQSPKPCN--FICKNTE-GSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCED-VDECGGNH--RCQHG-CQNIVGGYRCSCPQGYIQHYQWNQCVDENECASQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGIGFNRGQYLPVGKENSEDNALSPEG 2631          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Xenopus
Match: FBN2 (fibrillin 2 (congenital contractural arachnodactyly) [Source:NCBI gene;Acc:100494368])

HSP 1 Score: 192.586 bits (488), Expect = 1.403e-49
Identity = 161/543 (29.65%), Postives = 239/543 (44.01%), Query Frame = 3
Query:  501 CQCKPG----FTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGPT-------------------SSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++  G C  +  G  L  E CC     AWG PC+RCE+   C +GF  + G+ C+D+NEC+ +  +C +G C+N +GSF C C      D     C+  + +   +       +  V        C C  G     + + C K  + ++++    GP           G+      N+G + S  G+   K ++ C  + G+ C NGKC +    + C+C++G+    + + CT I  C + P  LC  G CI  P + +EC C  GF +     K C  I  D+ E  P                    + +E + S    +D    +   + C+ G C+N+   Y+C C PG+      QA  +R+        D+     +   CD           C  S  SY+C C  GY    D + C+DIDEC  NP ICD G C N PG Y+C CFDGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  803 CECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSE-CCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNECEVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGP-----------GFT-----NRGDVLS--GRPFYKDINECKAFPGI-CTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISP-DLCGSGTCINTPGS-FECECFEGFESGFMMMKNCMDI--DECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGY------QATLDRL-----GCTDIDECTIMNGGCDT---------HCTNSEGSYECSCLEGYALMPDKRTCTDIDECEDNPDICDGGQCTNIPGEYRCLCFDGFMASMDM---KTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDE 1298          

HSP 2 Score: 178.718 bits (452), Expect = 3.482e-45
Identity = 171/621 (27.54%), Postives = 261/621 (42.03%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C+C  G T    G+ C ++    CFL      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  IC +GKC N  GSF+C C++ +  D  + +C     +C   P+LCG G  C++ +  +  C+C  G+           ++    D C    P +C  G+CI    ++ C C  G+  +  G +C    +     N  +C NGKCV++   Y C C+ GY ++ DR  CT I +    +   D  C       YEC CL G+A M   + C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+ S+  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C+D+DEC      C     C+N+PGSY CSC +G+T      G  C D +ECTE  +LC+NG C N  GS++C+C+ G+  ++  + C  + + + Q        IC      C    G+F C C  G +     G C  V +  D
Sbjct:  908 CECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECV-HPVPGKFRLDACCCAVGAAWGTECEECP----KPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTD-IDECRISPDLCGSGT-CIN-TPGSFECECFEGFESGFM----MMKNCMDIDECE-RNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDN--LCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDIDECTIMNGGCDTHCT-NSEGSYECSCLEGYALMPDKRTCTDI--DECEDNP-----------------------DICDGGQCTNIPGEYRCLCFDGFMASMDMKTCIDVNEC------DINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIG--NGIKCNDLDECLNGTHRCSVSAHCLNTPGSYHCSCAEGYTGD----GFTCSDVDECTENINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQDIDECAFQN-------ICV--FGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECAD 1466          

HSP 3 Score: 161.384 bits (407), Expect = 1.140e-39
Identity = 196/722 (27.15%), Postives = 285/722 (39.47%), Query Frame = 3
Query:  168 LSVGLLSIFGLFFAHLQTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEE----------------------DQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC---KKTVDFCTRYNG--------------VVCPNGKCVSLSNDYICQCDSGYTSSYDR-----KKCTSICDLYPRSLCPDGQ-CIPQPN-NGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            + +G  +I GL            ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS G I+ +C  +                       +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI       +I         +SG C                         Q   +C+ IP LC  G +C++    ++ C+C  G+ +S      + Q     D C    P VC+ G+C     +Y C C +GY+ S DG  C   +  V F +  NG                C +G+C +L +     C    T  Y R               P    P G   IP P  NG+     PG    G   Q   I       G   +   S S+Q   +      Y + C  G CI   N YRCEC  G+  D Q +                          D+  S  C NG C+ +  SY C+C++G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +   P G  C D +EC+ TT++C NG+C N  GSF+C C  G++ ++  + C  +        + +   IC   + +C  + G F C CP GL   ++  +C   
Sbjct:    9 IIIGYFTIVGLVSDM------GPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSTGQISPNCGSKTIQQCSVRCMNGGTCVEDHCQCQKGYVGAHCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVSNQMCQGQVTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIP------NI---------RSGAC-------------------------QDVDECQAIPGLC-QGGNCINTD-GSYECRCPVGHKQSE-----TTQKCEDIDECTTI-PGVCNGGECSNTIGSYYCICPRGYVTSGDGSRCIDQRSGVCFSSLVNGHCAQEQAGRFTKMQCCCESGRCWALGSIPE-MCPIRGTDEYRRLCIEGVPFGGPGGFVPNGFGPGGTGFIPGPGGNGFH----PGIGGTGIDGQGPVIN------GGVGTLLFSFSAQLLSNDYICKQYPNLCLNGRCIPNLNSYRCECNMGYKQDTQTEC----------------------IDVDECTSNPCTNGDCVNTPGSYYCKCHSGFQRTPTKQACIDIDECIQNGILCKHGRCVNTEGSFQCICNAGFEL--TPDGKNCADHDECS-TTNMCLNGMCINEDGSFKCICKPGFVLASNGRYCTDID-------ECQTPGICM--NGHCINTEGSFRCDCPPGLAIGVDGRVCVDT 629          

HSP 4 Score: 157.918 bits (398), Expect = 1.385e-38
Identity = 175/615 (28.46%), Postives = 236/615 (38.37%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR------------------------------------RIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF     G C   P     +K  CC +      WGDPC+ C           C  G   I GI    +D+NEC +   IC +G CIN  GSFRC C   Y  D    +CV   +    I N CG G    + +I    C C  G+     G     +  N+        P +C F +CI     Y+C C  GYI   D K CK   +    ++        C +L   ++C C  G     D + C   + C   P  +C +G+C+      Y C C  GF     G +C                                     R   +Q EI P       K          +   DID C      + C+ G CIN    YRC C PG+  D  G AC +  E                +Q  K  +F+C N     +  SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC   +++C   G+C+N+ GSF C+C  GY   +   +C  V +               +C H C+   G + CSCP G
Sbjct: 1948 QCICPPGFVLSENGRRCFDTRQSFCFTRFENGKC-SVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDEC--SIGNPCGNGT--CTNAIGTFECLCDEGFEP---GPMMVCEDINEC----ILNPLLCAF-RCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKP-GICENGRCV-NTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDEC--KVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDEC---------------SQSPKPCNFICKN-----TEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGN----------HRCQHGCQNIVGGYRCSCPQG 2510          

HSP 5 Score: 142.124 bits (357), Expect = 1.366e-33
Identity = 171/675 (25.33%), Postives = 247/675 (36.59%), Query Frame = 3
Query:  687 CEKGFIEIDG--ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLC-KCLPGYVKSLD----------GKSC----SKQSANKYDMCRFYG--------------PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEI---GPTSSNE------------------DSKSSQG----------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-RVEY------KTNQMNDVASSFSLKT--------------QCDKFGS------------------------------------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------------PGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C+ GF+       C DI+ECQ   IC +G CIN  GSFRC C            CV    +     + C  G       I   LC +  PG V   +          G+ C     + SA  Y     YG              P +C  G C     +++C CN G+ + S GK+C   +D C   N ++C NG C +    Y C C  GY    D + C  I  C+  P   C +G C       + C C PG      G  C           I   + E+   G T  +E                  D    +G          D++ C    +   C  G C+N K  + CEC  G  LD  G+ C + R+E+      +   ++ V   F L                +C K GS                                     +C NG+C  +  S++C+CN G+   ++ + C+DIDEC I+P +C  GTCIN+PGS++C CF+GF    M                                         P G  C D NEC  + +LC+NG C N  G++QC CN GY ++  +  C  +          E + +   C  +C  S G + CSC  G   + +   C  + +  D
Sbjct:  572 CKPGFVLASNGRYCTDIDECQTPGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMR-----STCYGG-------IKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAYMYLKRDSYGASITLLDINECALDPDICANGICENLRGSFRCNCNSGFESDSTGKNCID-IDECL-VNRLLCDNGLCRNTPGSYSCTCPKGYVFRSDSETCEDINECESSP---CVNGACR-NILGSFNCECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNEC--EVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISPDLCGSGTCINTPGSFECECFEGFESGFMMMKNCMDIDECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDID---------ECTIMNGGCDTHCTNSEGSYECSCLEGYALMPDKRTCTDIDECED 1217          

HSP 6 Score: 128.642 bits (322), Expect = 2.027e-29
Identity = 137/518 (26.45%), Postives = 216/518 (41.70%), Query Frame = 3
Query:  717 ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--------TSICDLYP-------RSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQC-RRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            +C+DINEC  + +  + +CIN  G++ C C + Y     Q  C    +  E   +    GM C +L I   +C C PG V+  DG+ C  ++      CR   P +C  G+C+    +Y+C+CN+G+ ++  G  C  T              G C S     +CQ  S   +   + +C         + C++ P       + +CP G           EC+ +P     G   QC   I S +    P  + +   ++  D+D C  S     C    C N +  Y+C C  G++L + G++CK+  E +T Q N      +    F+ K                +C    +     G C  S  S+ C+C  GY     G  C D+DEC  N   C  G C N  G Y+CSC  G+  H      +C D NEC  + + C +  C NT GS++C C +G+  +     C  V + ++ K           C++ C  + G ++C CP G   V
Sbjct: 2118 VCEDINECILNPLLCAFRCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNL-IGTFMCICPPGMVRRPDGEGCMDENE-----CRTK-PGICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQ------------GFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNG---QCINNIGSYRCFCNPGYTTDIGGTACVDLDEC--SQSPKPCNF-ICKNTEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGNHR-CQHG-CQNIVGGYRCSCPQGYIQHYQWN--QCVDENECA-SQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSK---------NPCNYGCSNTEGGYLCGCPPGYYRV 2596          

HSP 7 Score: 121.324 bits (303), Expect = 3.214e-27
Identity = 155/555 (27.93%), Postives = 215/555 (38.74%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSL-SRG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE-LGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT-VDFCTR-YNGVVCPN-----------------GKCVS-----------LSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR-RIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L+  +RG   +      G+ +S+  CC +   AWG+PC+ C  +  C+K FI +           W                       YQ+  +          C+++P LC  G +C++ +  +  C+C  GY  S + + C        D C F  P VC  G C     NY C C   Y+  + G +C      FC R YNG  C N                 GK  S            +  ++C    G+T      K   I  C   P  +C +G CI Q  + + C C  GF+       C     S +  I   +         G+  F   S      +   CIN    YRCEC  GF L   G AC            D+    SL  Q       +C NG C     S+ C CN GY+ + DGK C DI+EC   P  C  GTC N  GS++C C  G+ +        C D +EC E  ++C  G C NT GSFQC C  G++ S   + C   +
Sbjct: 1483 ECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFILVPRY--------W-----------------------YQYQELL-----NIFMCQELPGLC-QGGNCIN-TFGSFQCECPQGYYLSEETRICED-----IDEC-FTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIP-GICTNGVCINQIGS-FRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLCLGENRFHRISGDYFCQRNADCINSPGTYRCECSTGFKLLPNG-ACI-----------DIDECSSLYGQ-------VCRNGHCFNEIGSFICLCNEGYELTPDGKNCIDINECVAFPGSCSPGTCQNLEGSFRCICPPGYEVER----ENCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTR 1968          

HSP 8 Score: 119.013 bits (297), Expect = 1.917e-26
Identity = 147/538 (27.32%), Postives = 215/538 (39.96%), Query Frame = 3
Query:  687 CEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPG-MDC---VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYD------------------MCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR----RIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR------DQCK-------GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQC--DKF----GSFLCN-NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDEC-SINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            C +G+ E+D   G C D++EC     C +G C+N  G + C C   +Q +P    CV  R   C       G G + C   + + +    C C  G       + C   ++ K                    MC+   P +C  G CI    +++CEC QGY  S + + C+  +D C  + GV  P G C +   +Y C C S Y        C  +     +S C       +  NG  C     F    K   C     +  S   E  PT    + K   G I    +  +       D+CK        G CIN    +RCEC  GF  +     C+         +  +   F L      ++F    G + C  N  CI S  +Y+C+C+TG++   +G  C DIDEC S+   +C  G C N  GS+ C C +G+ +   P G  C D NEC      C  G C+N  GSF+C C  GY    ++++C+ + +        E   IC      C  + G F C CP G 
Sbjct: 1445 CNEGY-ELDRTGGNCTDVDECADPINCVNGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFILVPRYWYQYQELLNIFMCQEL-PGLCQGGNCINTFGSFQCECPQGYYLSEETRICED-IDECFTHPGVCGP-GTCYNTLGNYTCICPSEYMQVNGGHNCMDM----RKSFCY------RTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLCLGENRFHRISGDYFCQRNADCINSPGTYRCECSTGFKLLPNGA-CIDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYEL--TPDGKNCIDINECVAFPGSCSPGTCQNLEGSFRCICPPGY--EVERENCIDIDEC------IEEPNICL--FGACSNTPGSFQCICPPGF 1955          

HSP 9 Score: 103.605 bits (257), Expect = 1.042e-21
Identity = 138/552 (25.00%), Postives = 206/552 (37.32%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGA--FQVAWGDP-CQR------------CELGRCEKGF-IEIDGICQDINECQ--WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGM---------------------DCVSL-----------------SIYNHLCKCLPGYVKSLDGKSC--SKQSA--NKYD--MCRFYGPYVCHFGKC-----IADGYNYKCE-------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNE 1913
            RC+C  GF+      +  G  F SL   +     Y + L   LC G   F    GD  CQR            CE   C  GF +  +G C DI+EC   + Q+C++G C NE GSF CLC+  Y+  P   +C+    +C   P  C PG                      +C+ +                 +  +  C C PG+V S +G+ C  ++QS    +++   C     Y     KC       +G+   CE             C  G+         ++ V+ C    G+ C NG C++    + C+C  GY   Y    C    +    + C +G C       +EC C  GF P                 GP    ED      +   C +           CIN    Y C C  G++L +  + CK+        +++    F     C+  G        C     ++ C C  G     DG+ C D +EC   P IC+ G C+N+ GSY+C C +GF   + P G +C D  +
Sbjct: 1756 RCECPTGFSYNDLLLVCEGNNF-SLKETITQITIYFILL---LCLGENRFHRISGDYFCQRNADCINSPGTYRCE---CSTGFKLLPNGACIDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNCID-INECVAFPGSCSPGTCQNLEGSFRCICPPGYEVERENCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGI-CANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDECSIGNPCGNGTCTNAIGT-FECLCDEGFEP-----------------GPMMVCEDINECILNPLLCAFR----------CINTYGAYECTCPAGYILREDQKMCKD--------LDECIEGFH---DCESRGMV------CKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKPGICENGRCVNTIGSYRCDCNEGF--QSTPSGTECLDTRQ 2251          

HSP 10 Score: 84.7297 bits (208), Expect = 6.576e-16
Identity = 147/635 (23.15%), Postives = 241/635 (37.95%), Query Frame = 3
Query:  684 RCEKGFIEIDGI--CQDINECQW-SQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA--PMGKGKQCRRI--------------MSDQSEIGPTSSNEDSKSSQGDI----------------DFCFYSYYRDQ----------------CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN-------------------------QMN------DVASSFSLKT----QCDKFGSF-----LC----NNGR--------CIESGSS---YQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMP---GGPKCYDRNECTETT-----SLC----------------KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
             C+ G+    G   C D++EC+  +  C     C+N  GSF+C C   +  + ++ +      +C    + C     C++     H C C  GY    DG +CS       ++       +C  G+C+    +Y+CEC+ G+  +SD +SC+  +D C   N  +C  G C +L   + C C+ GY        CT + +      C +G C+  P   YEC C P F   P G G    R+              +S  +EIG   S      S G                   F     Y  Q                C+GG CIN    ++CEC  G+ L ++ + C++  E  T+                         Q+N      D+  SF  +T     CD    F     +C    N G+        C   G++   + C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++     G     +   T+ T      LC                +N  C N+ G+++C+C++G+        C+ + + S+        ++C+  + +C    G F+C C  G +   +   C  +++ V
Sbjct: 1279 HCQVGYAVKKGTTGCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIGNGIKCN---DLDECLNGTHRCSVSAHCLNTPGSYH-CSCAEGYTG--DGFTCSDVDECTENI------NLCENGQCLNIPGSYRCECDMGFTPASDSRSCQD-IDECAFQN--ICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECADPINCVNGFCVNTPGR-YECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFILVPRYWYQYQELLNIFMCQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLCLGENRFHRISGDYFCQRNADCINSPGTYRCECSTGF-KLLPNGACIDIDECSSLY-----GQVCR--NGHCFNEIGSFICLCNEGYELTPDGKNCIDINECV 1889          

HSP 11 Score: 67.0106 bits (162), Expect = 1.635e-10
Identity = 98/412 (23.79%), Postives = 152/412 (36.89%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVC-MKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC----------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFY-----GPYVC--------HFGKCIADGY-------------------NYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI----------------------------------------PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE---IGPTSSNEDSKSSQG 1454
            RC C  GF    +G  C +   G CF  + + +C M       ++K  CC      WG+ C+ C L     G  +   +C          +DI+EC+    +C++G+CIN  GS+RC C+  Y  D     CV   + C Q P  C     C +    ++ C C  GY+   DGKSC    +   K   C+F      G + C        H   CI +                     ++ CEC +GY   S G +C+  VD C   +   C +G C ++   Y C C  GY   Y   +C    +   ++ C    C                                              GY C C PG+  +G+G     I  ++ +   +G  +S +++ S +G
Sbjct: 2230 RCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPL----PGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDE-CSQSPKPCN--FICKNTE-GSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCED-VDECGGNH--RCQHG-CQNIVGGYRCSCPQGYIQHYQWNQCVDENECASQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGIGFNRGQYLPVGKENSEDNALSPEG 2629          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Xenopus
Match: FBN2 (fibrillin 2 (congenital contractural arachnodactyly) [Source:NCBI gene;Acc:100494368])

HSP 1 Score: 192.586 bits (488), Expect = 1.431e-49
Identity = 161/543 (29.65%), Postives = 239/543 (44.01%), Query Frame = 3
Query:  501 CQCKPG----FTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGPT-------------------SSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++  G C  +  G  L  E CC     AWG PC+RCE+   C +GF  + G+ C+D+NEC+ +  +C +G C+N +GSF C C      D     C+  + +   +       +  V        C C  G     + + C K  + ++++    GP           G+      N+G + S  G+   K ++ C  + G+ C NGKC +    + C+C++G+    + + CT I  C + P  LC  G CI  P + +EC C  GF +     K C  I  D+ E  P                    + +E + S    +D    +   + C+ G C+N+   Y+C C PG+      QA  +R+        D+     +   CD           C  S  SY+C C  GY    D + C+DIDEC  NP ICD G C N PG Y+C CFDGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  775 CECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSE-CCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNECEVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGP-----------GFT-----NRGDVLS--GRPFYKDINECKAFPGI-CTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISP-DLCGSGTCINTPGS-FECECFEGFESGFMMMKNCMDI--DECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGY------QATLDRL-----GCTDIDECTIMNGGCDT---------HCTNSEGSYECSCLEGYALMPDKRTCTDIDECEDNPDICDGGQCTNIPGEYRCLCFDGFMASMDM---KTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDE 1270          

HSP 2 Score: 179.104 bits (453), Expect = 3.056e-45
Identity = 171/621 (27.54%), Postives = 261/621 (42.03%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C+C  G T    G+ C ++    CFL      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  IC +GKC N  GSF+C C++ +  D  + +C     +C   P+LCG G  C++ +  +  C+C  G+           ++    D C    P +C  G+CI    ++ C C  G+  +  G +C    +     N  +C NGKCV++   Y C C+ GY ++ DR  CT I +    +   D  C       YEC CL G+A M   + C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+ S+  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C+D+DEC      C     C+N+PGSY CSC +G+T      G  C D +ECTE  +LC+NG C N  GS++C+C+ G+  ++  + C  + + + Q        IC      C    G+F C C  G +     G C  V +  D
Sbjct:  880 CECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECV-HPVPGKFRLDACCCAVGAAWGTECEECP----KPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTD-IDECRISPDLCGSGT-CIN-TPGSFECECFEGFESGFM----MMKNCMDIDECE-RNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDN--LCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDIDECTIMNGGCDTHCT-NSEGSYECSCLEGYALMPDKRTCTDI--DECEDNP-----------------------DICDGGQCTNIPGEYRCLCFDGFMASMDMKTCIDVNEC------DINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIG--NGIKCNDLDECLNGTHRCSVSAHCLNTPGSYHCSCAEGYTGD----GFTCSDVDECTENINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQDIDECAFQN-------ICV--FGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECAD 1438          

HSP 3 Score: 162.155 bits (409), Expect = 6.945e-40
Identity = 193/703 (27.45%), Postives = 281/703 (39.97%), Query Frame = 3
Query:  225 HGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEE----------------------DQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC---KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP-------RSLCPDGQCIPQPNNGYECRCLPGFAPMGKG--------KQCRRIMS----DQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            H   ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS G I+ +C  +                       +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++EC                                          + IP LC  G +C++    ++ C+C  G+ +S      + Q     D C    P VC+ G+C     +Y C C +GY+ S DG  C   +  V F +  NG  C   +    +    C C+SG   +       SI ++ P       R LC +G     P          GF P G G            RI+     +     P + N+        ID C    Y + C  G CI   N YRCEC  G+  D Q +                          D+  S  C NG C+ +  SY C+C++G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +   P G  C D +EC+ TT++C NG+C N  GSF+C C  G++ ++  + C  +        + +   IC   + +C  + G F C CP GL   ++  +C   
Sbjct:    5 HLLPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSTGQISPNCGSKTIQQCSVRCMNGGTCVEDHCQCQKGYVGAHCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVSNQMCQGQVTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRSGACQDVDEC------------------------------------------QAIPGLC-QGGNCINTD-GSYECRCPVGHKQSE-----TTQKCEDIDECTTI-PGVCNGGECSNTIGSYYCICPRGYVTSGDGSRCIDQRSGVCFSSLVNGH-CAQEQAGRFTKMQCC-CESGRCWALG-----SIPEMCPIRGTDEYRRLCIEGVPFGGPGGFV----PNGFGPGGTGFIPGPVPRTFLHRILHTYNINLMLCFPATLNQT-------IDIC--KQYPNLCLNGRCIPNLNSYRCECNMGYKQDTQTEC----------------------IDVDECTSNPCTNGDCVNTPGSYYCKCHSGFQRTPTKQACIDIDECIQNGILCKHGRCVNTEGSFQCICNAGFEL--TPDGKNCADHDECS-TTNMCLNGMCINEDGSFKCICKPGFVLASNGRYCTDID-------ECQTPGICM--NGHCINTEGSFRCDCPPGLAIGVDGRVCVDT 601          

HSP 4 Score: 157.918 bits (398), Expect = 1.315e-38
Identity = 175/615 (28.46%), Postives = 236/615 (38.37%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR------------------------------------RIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF     G C   P     +K  CC +      WGDPC+ C           C  G   I GI    +D+NEC +   IC +G CIN  GSFRC C   Y  D    +CV   +    I N CG G    + +I    C C  G+     G     +  N+        P +C F +CI     Y+C C  GYI   D K CK   +    ++        C +L   ++C C  G     D + C   + C   P  +C +G+C+      Y C C  GF     G +C                                     R   +Q EI P       K          +   DID C      + C+ G CIN    YRC C PG+  D  G AC +  E                +Q  K  +F+C N     +  SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC   +++C   G+C+N+ GSF C+C  GY   +   +C  V +               +C H C+   G + CSCP G
Sbjct: 2043 QCICPPGFVLSENGRRCFDTRQSFCFTRFENGKC-SVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDEC--SIGNPCGNGT--CTNAIGTFECLCDEGFEP---GPMMVCEDINEC----ILNPLLCAF-RCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKP-GICENGRCV-NTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDEC--KVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDEC---------------SQSPKPCNFICKN-----TEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGN----------HRCQHGCQNIVGGYRCSCPQG 2605          

HSP 5 Score: 142.124 bits (357), Expect = 1.378e-33
Identity = 170/673 (25.26%), Postives = 246/673 (36.55%), Query Frame = 3
Query:  687 CEKGFIEIDG--ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLC-KCLPGYVKSLD----------GKSC----SKQSANKYDMCRFYG--------------PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEI---GPTSSNE------------------DSKSSQG----------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-RVEY------KTNQMNDVASSFSLKT--------------QCDKFGS------------------------------------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------------PGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C+ GF+       C DI+ECQ   IC +G CIN  GSFRC C            CV    +     + C  G       I   LC +  PG V   +          G+ C     + SA  Y     YG              P +C  G C     +++C CN G+ + S GK+C   +D C   N ++C NG C +    Y C C  GY    D + C  I +    S C +G C       + C C PG      G  C           I   + E+   G T  +E                  D    +G          D++ C    +   C  G C+N K  + CEC  G  LD  G+ C + R+E+      +   ++ V   F L                +C K GS                                     +C NG+C  +  S++C+CN G+   ++ + C+DIDEC I+P +C  GTCIN+PGS++C CF+GF    M                                         P G  C D NEC  + +LC+NG C N  G++QC CN GY ++  +  C  +          E + +   C  +C  S G + CSC  G   + +   C  + +  D
Sbjct:  544 CKPGFVLASNGRYCTDIDECQTPGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMR-----STCYGG-------IKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAYMYLKRDSYGASITLLDINECALDPDICANGICENLRGSFRCNCNSGFESDSTGKNCID-IDECL-VNRLLCDNGLCRNTPGSYSCTCPKGYVFRSDSETCEDI-NECESSPCVNGACR-NILGSFNCECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNEC--EVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISPDLCGSGTCINTPGSFECECFEGFESGFMMMKNCMDIDECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDID---------ECTIMNGGCDTHCTNSEGSYECSCLEGYALMPDKRTCTDIDECED 1189          

HSP 6 Score: 132.88 bits (333), Expect = 8.633e-31
Identity = 136/494 (27.53%), Postives = 192/494 (38.87%), Query Frame = 3
Query:  684 RCEKGFI--EIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV-QRKKKC----------EQIPNLCGPGMDCVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGY------IASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYT-----SSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C +G+   E   IC+DI+EC     +C  G C N  G++ C+C S Y       +C+  RK  C           ++P      M C + +I                  + HLC  +PG+   +         A   D C+   P +C  G CI    +++CEC  G+      +   D   C     FC R       N  C++    Y C+C +G+      +  DR +C  I      ++C  G C+      Y C C  GF          ++  DQ+                DID C     R  C  G C N    Y C C PGF +               N   D+    SL  Q       +C NG C     S+ C CN GY+ + DGK C DI+EC   P  C  GTC N  GS++C C  G+ +        C D +EC E  ++C  G C NT GSFQC C  G++ S   + C   +
Sbjct: 1639 ECPQGYYLSEETRICEDIDECFTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDI-----HTGKAVDIDECKEI-PGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSSGDYFCQR-------NADCINSPGTYRCECSTGFKLLPNGACIDRNECLEI-----PNVCSHGTCV-DTEGSYHCVCNNGF----------KVSPDQTMCM-------------DIDEC----ERQPCGNGTCKNTVGSYNCLCYPGFEITHN------------NDCLDIDECSSLYGQ-------VCRNGHCFNEIGSFICLCNEGYELTPDGKNCIDINECVAFPGSCSPGTCQNLEGSFRCICPPGYEVER----ENCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTR 2063          

HSP 7 Score: 128.257 bits (321), Expect = 2.531e-29
Identity = 137/518 (26.45%), Postives = 216/518 (41.70%), Query Frame = 3
Query:  717 ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--------TSICDLYP-------RSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQC-RRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            +C+DINEC  + +  + +CIN  G++ C C + Y     Q  C    +  E   +    GM C +L I   +C C PG V+  DG+ C  ++      CR   P +C  G+C+    +Y+C+CN+G+ ++  G  C  T              G C S     +CQ  S   +   + +C         + C++ P       + +CP G           EC+ +P     G   QC   I S +    P  + +   ++  D+D C  S     C    C N +  Y+C C  G++L + G++CK+  E +T Q N      +    F+ K                +C    +     G C  S  S+ C+C  GY     G  C D+DEC  N   C  G C N  G Y+CSC  G+  H      +C D NEC  + + C +  C NT GS++C C +G+  +     C  V + ++ K           C++ C  + G ++C CP G   V
Sbjct: 2213 VCEDINECILNPLLCAFRCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNL-IGTFMCICPPGMVRRPDGEGCMDENE-----CRTK-PGICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQ------------GFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNG---QCINNIGSYRCFCNPGYTTDIGGTACVDLDEC--SQSPKPCNF-ICKNTEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGN-HRCQHG-CQNIVGGYRCSCPQGYIQHYQWN--QCVDENECA-SQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSK---------NPCNYGCSNTEGGYLCGCPPGYYRV 2691          

HSP 8 Score: 127.872 bits (320), Expect = 3.689e-29
Identity = 116/432 (26.85%), Postives = 183/432 (42.36%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSL--------KTQC----------------------------DKFGSFL--------------CNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSG 1994
            Q    C+Q PNLC  G    +L+ Y   C+C  GY +       ++      D C       C  G C+    +Y C+C+ G+  +   ++C   +D C + NG++C +G+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                        DID C        C  G CIN +  +RC+C PG  +   G+ C +    ++     +     +        K++C                            D +G+ +              C NG C     S++C CN+G+++   GK C DIDEC +N  +CD G C N+PGSY C+C  G+   +      C D NEC   +S C NG C+N  GSF C+C+ G
Sbjct:  394 QTIDICKQYPNLCLNGRCIPNLNSYR--CECNMGYKQD------TQTECIDVDECT---SNPCTNGDCVNTPGSYYCKCHSGFQRTPTKQACID-IDECIQ-NGILCKHGRCVNTEGSFQCICNAGFELTPDGKNCADHDECSTTNMCLNGMCINE-DGSFKCICKPGFVLASNGRYCT-----------------------DIDEC---QTPGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVD-THMRSTCYGGIKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAYMYLKRDSYGASITLLDINECALDPDICANGICENLRGSFRCNCNSGFESDSTGKNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPKGYVFRS--DSETCEDINEC--ESSPCVNGACRNILGSFNCECSPG 780          

HSP 9 Score: 100.908 bits (250), Expect = 6.581e-21
Identity = 107/396 (27.02%), Postives = 160/396 (40.40%), Query Frame = 3
Query:  684 RCEKGF--IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDG 1862
            +C  GF        C DI+EC Q   +CK G+C+N  GSF+C+C++ ++  P   +C    +      N+C  GM C++    +  C C PG+V + +G+ C+       D C+   P +C  G CI    +++C+C  G     DG+ C  T    T Y G+    G CV                             +P ++     C   P+ G+   C P   P        +  S  + I           +  DI+ C  +   D C  G C N++  +RC C  GF  D  G+ C +  E   N++                   LC+NG C  +  SY C C  GY    D + C DI+EC  +P  C  G C N  GS+ C C  G
Sbjct:  460 KCHSGFQRTPTKQACIDIDECIQNGILCKHGRCVNTEGSFQCICNAGFELTPDGKNCADHDEC--STTNMCLNGM-CINED-GSFKCICKPGFVLASNGRYCT-----DIDECQT--PGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMRSTCYGGI--KKGLCVR---------------------------PFPGAVTKSECCCANPDYGFGEPCHP-CPPRNSAYMYLKRDSYGASI-----------TLLDINEC--ALDPDICANGICENLRGSFRCNCNSGFESDSTGKNCIDIDECLVNRL-------------------LCDNGLCRNTPGSYSCTCPKGYVFRSDSETCEDINECESSP--CVNGACRNILGSFNCECSPG 780          

HSP 10 Score: 99.7525 bits (247), Expect = 1.311e-20
Identity = 119/475 (25.05%), Postives = 193/475 (40.63%), Query Frame = 3
Query:  684 RCEKGFIEIDGI--CQDINECQW-SQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLP-----------GFVLDKQGQ-ACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNT------GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C+ G+    G   C D++EC+  +  C     C+N  GSF+C C   +  + ++ +      +C    + C     C++     H C C  GY    DG +CS       ++       +C  G+C+    +Y+CEC+ G+  +SD +SC+  +D C   N  +C  G C +L   + C C+ GY        CT + +      C +G C+  P   YEC C P F     G  C         +   +  + + S   +I        R  C    C ++   +   CE  P            F+++  G+ +      Y T  +     SFS   Q   +  FL            +Q + NT      G++ +    +  DIDEC   P +C  G CIN+ GS+QC C  G+ +        C D +EC     +C  G C NT G++ C C S Y+  N   +C+ ++
Sbjct: 1251 HCQVGYAVKKGTTGCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIGNGIKCN---DLDECLNGTHRCSVSAHCLNTPGSYH-CSCAEGYTG--DGFTCSDVDECTENI------NLCENGQCLNIPGSYRCECDMGFTPASDSRSCQD-IDECAFQN--ICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECADPINCVNGFCVNTPGR-YECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGV---GVSRSSC----CCSLGKAWGNPCEICPPVNSYIFMVELDFMVELDGRMSFFNPTYYVTCSLCLFMFSFSF-IQFQDYILFLKEASHLTFKPFIFQAEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEET--RICEDIDECFTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMR 1699          

HSP 11 Score: 99.7525 bits (247), Expect = 1.333e-20
Identity = 116/474 (24.47%), Postives = 178/474 (37.55%), Query Frame = 3
Query:  687 CEKGF-IEIDGICQDINECQ--WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGM---------------------DCVSL-----------------SIYNHLCKCLPGYVKSLDGKSC--SKQSA--NKYD--MCRFYGPYVCHFGKC-----IADGYNYKCE-------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNE 1913
            C  GF I  +  C DI+EC   + Q+C++G C NE GSF CLC+  Y+  P   +C+    +C   P  C PG                      +C+ +                 +  +  C C PG+V S +G+ C  ++QS    +++   C     Y     KC       +G+   CE             C  G+         ++ V+ C    G+ C NG C++    + C+C  GY   Y    C    +    + C +G C       +EC C  GF P                 GP    ED      +   C +           CIN    Y C C  G++L +  + CK+        +++    F     C+  G        C     ++ C C  G     DG+ C D +EC   P IC+ G C+N+ GSY+C C +GF   + P G +C D  +
Sbjct: 1922 CYPGFEITHNNDCLDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNCID-INECVAFPGSCSPGTCQNLEGSFRCICPPGYEVERENCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGI-CANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDECSIGNPCGNGTCT-NAIGTFECLCDEGFEP-----------------GPMMVCEDINECILNPLLCAFR----------CINTYGAYECTCPAGYILREDQKMCKD--------LDECIEGFH---DCESRGMV------CKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKPGICENGRCVNTIGSYRCDCNEGF--QSTPSGTECLDTRQ 2346          

HSP 12 Score: 93.9745 bits (232), Expect = 9.104e-19
Identity = 120/477 (25.16%), Postives = 177/477 (37.11%), Query Frame = 3
Query:  720 CQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHF-GKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE------------RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC-------------------DQGTCINSP----GSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C D+NEC   S IC  G+C N +GSF C C   Y        C     +CE   + C     C+++   +  C C  G++   +G  C     N  D C   G + C     C+    +Y C C +GY  + DG +C   VD CT  N  +C NG+C+++   Y C+CD G+T + D + C  I +   +++C  G C   P   + C C  G+     G  C                        D+D C        C  G C+N    Y C C P F L+  G  C +            R +   +   ++    S  + C   G    N        +SY       +   LDG++        +  S+C                   +       P      Y   C  G      P      D +EC E   LC+ G C NT+GSFQC+C  GY  S + + C  + +
Sbjct: 1223 CIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTD-VDECEIDTHNCHLHATCLNVP-GSFKCTCKEGWIG--NGIKC-----NDLDEC-LNGTHRCSVSAHCLNTPGSYHCSCAEGY--TGDGFTCSD-VDECTE-NINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQDIDECAFQNICVFGTCSNLPGM-FRCICNEGYELDRTGGNCT-----------------------DVDECADPI---NCVNGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSYIFMVELDFMVELDGRMSFFNPTYYVTCSLCLFMFSFSFIQFQDYILFLKEASHLTFKPFIFQAEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDE 1658          

HSP 13 Score: 67.0106 bits (162), Expect = 1.668e-10
Identity = 98/412 (23.79%), Postives = 152/412 (36.89%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVC-MKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC----------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFY-----GPYVC--------HFGKCIADGY-------------------NYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI----------------------------------------PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE---IGPTSSNEDSKSSQG 1454
            RC C  GF    +G  C +   G CF  + + +C M       ++K  CC      WG+ C+ C L     G  +   +C          +DI+EC+    +C++G+CIN  GS+RC C+  Y  D     CV   + C Q P  C     C +    ++ C C  GY+   DGKSC    +   K   C+F      G + C        H   CI +                     ++ CEC +GY   S G +C+  VD C   +   C +G C ++   Y C C  GY   Y   +C    +   ++ C    C                                              GY C C PG+  +G+G     I  ++ +   +G  +S +++ S +G
Sbjct: 2325 RCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPL----PGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDE-CSQSPKPCN--FICKNTE-GSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCED-VDECGGNH--RCQHG-CQNIVGGYRCSCPQGYIQHYQWNQCVDENECASQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGIGFNRGQYLPVGKENSEDNALSPEG 2724          

HSP 14 Score: 62.3882 bits (150), Expect = 4.195e-9
Identity = 74/294 (25.17%), Postives = 112/294 (38.10%), Query Frame = 3
Query: 1455 DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN-------------------------QMN------DVASSFSLK----TQCDKFGSF-----LC----NNGR--------CIESGSS---YQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM--------------------------PGGPK--------------CYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQ 2051
            DID C        C+GG CIN    ++CEC  G+ L ++ + C++  E  T+                         Q+N      D+  SF  +    T CD    F     +C    N G+        C   G++   + C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++                          PG  +              C DRNEC E  ++C +G C +T GS+ C CN+G+  S  +  C+ + +   Q
Sbjct: 1613 DIDEC--QELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSSGDYFCQRNADCINSPGTYRCECSTGFKLLPNGACIDRNECLEIPNVCSHGTCVDTEGSYHCVCNNGFKVSPDQTMCMDIDECERQ 1904          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Xenopus
Match: FBN2 (fibrillin 2 (congenital contractural arachnodactyly) [Source:NCBI gene;Acc:100494368])

HSP 1 Score: 192.586 bits (488), Expect = 1.458e-49
Identity = 161/545 (29.54%), Postives = 238/545 (43.67%), Query Frame = 3
Query:  501 CQCKPG----FTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGP-------------------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGF--VLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++  G C  +  G  L  E CC     AWG PC+RCE+   C +GF  + G+ C+D+NEC+ +  +C +G C+N +GSF C C      D     C+  + +   +       +  V        C C  G     + + C K  + ++++    GP           G+      N+G + S  G+   K ++ C  + G+ C NGKC +    + C+C++G+    + + CT I  C + P  LC  G CI  P + +EC C  GF +     K C  I  D+ E  P                    + +E + S    +D    +   + C+ G C+N+   Y+C C PG+   LD+ G               D+     +   CD           C  S  SY+C C  GY    D + C+DIDEC  NP ICD G C N PG Y+C CFDGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  759 CECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSE-CCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNECEVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGP-----------GFT-----NRGDVLS--GRPFYKDINECKAFPGI-CTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISP-DLCGSGTCINTPGS-FECECFEGFESGFMMMKNCMDI--DECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGYQATLDRLG-------------CTDIDECTIMNGGCDT---------HCTNSEGSYECSCLEGYALMPDKRTCTDIDECEDNPDICDGGQCTNIPGEYRCLCFDGFMASMDM---KTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDE 1254          

HSP 2 Score: 178.718 bits (452), Expect = 3.815e-45
Identity = 171/621 (27.54%), Postives = 261/621 (42.03%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C+C  G T    G+ C ++    CFL      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  IC +GKC N  GSF+C C++ +  D  + +C     +C   P+LCG G  C++ +  +  C+C  G+           ++    D C    P +C  G+CI    ++ C C  G+  +  G +C    +     N  +C NGKCV++   Y C C+ GY ++ DR  CT I +    +   D  C       YEC CL G+A M   + C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+ S+  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C+D+DEC      C     C+N+PGSY CSC +G+T      G  C D +ECTE  +LC+NG C N  GS++C+C+ G+  ++  + C  + + + Q        IC      C    G+F C C  G +     G C  V +  D
Sbjct:  864 CECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECV-HPVPGKFRLDACCCAVGAAWGTECEECP----KPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTD-IDECRISPDLCGSGT-CIN-TPGSFECECFEGFESGFM----MMKNCMDIDECE-RNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDN--LCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDIDECTIMNGGCDTHCT-NSEGSYECSCLEGYALMPDKRTCTDI--DECEDNP-----------------------DICDGGQCTNIPGEYRCLCFDGFMASMDMKTCIDVNEC------DINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIG--NGIKCNDLDECLNGTHRCSVSAHCLNTPGSYHCSCAEGYTGD----GFTCSDVDECTENINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQDIDECAFQN-------ICV--FGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECAD 1422          

HSP 3 Score: 175.637 bits (444), Expect = 3.352e-44
Identity = 180/628 (28.66%), Postives = 255/628 (40.61%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEE----------------------DQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSA--------NKYDMCRFYGPYV-----CHFGKCIADGY-----------NYKCEC--------------------NQGYIASSDG-----KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGY-----TSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS G I+ +C  +                       +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GS+ C C   ++       C +   +C  IP +C  G    S +I ++ C C  GYV S DG  C  Q +        N +      G +      C  G+C A G             Y+  C                      G+I    G      +  +T+D C +Y   +C NG+C+   N Y C+C+ GY     T   D  +CTS       + C +G C+  P + Y C+C  GF         +R  + Q+ I              DID C  +     CK G C+N +  ++C C  GF L   G+ C +  E  T  M                    C NG CI    S++C C  G+  + +G+ C+DIDEC   P IC  G CIN+ GS++C C  G  I
Sbjct:    8 NVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSTGQISPNCGSKTIQQCSVRCMNGGTCVEDHCQCQKGYVGAHCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVSNQMCQGQVTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRSGACQDVDECQAIPGLCQGGNCINTDGSYECRCPVGHKQSETTQKC-EDIDECTTIPGVCNGGE--CSNTIGSYYCICPRGYVTSGDGSRCIDQRSGVCFSSLVNGHCAQEQAGRFTKMQCCCESGRCWALGSIPEMCPIRGTDEYRRLCIEGVPFGGPGGFVPNGFGPGGTGFIPGPGGNGFHPATLNQTIDICKQYPN-LCLNGRCIPNLNSYRCECNMGYKQDTQTECIDVDECTS-------NPCTNGDCVNTPGS-YYCKCHSGF---------QRTPTKQACI--------------DIDECIQNGIL--CKHGRCVNTEGSFQCICNAGFELTPDGKNCADHDECSTTNM--------------------CLNGMCINEDGSFKCICKPGFVLASNGRYCTDIDECQT-PGICMNGHCINTEGSFRCDCPPGLAI 575          

HSP 4 Score: 157.918 bits (398), Expect = 1.390e-38
Identity = 175/615 (28.46%), Postives = 236/615 (38.37%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR------------------------------------RIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF     G C   P     +K  CC +      WGDPC+ C           C  G   I GI    +D+NEC +   IC +G CIN  GSFRC C   Y  D    +CV   +    I N CG G    + +I    C C  G+     G     +  N+        P +C F +CI     Y+C C  GYI   D K CK   +    ++        C +L   ++C C  G     D + C   + C   P  +C +G+C+      Y C C  GF     G +C                                     R   +Q EI P       K          +   DID C      + C+ G CIN    YRC C PG+  D  G AC +  E                +Q  K  +F+C N     +  SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC   +++C   G+C+N+ GSF C+C  GY   +   +C  V +               +C H C+   G + CSCP G
Sbjct: 1904 QCICPPGFVLSENGRRCFDTRQSFCFTRFENGKC-SVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDEC--SIGNPCGNGT--CTNAIGTFECLCDEGFEP---GPMMVCEDINEC----ILNPLLCAF-RCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKP-GICENGRCV-NTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDEC--KVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDEC---------------SQSPKPCNFICKN-----TEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGN----------HRCQHGCQNIVGGYRCSCPQG 2466          

HSP 5 Score: 141.739 bits (356), Expect = 1.495e-33
Identity = 170/673 (25.26%), Postives = 246/673 (36.55%), Query Frame = 3
Query:  687 CEKGFIEIDG--ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLC-KCLPGYVKSLD----------GKSC----SKQSANKYDMCRFYG--------------PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEI---GPTSSNE------------------DSKSSQG----------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-RVEY------KTNQMNDVASSFSLKT--------------QCDKFGS------------------------------------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------------PGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C+ GF+       C DI+ECQ   IC +G CIN  GSFRC C            CV    +     + C  G       I   LC +  PG V   +          G+ C     + SA  Y     YG              P +C  G C     +++C CN G+ + S GK+C   +D C   N ++C NG C +    Y C C  GY    D + C  I +    S C +G C       + C C PG      G  C           I   + E+   G T  +E                  D    +G          D++ C    +   C  G C+N K  + CEC  G  LD  G+ C + R+E+      +   ++ V   F L                +C K GS                                     +C NG+C  +  S++C+CN G+   ++ + C+DIDEC I+P +C  GTCIN+PGS++C CF+GF    M                                         P G  C D NEC  + +LC+NG C N  G++QC CN GY ++  +  C  +          E + +   C  +C  S G + CSC  G   + +   C  + +  D
Sbjct:  528 CKPGFVLASNGRYCTDIDECQTPGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMR-----STCYGG-------IKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAYMYLKRDSYGASITLLDINECALDPDICANGICENLRGSFRCNCNSGFESDSTGKNCID-IDECL-VNRLLCDNGLCRNTPGSYSCTCPKGYVFRSDSETCEDI-NECESSPCVNGACR-NILGSFNCECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGFARVKGVSCEDVNEC--EVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISPDLCGSGTCINTPGSFECECFEGFESGFMMMKNCMDIDECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDID---------ECTIMNGGCDTHCTNSEGSYECSCLEGYALMPDKRTCTDIDECED 1173          

HSP 6 Score: 128.257 bits (321), Expect = 2.218e-29
Identity = 137/518 (26.45%), Postives = 216/518 (41.70%), Query Frame = 3
Query:  717 ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--------TSICDLYP-------RSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQC-RRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAV 2156
            +C+DINEC  + +  + +CIN  G++ C C + Y     Q  C    +  E   +    GM C +L I   +C C PG V+  DG+ C  ++      CR   P +C  G+C+    +Y+C+CN+G+ ++  G  C  T              G C S     +CQ  S   +   + +C         + C++ P       + +CP G           EC+ +P     G   QC   I S +    P  + +   ++  D+D C  S     C    C N +  Y+C C  G++L + G++CK+  E +T Q N      +    F+ K                +C    +     G C  S  S+ C+C  GY     G  C D+DEC  N   C  G C N  G Y+CSC  G+  H      +C D NEC  + + C +  C NT GS++C C +G+  +     C  V + ++ K           C++ C  + G ++C CP G   V
Sbjct: 2074 VCEDINECILNPLLCAFRCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNL-IGTFMCICPPGMVRRPDGEGCMDENE-----CRTK-PGICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQ------------GFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNG---QCINNIGSYRCFCNPGYTTDIGGTACVDLDEC--SQSPKPCNF-ICKNTEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGNHR-CQHG-CQNIVGGYRCSCPQGYIQHYQWN--QCVDENECA-SQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSK---------NPCNYGCSNTEGGYLCGCPPGYYRV 2552          

HSP 7 Score: 120.939 bits (302), Expect = 4.173e-27
Identity = 155/555 (27.93%), Postives = 215/555 (38.74%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSL-SRG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE-LGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTV-DFCTR-YNGVVCPN-----------------GKCVS-----------LSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR-RIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L+  +RG   +      G+ +S+  CC +   AWG+PC+ C  +  C+K FI +           W                       YQ+  +          C+++P LC  G +C++ +  +  C+C  GY  S + + C        D C F  P VC  G C     NY C C   Y+  + G +C      FC R YNG  C N                 GK  S            +  ++C    G+T      K   I  C   P  +C +G CI Q  + + C C  GF+       C     S +  I   +         G+  F   S      +   CIN    YRCEC  GF L   G AC            D+    SL  Q       +C NG C     S+ C CN GY+ + DGK C DI+EC   P  C  GTC N  GS++C C  G+ +        C D +EC E  ++C  G C NT GSFQC C  G++ S   + C   +
Sbjct: 1439 ECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFILVPRY--------W-----------------------YQYQELL-----NIFMCQELPGLC-QGGNCIN-TFGSFQCECPQGYYLSEETRICED-----IDEC-FTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIP-GICTNGVCINQIGS-FRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLCLGENRFHRISGDYFCQRNADCINSPGTYRCECSTGFKLLPNG-ACI-----------DIDECSSLYGQ-------VCRNGHCFNEIGSFICLCNEGYELTPDGKNCIDINECVAFPGSCSPGTCQNLEGSFRCICPPGYEVER----ENCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTR 1924          

HSP 8 Score: 119.013 bits (297), Expect = 1.993e-26
Identity = 147/538 (27.32%), Postives = 215/538 (39.96%), Query Frame = 3
Query:  687 CEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPG-MDC---VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYD------------------MCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCR----RIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR------DQCK-------GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQC--DKF----GSFLCN-NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDEC-SINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            C +G+ E+D   G C D++EC     C +G C+N  G + C C   +Q +P    CV  R   C       G G + C   + + +    C C  G       + C   ++ K                    MC+   P +C  G CI    +++CEC QGY  S + + C+  +D C  + GV  P G C +   +Y C C S Y        C  +     +S C       +  NG  C     F    K   C     +  S   E  PT    + K   G I    +  +       D+CK        G CIN    +RCEC  GF  +     C+         +  +   F L      ++F    G + C  N  CI S  +Y+C+C+TG++   +G  C DIDEC S+   +C  G C N  GS+ C C +G+ +   P G  C D NEC      C  G C+N  GSF+C C  GY    ++++C+ + +        E   IC      C  + G F C CP G 
Sbjct: 1401 CNEGY-ELDRTGGNCTDVDECADPINCVNGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFILVPRYWYQYQELLNIFMCQEL-PGLCQGGNCINTFGSFQCECPQGYYLSEETRICED-IDECFTHPGVCGP-GTCYNTLGNYTCICPSEYMQVNGGHNCMDM----RKSFCY------RTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLCLGENRFHRISGDYFCQRNADCINSPGTYRCECSTGFKLLPNGA-CIDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYEL--TPDGKNCIDINECVAFPGSCSPGTCQNLEGSFRCICPPGY--EVERENCIDIDEC------IEEPNICL--FGACSNTPGSFQCICPPGF 1911          

HSP 9 Score: 103.219 bits (256), Expect = 1.180e-21
Identity = 138/552 (25.00%), Postives = 206/552 (37.32%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGA--FQVAWGDP-CQR------------CELGRCEKGF-IEIDGICQDINECQ--WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGM---------------------DCVSL-----------------SIYNHLCKCLPGYVKSLDGKSC--SKQSA--NKYD--MCRFYGPYVCHFGKC-----IADGYNYKCE-------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNE 1913
            RC+C  GF+      +  G  F SL   +     Y + L   LC G   F    GD  CQR            CE   C  GF +  +G C DI+EC   + Q+C++G C NE GSF CLC+  Y+  P   +C+    +C   P  C PG                      +C+ +                 +  +  C C PG+V S +G+ C  ++QS    +++   C     Y     KC       +G+   CE             C  G+         ++ V+ C    G+ C NG C++    + C+C  GY   Y    C    +    + C +G C       +EC C  GF P                 GP    ED      +   C +           CIN    Y C C  G++L +  + CK+        +++    F     C+  G        C     ++ C C  G     DG+ C D +EC   P IC+ G C+N+ GSY+C C +GF   + P G +C D  +
Sbjct: 1712 RCECPTGFSYNDLLLVCEGNNF-SLKETITQITIYFILL---LCLGENRFHRISGDYFCQRNADCINSPGTYRCE---CSTGFKLLPNGACIDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNCID-INECVAFPGSCSPGTCQNLEGSFRCICPPGYEVERENCIDIDECIEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGI-CANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDECSIGNPCGNGTCTNAIGT-FECLCDEGFEP-----------------GPMMVCEDINECILNPLLCAFR----------CINTYGAYECTCPAGYILREDQKMCKD--------LDECIEGFH---DCESRGMV------CKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKPGICENGRCVNTIGSYRCDCNEGF--QSTPSGTECLDTRQ 2207          

HSP 10 Score: 84.3445 bits (207), Expect = 7.325e-16
Identity = 147/635 (23.15%), Postives = 241/635 (37.95%), Query Frame = 3
Query:  684 RCEKGFIEIDGI--CQDINECQW-SQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA--PMGKGKQCRRI--------------MSDQSEIGPTSSNEDSKSSQGDI----------------DFCFYSYYRDQ----------------CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN-------------------------QMN------DVASSFSLKT----QCDKFGSF-----LC----NNGR--------CIESGSS---YQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMP---GGPKCYDRNECTETT-----SLC----------------KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
             C+ G+    G   C D++EC+  +  C     C+N  GSF+C C   +  + ++ +      +C    + C     C++     H C C  GY    DG +CS       ++       +C  G+C+    +Y+CEC+ G+  +SD +SC+  +D C   N  +C  G C +L   + C C+ GY        CT + +      C +G C+  P   YEC C P F   P G G    R+              +S  +EIG   S      S G                   F     Y  Q                C+GG CIN    ++CEC  G+ L ++ + C++  E  T+                         Q+N      D+  SF  +T     CD    F     +C    N G+        C   G++   + C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++     G     +   T+ T      LC                +N  C N+ G+++C+C++G+        C+ + + S+        ++C+  + +C    G F+C C  G +   +   C  +++ V
Sbjct: 1235 HCQVGYAVKKGTTGCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIGNGIKCN---DLDECLNGTHRCSVSAHCLNTPGSYH-CSCAEGYTG--DGFTCSDVDECTENI------NLCENGQCLNIPGSYRCECDMGFTPASDSRSCQD-IDECAFQN--ICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECADPINCVNGFCVNTPGR-YECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFILVPRYWYQYQELLNIFMCQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLCLGENRFHRISGDYFCQRNADCINSPGTYRCECSTGF-KLLPNGACIDIDECSSLY-----GQVCR--NGHCFNEIGSFICLCNEGYELTPDGKNCIDINECV 1845          

HSP 11 Score: 67.0106 bits (162), Expect = 1.499e-10
Identity = 98/412 (23.79%), Postives = 152/412 (36.89%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVC-MKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC----------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFY-----GPYVC--------HFGKCIADGY-------------------NYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI----------------------------------------PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE---IGPTSSNEDSKSSQG 1454
            RC C  GF    +G  C +   G CF  + + +C M       ++K  CC      WG+ C+ C L     G  +   +C          +DI+EC+    +C++G+CIN  GS+RC C+  Y  D     CV   + C Q P  C     C +    ++ C C  GY+   DGKSC    +   K   C+F      G + C        H   CI +                     ++ CEC +GY   S G +C+  VD C   +   C +G C ++   Y C C  GY   Y   +C    +   ++ C    C                                              GY C C PG+  +G+G     I  ++ +   +G  +S +++ S +G
Sbjct: 2186 RCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPL----PGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDE-CSQSPKPCN--FICKNTE-GSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCED-VDECGGNH--RCQHG-CQNIVGGYRCSCPQGYIQHYQWNQCVDENECASQNTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGIGFNRGQYLPVGKENSEDNALSPEG 2585          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Mouse
Match: Fbn2 (fibrillin 2 [Source:MGI Symbol;Acc:MGI:95490])

HSP 1 Score: 195.667 bits (496), Expect = 1.068e-50
Identity = 170/552 (30.80%), Postives = 241/552 (43.66%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-GRCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC----------EQIPNL-----------CGPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
             C+C PG     TG  C + + G C+L++    C  +  G  L  E CC     AWG PC+RCEL   C +GF  I G+ C+D+NEC+ +  +C +G+C+N +GSF C C      D     C+  R + C            +P                G +C          Y  LC   PG+    D  +  +      + C+ + P +C +GKC     ++KC CN G+    + ++C   +D C R +  +C +G CV+    + C+C  GY S +   K C  I  C+  P  LC  G C+      ++C C     P+G             E+ P  S ED      DI+ C  S   + C+ G C+NM   Y+C C PG+      Q C            D+     +   CD          +C  S  SY+C C+ GY    DG+ C+DIDEC  NP ICD G C N PG Y+C C+DGF    +M     C D NEC    ++C  G C+NT GSF C C  GY        C  V +
Sbjct:  867 HCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSE-CCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILT-GRPFYKDINECKAF-PGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTD-IDEC-RISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPL-LCRGGTCV-NTEGSFQCDC-----PLGH------------ELSP--SREDCV----DINEC--SLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC-----------TDIDECMIMNGGCDT---------QCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM---KTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDE 1363          

HSP 2 Score: 181.03 bits (458), Expect = 5.822e-46
Identity = 171/622 (27.49%), Postives = 266/622 (42.77%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
             C+C  G T    G+ C +I    CFL      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  +C  GKC N  GSF+C C++ +  D  + +C     +C   P+LCG G+ CV+ +  +  C+C  GY           ++    D C    P +C  G C+    +++C+C  G+  S   + C   ++ C+  + + C NGKCV++   Y C C+ GY ++ DR+ CT I +    +   D QC       YEC C  G+A M  G+ C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+  +  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C D+DEC+     C     C+N+PGSY+C+C +GFT      G  C D +EC E T+LC+NG C N  G+++C+C  G+  ++  + C  + + S Q        IC      C    G+F C C +G +     G C  + +  D
Sbjct:  972 HCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECI-HPVPGKFRMDACCCAVGAAWGTECEECP----KPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTD-IDECRISPDLCGSGI-CVN-TPGSFECECFEGYESGFM----MMKNCMDIDECE-RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT-NSEGSYECSCSEGYALMPDGRSCADI--DECENNP-----------------------DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC------DLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVG--NGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGD----GFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQ-------NICV--FGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD 1531          

HSP 3 Score: 168.703 bits (426), Expect = 4.731e-42
Identity = 162/611 (26.51%), Postives = 260/611 (42.55%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE--RVEYKT--------NQMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC C PG      G+ C +  +   C+  + +GVC++   G     E CC      +G+PCQ C         G C  G  I +DG  +DINEC     IC +G C N RGS+RC C+S Y+ D    +C+    +C     LC  G+     +  ++ C C PGYV   + ++C   +  + + C          G C  +  ++ CEC+ G   SS G  C  ++                 NG    +  C +L   +      C+ D+     + R K   C  +  C+++P  +CP+G+C+      + C C  G    G G+ C  I                      ++ CF  +  D+C        +    C C  G     + + C +    EY+T            D+ +        ++  +F  +C  G+C  +  S++C+CN G+   ++ + C+DIDEC I+P +C  G C+N+PGS++C CF+G+    M     C D +EC     LC+ G C NT GSFQC C  G+  S  ++DCV + + S          +C+  +  C    G + CSC  G  A  +   C  + +
Sbjct:  674 RCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDG--RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCID-IDECLVNRLLCDNGL--CRNTPGSYSCTCPPGYVFRTETETCEDVNECESNPCVN--------GACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFP-GVCPNGRCV-NSKGSFHCECPEGLTLDGTGRVCLDIR---------------------MEHCFLKWDEDECIHPVPGKFRMDACC-CAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMM-MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLS------DNLCR--NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDE 1238          

HSP 4 Score: 164.466 bits (415), Expect = 8.910e-41
Identity = 194/731 (26.54%), Postives = 284/731 (38.85%), Query Frame = 3
Query:  216 QTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYI----CQCDSG--YTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA---PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG---------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVR 2234
            Q +    ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS+G I+ +C  +                       +                 N G      RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ                                           IP LC  G +C++ ++ +  C+C  G+ +S      + Q     D C    P VC  G C     +Y C C +G++ S+DG  C       T ++G+V  NG+C       +    C C+ G  ++     + C        R LC DG     P  G     +PG +   P G G          +   P   +       G                      ID C   ++ + C  G CI   + YRCEC  G+  D  G                           D+  S  C+NG C+ +  SY C+C+ G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +     G  C D +ECT TT++C NG+C N  GSF+C C  G+I +   + C  V        + +   IC   + +C  + G F C CP GL   ++  +C           +I   V VR
Sbjct:   80 QEILRGPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSSGQISPTCGAKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQ------------------------------------------AIPGLC-QGGNCIN-TVGSFECRCPAGHKQSE-----TTQKCEDIDECSVI-PGVCETGDCSNTVGSYFCLCPRGFVTSTDGSRCIDQRAG-TCFSGLV--NGRCAQELPGRMAKAQCCCEPGRCWSIGTIPEACPVRGSEEYRRLCLDGL----PMGG-----IPGSSVSRPGGTGSTGNGYGPGGTGFLPIPGDNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDIC--KHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC----------------------IDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT--DGKNCVDHDECT-TTNMCLNGMCINEDGSFKCVCKPGFILAPNGRYCTDVD-------ECQTPGICM--NGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVR 710          

HSP 5 Score: 148.673 bits (374), Expect = 8.856e-36
Identity = 169/615 (27.48%), Postives = 234/615 (38.05%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEIGPTSSNEDSKSS-------------------------------------QGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF +   G C   P     +K  CC +      WGDPC+ C           C  G   +  +    +D+NEC  S  IC +G+CIN  GSFRC C   Y  D     CV   +    I N CG G  C ++ I +  C C  G+     G   + +  N+        P +C F +C+    +Y+C C  GY    D K CK   +     +        C +L   ++C C  G     D + C   + C   P  +C +G+C+      Y C C  GF     G +C           ++    ++  +S N  +KS                                        DID C        C  G C+N    +RC C  G+  D  G AC +  E                +Q  K  +F+C N +      SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC    SLC   GIC+NT GSF C+C  G+       +C  V +               +C H C+   G + C CP G
Sbjct: 2073 QCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKC-SVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDEC--SIGNPCGNGT-CTNV-IGSFECTCNEGFEP---GPMMNCEDINECAQ----NPLLCAF-RCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKP-GICENGRCV-NIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDEC--KVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDEC---------------SQSPKPCNFICKNTK-----GSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC-QFLCVNTLGGFTCKCPPGFTQHHT----ACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGN----------HRCQHGCQNILGGYRCGCPQG 2635          

HSP 6 Score: 136.346 bits (342), Expect = 5.205e-32
Identity = 155/609 (25.45%), Postives = 226/609 (37.11%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLS-RG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC----------------------------------EL-GRCEKG------------------FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK----------CE-QIPNLCGPGMDCVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L    RG   +      G+ +S+  CC +   AWG+PC+ C                                  EL G C+ G                    E   IC+DI+EC     +C  G C N  G++ C+C   Y       +C+  +K           CE ++P      M C + ++                  +  +C  +PG+   +         A   D C+   P +C  G CI    +++CEC  G+  +     C+  +D C+  + +   N  C++    Y C+C +G+  S      DR +C  I ++    LC D Q        Y+C C  GF        C                        D+D C     R  C  G C N    Y C C PGF L               N   D+        +C  F   +C NGRC     S++C CN GY+ + DGK C D +EC   P  C  GTC N  GS++C C  G+ + +      C D NEC E  ++C  G C NT G FQC C  G++ S+  + C   +
Sbjct: 1548 ECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDI-----HTGKAVDIDECKEI-PGICANGVCINQIGSFRCECPTGFSYNDLLLVCED-IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQ------GSYQCICNNGFKASQDQTMCM-----------------------DVDEC----ERHPCGNGTCKNTVGSYNCLCYPGFELTHN------------NDCLDI-------DECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSE----NCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTR 2093          

HSP 7 Score: 130.954 bits (328), Expect = 2.677e-30
Identity = 147/537 (27.37%), Postives = 218/537 (40.60%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP---------------RSLCP-------------------------DGQC-IPQPNNGYECRC----LPGFAPMGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSF--LCNNG------------------------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RCE   C  GF +  +G C D NEC +   +C  G C++ +GS++C+C++ ++    Q  C+    +CE+ P  CG G    ++  YN  C C PG+  +              D C  +   VC  G+C  +  ++KC CN+GY  + DGK+C  T + C    G   P G C +L   + C C  GY    +     + CD  P               + +CP                         +G+C +P+  N  + +C    +PG    G G  C     D             G   S  D++    D++ C  S     C  G CIN    +RCEC  G+ LD  G  C +  E        + +     T  +  GSF   CN G                        RC+ +  SY+C C  GY    D K+C D+DEC+     C+     C N  G++ C C  G      P G  C D NEC     +C+NG C N  GS++C+CN G+ SS+   +C+
Sbjct: 1868 RCE---CAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMD-VDECERHP--CGNGTCKNTVGSYN--CLCYPGFELT------HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNE-CVALPGSCSP-GTCQNLEGSFRCICPPGYEVRSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPG---EGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTRE---DVNECLES--PGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECS------IGNPCGNGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMA--RRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECL 2372          

HSP 8 Score: 126.716 bits (317), Expect = 5.416e-29
Identity = 157/571 (27.50%), Postives = 232/571 (40.63%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR-------------DQCKGGA--------CINMKNHYRCECLPGFVLD-----------------KQGQACKERVEYKTN-QMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGG------PKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDT-------EPSKI---------CKKCSHYCKYSN-----GLFVCSCPNGLDAVLETGLCAKVSQ 2189
            E GF+ +   C DI+EC+ + + C+ G C+N  GSF+C C   ++  P + DCV    +C    NLC  G  CV++ I  + C C PGY  + D     +Q     D C           +C     +Y+C C++GY    DG+SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL P ++C  G+C       + C C  G++       C  +  D+ EIG  + N D  +S  ++   F    R             D+C  G         C+N    YRC C  GF  D                 + GQ       Y+   +M    +S S   Q     SF  +C  G C      + C C+ GY+    G  C+DIDEC+ +P  C  G C+N+PG Y+C+C   F ++    G        CY +       SL  N           C C+ G    N  + C  V  NS + Y          P+ I         C++    C+  N     G F C CP G     ET +C  + +
Sbjct: 1140 ESGFMMMKN-CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLCRNG-KCVNM-IGTYQCSCNPGYQATPD-----RQGCTDIDECMIMNGGC--DTQCTNSEGSYECSCSEGYALMPDGRSCAD-IDECEN-NPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNP-NICMFGEC-ENTKGSFICHCQLGYSVKKGTTGCTDV--DECEIG--AHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA-DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPV--NSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDE 1688          

HSP 9 Score: 122.479 bits (306), Expect = 1.199e-27
Identity = 134/530 (25.28%), Postives = 215/530 (40.57%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV-------EYKTNQMNDVASSFSLKTQC----DKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGL------NNVYFELFSATDREDFRSKVTTQFNDTVLDKCESSTEDKIKPGV 2387
            Q    C+   NLC  G    ++S Y   C+C  GY +  +G                     C  G C+    +Y C+C+ G+  +   ++C   +D C + NGV+C NG+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                        D+D C        C  G CIN +  +RC+C PG  +   G+ C +         E K             K++C      +G          ++ + +   C++G   ++DG+   DI+EC+++P IC  G C N  GSY+C+C  G+       G  C D +EC     LC NG+C+NT GS+ C C  GY+   + + C  V +      ++ P       +  C+ + G F C C  G   +  TGL    S       +I DN R   +IN           +     S  +R +  +     F       CE   E ++ PGV
Sbjct:  486 QTIDICKHHANLCLNGRCIPTVSSYR--CECNMGYKQDANGDCIDVDECTSNP---------CSNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQ-NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE-DGSFKCVCKPGFILAPNGRYCT-----------------------DVDECQTPGI---CMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGR---DINECALDPDICANGICENLRGSYRCNCNSGYEPD--ASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNE-----CESNPCV-----NGACRNNLGSFHCECSPG-SKLSSTGLICIDSLKGTCWLNIQDN-RCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGV 958          

HSP 10 Score: 117.857 bits (294), Expect = 3.242e-26
Identity = 132/513 (25.73%), Postives = 201/513 (39.18%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC---KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQCRRIMSDQS---EIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECS---------------------------------------INPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKY 2057
            C+DINEC  + +  + +C+N  GS+ C C   Y     Q  C    +  E + +    GM C +L I   +C C PG  +  DG+ C  ++      CR   P +C  G+C+    +Y+CECN+G+ +SS G  C   ++ + F      +        +L     C CD G    +  + C        + +CP G           EC+ +P     G   QC   M       ++G T+  + S ++  D+D C  S     C    C N K  Y+C C  G+VL + G+ CK+  E +T Q N      +    F+ K                +C    S     G C  +  S+ C+C  G+     G  C D+DEC                                         NP  C   +C N+ GSY+C+C  GF+         C+D NEC+ + + C  G C NT G + C C  GY    +   CVS    +  +Y
Sbjct: 2244 CEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNL-IGTFMCICPPGMARRPDGEGCVDENE-----CRTK-PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNG---QCVNTMGSFRCFCKVGYTT--DISGTACVDLDEC--SQSPKPCNF-ICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECSNPGACGSASCYNTLGSYKCACPSGFSFDQFSSA--CHDVNECSSSKNPCSYG-CSNTEGGYLCGCPPGYFRVGQGH-CVSGMGFNKGQY 2737          

HSP 11 Score: 108.612 bits (270), Expect = 2.010e-23
Identity = 119/438 (27.17%), Postives = 173/438 (39.50%), Query Frame = 3
Query:  717 ICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ------------RKKKCEQIPN---------LCGPGMDCVSLS---------IYNHLCKCLPGYVK-------SLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA--PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
             C D+NEC  +  IC  G+C N +GSF C C   Y        C                  C  +P            G G+ C+ L            N  C   PG  +       + DG +CS       D C      +C  G+C+     Y+CEC  G+  +SD +SC+  +D C+  N  +C  G C +L   + C CD GY        CT I +      C +G C+  P   YEC C P F   P G G    R+ +   + GP      S +++  +        R  C    C ++   +   CE  P     +    C     ++ N +  +        +C +    LC  G CI +  S+QC+C  GY  S + ++C DIDEC  +P +C  GTC N+ G+Y C C   +   N  GG  C D
Sbjct: 1315 TCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSD-----VDECA-ENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQD-IDECSFQN--ICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGR-YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGV-----GVSRSSC----CCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDID---ECQELPG-LCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVN--GGHNCMD 1727          

HSP 12 Score: 103.605 bits (257), Expect = 7.119e-22
Identity = 106/399 (26.57%), Postives = 162/399 (40.60%), Query Frame = 3
Query:  684 RCEKGF--IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            +C  GF        C DI+EC Q   +CK+G+C+N  GSF+C+C++ ++      +CV   +      N+C  GM C++    +  C C PG++ + +G+ C+       D C+   P +C  G CI +  +++C+C  G     DG+ C  T    T Y  +    G CV                             +P ++     C   P+ G+   C P   P     +   + S  S IG T    D      D D          C  G C N++  YRC C  G+  D  G+ C +  E   N++                   LC+NG C  +  SY C C  GY    + + C D++EC  NP  C  G C N+ GS+ C C  G  +
Sbjct:  552 KCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDEC--TTTNMCLNGM-CINED-GSFKCVCKPGFILAPNGRYCT-----DVDECQT--PGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEI--KKGVCVR---------------------------PFPGAVTKSECCCANPDYGFGEPCQP--CPAKNSAEFHGLCS--SGIGITVDGRDINECALDPDI---------CANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRL-------------------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESNP--CVNGACRNNLGSFHCECSPGSKL 876          

HSP 13 Score: 93.2041 bits (230), Expect = 1.074e-18
Identity = 132/532 (24.81%), Postives = 205/532 (38.53%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL--DGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIM-SDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-------RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC----IESGSSYQCQCNT--GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C +GF      C D++EC + + +C++G+C+N  G++RC C   +        C Q   +C    N+C  G            C  LPG    +  DG    +   N  D+     P  C  G C+     Y+C C   +  +  G  C         + F  R +G +  N +     +   C C  G       + C  +      +LCP G+   P P      +  EC+ LPG     +G  C     S Q E        +      DID CF   +   C  G C N   +Y C C P ++    G  C +       R    T   N++  + + +  C  +      N  C        + ++  C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++     C D +EC+   +LC +N  C N+ GS++C+C +G+           +  N       E  +I   CSH  C    G + C C NG  A  +  +C  V +
Sbjct: 1429 CSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSC-QDIDEC-SFQNICVFGT-----------CNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC---QGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFA--HPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLL--LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF----------KLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDE 1930          

HSP 14 Score: 77.7962 bits (190), Expect = 5.981e-14
Identity = 114/461 (24.73%), Postives = 174/461 (37.74%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQL-SKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC+C  GF    +G  C +   G CF  + + +C        L +K  CC      WG  C+ C L                    Q+ +IC  G                Y  D    D      +C+ +P+LC  G  CV+ ++ +  C C  GY   + G +C        D C    P  C+F  C     +Y+C C +GY+   DGK+CK   +  T+ +        CV+    + C+C  G+T  +      + C   P      G C   P + + C C  GF+    G  C                        D+D C  ++   +C+ G C N+   YRC C  G+V             Y+ NQ  D       + +C   G+  C +  C  +  SY+C C +G+        C D++ECS + + C  G C N+ G Y C C  G+
Sbjct: 2355 RCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPL----------------PGTAQYKKICPHGP--------------GYATDGRDID------ECKVMPSLCTNGQ-CVN-TMGSFRCFCKVGYTTDISGTACVD-----LDECS-QSPKPCNF-ICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC---QFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGS-FSCECQRGFSLDASGLNCE-----------------------DVDECDGNH---RCQHG-CQNILGGYRCGCPQGYVQ-----------HYQWNQCVD-------ENECSNPGA--CGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYG-CSNTEGGYLCGCPPGY 2718          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Mouse
Match: Fbn1 (fibrillin 1 [Source:MGI Symbol;Acc:MGI:95489])

HSP 1 Score: 185.267 bits (469), Expect = 2.592e-47
Identity = 172/587 (29.30%), Postives = 244/587 (41.57%), Query Frame = 3
Query:  501 CQCKP----GFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCE--------QIPNLCGPGMDCVSLSI-------------------YNHLCKCLPGYVKS--LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            C+C P      T   C E + G C+ ++  G C  +  G  L  E CC +   AWG PC  C+L   C KGF  I G  C+DINEC+ +  +CK+G C+N RGSF+C C +    D     C+  R + C          +P      MD    S+                   Y  LC   PG+      +GK   K      + C+   P +C  GKC     ++KC C+ G+   S+ ++C   +D C R +  +C  G+CV+   D+ C+CD GY S +   K C  I +     L   G         Y C C PG                  ++ P      + S+  DI+ C  S   + C  G C+N+   Y+C C PG+        C            D+     +   C+ F         C  S  SY+C C  G+    D + C+DIDEC  NP+ICD G C N PG Y+C C+DGF          C D NEC    ++C +G C+NT GSF C C+ GY     K  C  + +     ++     +C         + G F CSC  G 
Sbjct:  832 CECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSE-CCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKD----INECKMI-PSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDEC-RISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGH-----------------QLSP------NISACIDINECELS--ANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCV-----------DIDECSIMNGGCETF---------CTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASE--DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTN-------TAGSFKCSCSPGW 1356          

HSP 2 Score: 169.474 bits (428), Expect = 2.740e-42
Identity = 181/632 (28.64%), Postives = 262/632 (41.46%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRCEL--------------GRCEKGFIEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQC---IPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLC--------------------------NNGR---CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDN 2222
            +C+C  G T    G+ C +I    CFL      C   P   +   + CC +   AWG + C+ C L              G   K         +DINEC+    +C  GKC N  GSF+C C S +  D  + +C     +C   P+LCG G  CV+ +  +  CKC  GY    +  K+C      + D      P +C  G C     +Y+CEC  G+  S +  +C    +     +  +CP+G+CV+L   Y C C+ GY  ++DR  C  I  C +       +G C       +  YEC C PGFA M   + C  I  D+ E  P                       + C GG C N+   YRC C  GF+  +  + C +  E       D+  +  L   C+   GSF+C                          N GR   C  +  S++C C+ G+    DG  C+D+DECS    +C Q   C N+ GSY+C C DG+T      G  C D +EC+E  +LC NG C N  G ++C+C+ G++ S   + C  + + S          IC      C    GLF C C  G +     G C  V++ +D    I  N
Sbjct:  936 KCECPNGMTLDATGRICLDIRLETCFLKYDDEECTL-PIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDECRISPDLCGRGQ-CVN-TPGDFECKCDEGYESGFMMMKNCMDIDECQRD------PLLCRGGICHNTEGSYRCECPPGHQLSPNISACIDINE--CELSANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIM------NGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDI--DECEDNP-----------------------NICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNEC------DLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGD----GFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECS-------LPNICV--FGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGN 1503          

HSP 3 Score: 155.221 bits (391), Expect = 7.470e-38
Identity = 167/583 (28.64%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSL-SRG----VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE---------LGRCEKGFI--EIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQS-----ANKY--------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG-----------------KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCP-DGQCIPQPNNGYECRCLPGFAPMGKGK-----QCRRIMSDQSE------IGP--------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C C P F    T   C +  +G C+L +  RG        +  G+ +SK  CC +   AWG PC+ C          L    +GF    I  I +DI+ECQ    +C+ GKCIN  GSF+C C + Y  +     C     +CE  P +CGPG      ++ N+ C C P Y++   G +C          N Y        ++       +C     I   +N  CE  Q  I S+D                        +D C    G VC NG C+++   + C+C  G+  +     C  I +     +C  + +CI      Y C C PG+     G+     +C+ I +  S       +G           +N D      DI+ C     RD C  G C N    + C C  GF+L               N   DV        +C      LC NG+C+ +  S+QC+CN GY+ + DG+ C DI+EC ++P  C  GTC N  GSY+C C  G+++ N     KC D +EC E   +C  G C NT GSF+C C  G+  S+  + C  ++
Sbjct: 1513 CDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVC-DDVNECE-TPGICGPGT--CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPG-VCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECI-NTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCL-DINEC----ERDACGNGTCRNTIGSFNCRCNHGFILSHN------------NDCIDV-------DECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQN----DKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLR 2059          

HSP 4 Score: 152.91 bits (385), Expect = 3.914e-37
Identity = 189/702 (26.92%), Postives = 272/702 (38.75%), Query Frame = 3
Query:  270 CCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----EEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQ-VAWGDPCQRCELGRCEKGFIEI-----------DGICQDINECQWSQICKSGKCINERGSFRCLCSSSY-------------------------------------QFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ---SANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY-----PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            C  GY +  +G   + I  N C  +     P TCQ  +G     C      + D+  +      E E         T  + +C C  GF    TG+ C ++    C+     G C   P     SK+ CC A +   WGDPC+ C     ++ F +I           D    D++EC+   +C+ G+CIN  GS+RC C   Y                                      F+P      +   +C Q P LC     CV+ +  ++ CKC  GYV   D + C  +   +  K+D             +C      Y C C  GY    DG+ C    +  T+    +C NG+C++    Y C+C+ G+T+S  + +C    + Y      +++C  G     P    EC C  G    G G  C        EI P       K          ++  DID C      D C+ G C+N +  Y C C  G+  D  G AC +      N+ N          Q  K  +F+C N     +  SYQC C  GY    DG+ C D+DEC+     C Q  C+N+ G + C C  GFT H+      C D NECT   +LC   G+C+NT GSF C+C  G+        C  V +               +C H C+   G + CSCP G
Sbjct: 1960 CNEGYEVAPDGRTCVDI--NECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEP-DEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLC--AFRCVN-TYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTE-------KQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPG--ICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGG---RGWGPHC--------EICPFEGTVAYKKLCPHGRGFMTNGADIDEC--KVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVD-----LNECN----------QAPKPCNFICKN-----TEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGN----------HRCQHGCQNIIGGYRCSCPQG 2597          

HSP 5 Score: 150.984 bits (380), Expect = 1.486e-36
Identity = 148/471 (31.42%), Postives = 208/471 (44.16%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGP-----------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGA--------CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            E GF+ +   C DI+ECQ   + C+ G C N  GS+RC C   +Q  P  + C+    +CE   NLC P   CV+L I  + C C PGY  + D   C        D C         F  C     +Y+C C  G+    D +SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL P ++C  G C       + C C  G++       C  I  ++ EIG            T+ +     S G I         D+C  G         C N    YRC C  G+  D  G  C +  E   N +N                  LC NG+C+ +   Y+C+C+ G+  S DGK C DIDECS+ P+IC  GTC N PG ++C C  G+ +     G  C D NEC + T+ C +G C NT GS+ C C   +  +  +  CV  +
Sbjct: 1104 ESGFMMMKN-CMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACID-INECELSANLC-PHGRCVNL-IGKYQCACNPGYHPTHDRLFCVD-----IDECSIMNGGCETF--CTNSDGSYECSCQPGFALMPDQRSCTD-IDECED-NPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP-NICLSGTC-ENTKGSFICHCDMGYSGKKGKTGCTDI--NECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGD--GFTCTDLDECSEN-LN------------------LCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSL-PNICVFGTCHNLPGLFRCECEIGYELDR--SGGNCTDVNECLDPTT-CISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTR 1532          

HSP 6 Score: 146.747 bits (369), Expect = 3.144e-35
Identity = 122/431 (28.31%), Postives = 200/431 (46.40%), Query Frame = 3
Query:  753 ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER--VEYKT--NQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
            +C++G+CI   GS+RC C+  +Q D ++ +C+    +CE+ P     G +C++ +  ++ C C  GY  +L     ++      D C   G  +C+ G+CI    ++ C CN G+  + DGK+C+  +D C+  N  +C NG C++    + C C  G+  + D + C  I +     +C +G+C+   +  Y C C PG A    G+ C       +                    C+  Y R QC       +     C     +   +  Q C  +   EY+   +    + S+ +   +C      +C NG C     +Y+C CN+GY+  + GK C DI+EC +N  +CD G C N+PGS+ C+C  GF     P    C D +EC   +S C NG+CKN+ GSF C+C+        K  C+  
Sbjct:  461 LCQNGRCIPTPGSYRCECNKGFQLD-IRGECID-VDECEKNPCT---GGECIN-NQGSYTCHCRAGYQSTL-----TRTECRDIDECLQNG-RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCED-MDECSIRN--MCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCV-NTDGSYRCECFPGLAVGLDGRVCVDTHMRST--------------------CYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINEC-ALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYK--PDLKTCEDIDEC--ESSPCINGVCKNSPGSFICECSPESTLDPTKTICIET 850          

HSP 7 Score: 144.436 bits (363), Expect = 1.782e-34
Identity = 176/667 (26.39%), Postives = 257/667 (38.53%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQ-VAWGDPCQRCELGRCEKGFIEI-----------DGICQDINECQWSQICKSGKCINERGSFRCLCSSSY-------------------------------------QFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ---SANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY-----PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD---NSNQKYDTEPSKICKKCS-------HY---------------------CKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +C C  GF    TG+ C ++    C+     G C   P     SK+ CC A +   WGDPC+ C     ++ F +I           D    D++EC+   +C+ G+CIN  GS+RC C   Y                                      F+P      +   +C Q P LC     CV+ +  ++ CKC  GYV   D + C  +   +  K+D             +C      Y C C  GY    DG+ C    +  T+    +C NG+C++    Y C+C+ G+T+S  + +C    + Y      +++C  G     P    EC C  G    G G  C        EI P       K          ++  DID C      D C+ G C+N +  Y C C  G+  D  G AC +      N+ N          Q  K  +F+C N     +  SYQC C  GY    DG+ C D+DEC+     C Q  C+N+ G + C C  GFT H+      C D NECT   +LC   G+C+NT GSF C+C  G+        C  V +   N   ++  +      +CS       HY                     C  + G + C CP G      +G C  +++
Sbjct: 2039 KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEP-DEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCA--FRCVN-TYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTE-------KQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPG--ICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGG---RGWGPHC--------EICPFEGTVAYKKLCPHGRGFMTNGADIDEC--KVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVD-----LNECN----------QAPKPCNFICKN-----TEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDINE 2653          

HSP 8 Score: 132.494 bits (332), Expect = 1.048e-30
Identity = 157/559 (28.09%), Postives = 229/559 (40.97%), Query Frame = 3
Query:  498 RCQCKPGF----TGK-----SCSEIVN----GECFLSLSRGVCMKHP-YGLQLSKELCCGAFQV---AWGDPCQRCELG----RCEKGFI-EIDGICQDINECQWSQ--ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT-VDFC-TRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQ----------CDKFGS-----FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC--DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RC CKPG+    TG+      C EI N    G+C  ++    C+ H  +   + + +C    +    A G+   R  +G    RC  GFI   +  C D++EC      +C++G+C+N  GSF+C C+  Y+  P    CV    +C   P  C PG  C +L   ++ C C PGY  SL    C        D C    P +C  G C     ++KC C +G+  SS G+ C+   + +C  ++ G  C + K  + S    C    G       + C +  D   R +CP G  I                                 +GP         S  D+D C      D C+ G CIN    YRCEC  G++L  +G  C +  E             +V   F    +          C+          LC   RC+ +  SY+C+C  GY    D ++C D DEC+     C   Q  C N  G+Y C C  G+     P G  C D NEC     +C+NG C NT GS+ C+CN G+ +S  + +C+
Sbjct: 1834 RCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVD-INECVLDPGKCAPGT-CQNLD-GSYRCICPPGY--SLQNDKCE-----DIDEC-VEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGII--------------------------------VGP-------DDSAVDMDEC---KEPDVCRHGQCINTDGSYRCECPFGYIL--EGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGY--QRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECL 2334          

HSP 9 Score: 118.242 bits (295), Expect = 2.358e-26
Identity = 135/549 (24.59%), Postives = 225/549 (40.98%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLS---RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQ-----------------------RCELGRCEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC CK G+TG   +     EC  +L+    G C+  P G +   ++  G    A G  C+                       RCE   CE G+ E+D   G C D+NEC     C SG C+N  GS+ C C   ++ +P +  CV  R   C       G   D      + + +    C C  G       + C   + ++Y +       +C  G    +G+      N   +   D       +D C    G+ C  GKC++    + C+C +GY  + D + C  + +     +C  G C     N Y C C P +  +  G  C   M  +  +   +   D+++  G++    ++  +  C     I    +  CE  P    D+    C  +   +   + D+ +   +     +    +C NG CI    S++C+C  G+  +    +C DIDEC   P       CIN+ GSY+C C  G+ + +     +C DRNEC E  ++C +G C +T GSF C C++G+ ++  +  C+ + +
Sbjct: 1390 RCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDM--GFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCE---CEIGY-ELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKI-------LCPGG----EGFRP----NPITVILED-------IDECQELPGL-CQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGN-YTCICPPDYMQVNGGNNC---MDMRRSLCYRNYYADNQTCDGEL---LFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQ---RPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTG---QCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINE 1896          

HSP 10 Score: 117.087 bits (292), Expect = 5.217e-26
Identity = 114/424 (26.89%), Postives = 170/424 (40.09%), Query Frame = 3
Query:  996 NKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCIN----SPGSYQCSCFDGFTIHNMPGGP---------------------KCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            N  D C+    Y+C  G+CI    +Y+CECN+G+     G+     VD C +     C  G+C++    Y C C +GY S+  R +C  I + L    +C +G+CI   +  + C C  GF     GK C                        D+D C     R+ C  G CIN    ++C C PGF L   G+ CK+  E +T                      +C NGRC+ +  SY+C+C  G    LDG++C D    S       +G C+     +    +C C         P  P                        D NEC     +C NGIC+N  G+++C CNSGY      ++CV + +          S +C   +  C+ + G FVC+CP G     +   C  + +
Sbjct:  450 NVTDYCQLV-RYLCQNGRCIPTPGSYRCECNKGFQLDIRGEC--IDVDECEKN---PCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICNNGRCI-NTDGSFHCVCNAGFHVTRDGKNCE-----------------------DMDEC---SIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECET--------------------PGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLN------SLLCD--NGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDE 812          

HSP 11 Score: 114.39 bits (285), Expect = 3.777e-25
Identity = 89/277 (32.13%), Postives = 128/277 (46.21%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC 980
            ++CG   N++ CC G++    G+ C +PIC + CG +G C RPN C C +G I+ SC                          +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GSF C C + ++F+ V   C +   +C  IP +C  G +C + ++ ++ CKC PG+  S DG  C
Sbjct:   57 NVCGSRYNAY-CCPGWKTLPGGNQCIVPICRHSCG-DGFCSRPNMCTCPSGQISPSCGSRSIQHCSIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEVSQKC-EDIDECSTIPGVCD-GGECTN-TVSSYFCKCPPGFYTSPDGTRC 328          

HSP 12 Score: 104.76 bits (260), Expect = 3.275e-22
Identity = 120/427 (28.10%), Postives = 172/427 (40.28%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIAD--GYNYKCECNQGYIASSDGKSCK--------KTVDFCTRYNGV---------------VCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C  GF +  DG  C+D++EC    +C +G CINE GSF+C+C   +Q       C +   +CE  P +C  G  CV+    ++ C+C PG    LDG+ C     + +     YG Y    G+C+    G   K EC       + G+ C+        +    C+   G+               +CPNG C +L   Y C C+SGY      K C  I +    S LC +GQC   P + + C C  GF      K C                        DID C  S     C  G C N    + CEC P   LD     C E ++  T     +     +        S  C++           CQ    C  G+ + + G  C DI+EC + P +C  G C+NS GS++C C +G T+
Sbjct:  559 CNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYC-KDINECE-TPGICMNGR-CVNTD-GSYRCECFPGLAVGLDGRVC----VDTHMRSTCYGGY--RRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGS-FVCTCPKGFVYKPDLKTCE-----------------------DIDECESS----PCINGVCKNSPGSFICECSPESTLDPTKTICIETIK-GTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICGKGF-SRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTL 945          

HSP 13 Score: 101.293 bits (251), Expect = 4.029e-21
Identity = 120/448 (26.79%), Postives = 171/448 (38.17%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLCGPGMD-----------CVSLSIYNHLCKCLP-----GYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCP-NGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYI 2000
            C D NECQ    IC++G+C+N  GS+ C C+  +   P Q +C+  ++     E + N+C  G             C     +   C+  P      Y K          +    D C+     VC  G+C+ D  +Y C C  GY     G +C   VD     N    P N  C +    Y C C  GY    D + C  + +   +       C+     G+ C+C PGF               Q       +NE +     DI+ C           G C N    + CEC  GF LD+ G +C++  E +                    G+  C +G C      Y+C C  GY        C D +EC ++  +C   +C N+ GSY+C C  GF      GG  C D NEC  + + C  G C NT G + C C  GY 
Sbjct: 2291 CIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHD-VCRNGECVNDRGSYHCICKTGYTPDITGTAC---VDL-NECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCV-NTIGGFTCKCPPGFT--------------QHHTACIDNNECTS----DINLCGSK--------GVCQNTPGSFTCECQRGFSLDQSGASCEDVDECE--------------------GNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVDENEC-LSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGG--CQDINECGSSQAPCSYG-CSNTEGGYLCGCPPGYF 2681          

HSP 14 Score: 67.3958 bits (163), Expect = 9.555e-11
Identity = 36/104 (34.62%), Postives = 54/104 (51.92%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C  G+  ++    C D+DEC   P +C  G CIN+ GS++C C  G   + +    KC D +EC+    +C  G C NT  S+ C+C  G+ +S     CV V+
Sbjct:  231 CRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEV--SQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGFYTSPDGTRCVDVR 332          

HSP 15 Score: 61.6178 bits (148), Expect = 5.459e-9
Identity = 41/111 (36.94%), Postives = 57/111 (51.35%), Query Frame = 3
Query: 1674 LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKN----TYGSFQCQCNSG 1994
            +C  G CI +  S++C+C  G++ +   + C DIDECS  P +CD G C N+  SY C C  GF  +  P G +C D       T+L  NG C N    +    QC C+ G
Sbjct:  256 MCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGF--YTSPDGTRCVDVRPGYCYTAL-ANGRCSNQLPQSITKMQCCCDLG 363          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Mouse
Match: Fbn1 (fibrillin 1 [Source:MGI Symbol;Acc:MGI:95489])

HSP 1 Score: 185.267 bits (469), Expect = 2.592e-47
Identity = 172/587 (29.30%), Postives = 244/587 (41.57%), Query Frame = 3
Query:  501 CQCKP----GFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCE--------QIPNLCGPGMDCVSLSI-------------------YNHLCKCLPGYVKS--LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            C+C P      T   C E + G C+ ++  G C  +  G  L  E CC +   AWG PC  C+L   C KGF  I G  C+DINEC+ +  +CK+G C+N RGSF+C C +    D     C+  R + C          +P      MD    S+                   Y  LC   PG+      +GK   K      + C+   P +C  GKC     ++KC C+ G+   S+ ++C   +D C R +  +C  G+CV+   D+ C+CD GY S +   K C  I +     L   G         Y C C PG                  ++ P      + S+  DI+ C  S   + C  G C+N+   Y+C C PG+        C            D+     +   C+ F         C  S  SY+C C  G+    D + C+DIDEC  NP+ICD G C N PG Y+C C+DGF          C D NEC    ++C +G C+NT GSF C C+ GY     K  C  + +     ++     +C         + G F CSC  G 
Sbjct:  832 CECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSE-CCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKD----INECKMI-PSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDEC-RISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGH-----------------QLSP------NISACIDINECELS--ANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCV-----------DIDECSIMNGGCETF---------CTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASE--DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTN-------TAGSFKCSCSPGW 1356          

HSP 2 Score: 169.474 bits (428), Expect = 2.740e-42
Identity = 181/632 (28.64%), Postives = 262/632 (41.46%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRCEL--------------GRCEKGFIEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQC---IPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLC--------------------------NNGR---CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDN 2222
            +C+C  G T    G+ C +I    CFL      C   P   +   + CC +   AWG + C+ C L              G   K         +DINEC+    +C  GKC N  GSF+C C S +  D  + +C     +C   P+LCG G  CV+ +  +  CKC  GY    +  K+C      + D      P +C  G C     +Y+CEC  G+  S +  +C    +     +  +CP+G+CV+L   Y C C+ GY  ++DR  C  I  C +       +G C       +  YEC C PGFA M   + C  I  D+ E  P                       + C GG C N+   YRC C  GF+  +  + C +  E       D+  +  L   C+   GSF+C                          N GR   C  +  S++C C+ G+    DG  C+D+DECS    +C Q   C N+ GSY+C C DG+T      G  C D +EC+E  +LC NG C N  G ++C+C+ G++ S   + C  + + S          IC      C    GLF C C  G +     G C  V++ +D    I  N
Sbjct:  936 KCECPNGMTLDATGRICLDIRLETCFLKYDDEECTL-PIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDECRISPDLCGRGQ-CVN-TPGDFECKCDEGYESGFMMMKNCMDIDECQRD------PLLCRGGICHNTEGSYRCECPPGHQLSPNISACIDINE--CELSANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIM------NGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDI--DECEDNP-----------------------NICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNEC------DLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGD----GFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECS-------LPNICV--FGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGN 1503          

HSP 3 Score: 155.221 bits (391), Expect = 7.470e-38
Identity = 167/583 (28.64%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSL-SRG----VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE---------LGRCEKGFI--EIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQS-----ANKY--------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG-----------------KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCP-DGQCIPQPNNGYECRCLPGFAPMGKGK-----QCRRIMSDQSE------IGP--------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C C P F    T   C +  +G C+L +  RG        +  G+ +SK  CC +   AWG PC+ C          L    +GF    I  I +DI+ECQ    +C+ GKCIN  GSF+C C + Y  +     C     +CE  P +CGPG      ++ N+ C C P Y++   G +C          N Y        ++       +C     I   +N  CE  Q  I S+D                        +D C    G VC NG C+++   + C+C  G+  +     C  I +     +C  + +CI      Y C C PG+     G+     +C+ I +  S       +G           +N D      DI+ C     RD C  G C N    + C C  GF+L               N   DV        +C      LC NG+C+ +  S+QC+CN GY+ + DG+ C DI+EC ++P  C  GTC N  GSY+C C  G+++ N     KC D +EC E   +C  G C NT GSF+C C  G+  S+  + C  ++
Sbjct: 1513 CDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVC-DDVNECE-TPGICGPGT--CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPG-VCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECI-NTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCL-DINEC----ERDACGNGTCRNTIGSFNCRCNHGFILSHN------------NDCIDV-------DECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQN----DKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLR 2059          

HSP 4 Score: 152.91 bits (385), Expect = 3.914e-37
Identity = 189/702 (26.92%), Postives = 272/702 (38.75%), Query Frame = 3
Query:  270 CCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----EEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQ-VAWGDPCQRCELGRCEKGFIEI-----------DGICQDINECQWSQICKSGKCINERGSFRCLCSSSY-------------------------------------QFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ---SANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY-----PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            C  GY +  +G   + I  N C  +     P TCQ  +G     C      + D+  +      E E         T  + +C C  GF    TG+ C ++    C+     G C   P     SK+ CC A +   WGDPC+ C     ++ F +I           D    D++EC+   +C+ G+CIN  GS+RC C   Y                                      F+P      +   +C Q P LC     CV+ +  ++ CKC  GYV   D + C  +   +  K+D             +C      Y C C  GY    DG+ C    +  T+    +C NG+C++    Y C+C+ G+T+S  + +C    + Y      +++C  G     P    EC C  G    G G  C        EI P       K          ++  DID C      D C+ G C+N +  Y C C  G+  D  G AC +      N+ N          Q  K  +F+C N     +  SYQC C  GY    DG+ C D+DEC+     C Q  C+N+ G + C C  GFT H+      C D NECT   +LC   G+C+NT GSF C+C  G+        C  V +               +C H C+   G + CSCP G
Sbjct: 1960 CNEGYEVAPDGRTCVDI--NECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEP-DEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLC--AFRCVN-TYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTE-------KQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPG--ICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGG---RGWGPHC--------EICPFEGTVAYKKLCPHGRGFMTNGADIDEC--KVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVD-----LNECN----------QAPKPCNFICKN-----TEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGN----------HRCQHGCQNIIGGYRCSCPQG 2597          

HSP 5 Score: 150.984 bits (380), Expect = 1.486e-36
Identity = 148/471 (31.42%), Postives = 208/471 (44.16%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGP-----------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGA--------CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            E GF+ +   C DI+ECQ   + C+ G C N  GS+RC C   +Q  P  + C+    +CE   NLC P   CV+L I  + C C PGY  + D   C        D C         F  C     +Y+C C  G+    D +SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL P ++C  G C       + C C  G++       C  I  ++ EIG            T+ +     S G I         D+C  G         C N    YRC C  G+  D  G  C +  E   N +N                  LC NG+C+ +   Y+C+C+ G+  S DGK C DIDECS+ P+IC  GTC N PG ++C C  G+ +     G  C D NEC + T+ C +G C NT GS+ C C   +  +  +  CV  +
Sbjct: 1104 ESGFMMMKN-CMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACID-INECELSANLC-PHGRCVNL-IGKYQCACNPGYHPTHDRLFCVD-----IDECSIMNGGCETF--CTNSDGSYECSCQPGFALMPDQRSCTD-IDECED-NPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP-NICLSGTC-ENTKGSFICHCDMGYSGKKGKTGCTDI--NECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGD--GFTCTDLDECSEN-LN------------------LCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSL-PNICVFGTCHNLPGLFRCECEIGYELDR--SGGNCTDVNECLDPTT-CISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTR 1532          

HSP 6 Score: 146.747 bits (369), Expect = 3.144e-35
Identity = 122/431 (28.31%), Postives = 200/431 (46.40%), Query Frame = 3
Query:  753 ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER--VEYKT--NQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
            +C++G+CI   GS+RC C+  +Q D ++ +C+    +CE+ P     G +C++ +  ++ C C  GY  +L     ++      D C   G  +C+ G+CI    ++ C CN G+  + DGK+C+  +D C+  N  +C NG C++    + C C  G+  + D + C  I +     +C +G+C+   +  Y C C PG A    G+ C       +                    C+  Y R QC       +     C     +   +  Q C  +   EY+   +    + S+ +   +C      +C NG C     +Y+C CN+GY+  + GK C DI+EC +N  +CD G C N+PGS+ C+C  GF     P    C D +EC   +S C NG+CKN+ GSF C+C+        K  C+  
Sbjct:  461 LCQNGRCIPTPGSYRCECNKGFQLD-IRGECID-VDECEKNPCT---GGECIN-NQGSYTCHCRAGYQSTL-----TRTECRDIDECLQNG-RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCED-MDECSIRN--MCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCV-NTDGSYRCECFPGLAVGLDGRVCVDTHMRST--------------------CYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINEC-ALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYK--PDLKTCEDIDEC--ESSPCINGVCKNSPGSFICECSPESTLDPTKTICIET 850          

HSP 7 Score: 144.436 bits (363), Expect = 1.782e-34
Identity = 176/667 (26.39%), Postives = 257/667 (38.53%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQ-VAWGDPCQRCELGRCEKGFIEI-----------DGICQDINECQWSQICKSGKCINERGSFRCLCSSSY-------------------------------------QFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ---SANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY-----PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD---NSNQKYDTEPSKICKKCS-------HY---------------------CKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +C C  GF    TG+ C ++    C+     G C   P     SK+ CC A +   WGDPC+ C     ++ F +I           D    D++EC+   +C+ G+CIN  GS+RC C   Y                                      F+P      +   +C Q P LC     CV+ +  ++ CKC  GYV   D + C  +   +  K+D             +C      Y C C  GY    DG+ C    +  T+    +C NG+C++    Y C+C+ G+T+S  + +C    + Y      +++C  G     P    EC C  G    G G  C        EI P       K          ++  DID C      D C+ G C+N +  Y C C  G+  D  G AC +      N+ N          Q  K  +F+C N     +  SYQC C  GY    DG+ C D+DEC+     C Q  C+N+ G + C C  GFT H+      C D NECT   +LC   G+C+NT GSF C+C  G+        C  V +   N   ++  +      +CS       HY                     C  + G + C CP G      +G C  +++
Sbjct: 2039 KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEP-DEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCA--FRCVN-TYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTE-------KQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPG--ICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGG---RGWGPHC--------EICPFEGTVAYKKLCPHGRGFMTNGADIDEC--KVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVD-----LNECN----------QAPKPCNFICKN-----TEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDINE 2653          

HSP 8 Score: 132.494 bits (332), Expect = 1.048e-30
Identity = 157/559 (28.09%), Postives = 229/559 (40.97%), Query Frame = 3
Query:  498 RCQCKPGF----TGK-----SCSEIVN----GECFLSLSRGVCMKHP-YGLQLSKELCCGAFQV---AWGDPCQRCELG----RCEKGFI-EIDGICQDINECQWSQ--ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT-VDFC-TRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQ----------CDKFGS-----FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC--DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RC CKPG+    TG+      C EI N    G+C  ++    C+ H  +   + + +C    +    A G+   R  +G    RC  GFI   +  C D++EC      +C++G+C+N  GSF+C C+  Y+  P    CV    +C   P  C PG  C +L   ++ C C PGY  SL    C        D C    P +C  G C     ++KC C +G+  SS G+ C+   + +C  ++ G  C + K  + S    C    G       + C +  D   R +CP G  I                                 +GP         S  D+D C      D C+ G CIN    YRCEC  G++L  +G  C +  E             +V   F    +          C+          LC   RC+ +  SY+C+C  GY    D ++C D DEC+     C   Q  C N  G+Y C C  G+     P G  C D NEC     +C+NG C NT GS+ C+CN G+ +S  + +C+
Sbjct: 1834 RCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVD-INECVLDPGKCAPGT-CQNLD-GSYRCICPPGY--SLQNDKCE-----DIDEC-VEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGII--------------------------------VGP-------DDSAVDMDEC---KEPDVCRHGQCINTDGSYRCECPFGYIL--EGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGY--QRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECL 2334          

HSP 9 Score: 118.242 bits (295), Expect = 2.358e-26
Identity = 135/549 (24.59%), Postives = 225/549 (40.98%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLS---RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQ-----------------------RCELGRCEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC CK G+TG   +     EC  +L+    G C+  P G +   ++  G    A G  C+                       RCE   CE G+ E+D   G C D+NEC     C SG C+N  GS+ C C   ++ +P +  CV  R   C       G   D      + + +    C C  G       + C   + ++Y +       +C  G    +G+      N   +   D       +D C    G+ C  GKC++    + C+C +GY  + D + C  + +     +C  G C     N Y C C P +  +  G  C   M  +  +   +   D+++  G++    ++  +  C     I    +  CE  P    D+    C  +   +   + D+ +   +     +    +C NG CI    S++C+C  G+  +    +C DIDEC   P       CIN+ GSY+C C  G+ + +     +C DRNEC E  ++C +G C +T GSF C C++G+ ++  +  C+ + +
Sbjct: 1390 RCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDM--GFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCE---CEIGY-ELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKI-------LCPGG----EGFRP----NPITVILED-------IDECQELPGL-CQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGN-YTCICPPDYMQVNGGNNC---MDMRRSLCYRNYYADNQTCDGEL---LFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQ---RPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTG---QCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINE 1896          

HSP 10 Score: 117.087 bits (292), Expect = 5.217e-26
Identity = 114/424 (26.89%), Postives = 170/424 (40.09%), Query Frame = 3
Query:  996 NKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCIN----SPGSYQCSCFDGFTIHNMPGGP---------------------KCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            N  D C+    Y+C  G+CI    +Y+CECN+G+     G+     VD C +     C  G+C++    Y C C +GY S+  R +C  I + L    +C +G+CI   +  + C C  GF     GK C                        D+D C     R+ C  G CIN    ++C C PGF L   G+ CK+  E +T                      +C NGRC+ +  SY+C+C  G    LDG++C D    S       +G C+     +    +C C         P  P                        D NEC     +C NGIC+N  G+++C CNSGY      ++CV + +          S +C   +  C+ + G FVC+CP G     +   C  + +
Sbjct:  450 NVTDYCQLV-RYLCQNGRCIPTPGSYRCECNKGFQLDIRGEC--IDVDECEKN---PCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICNNGRCI-NTDGSFHCVCNAGFHVTRDGKNCE-----------------------DMDEC---SIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECET--------------------PGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLN------SLLCD--NGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDE 812          

HSP 11 Score: 114.39 bits (285), Expect = 3.777e-25
Identity = 89/277 (32.13%), Postives = 128/277 (46.21%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC 980
            ++CG   N++ CC G++    G+ C +PIC + CG +G C RPN C C +G I+ SC                          +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GSF C C + ++F+ V   C +   +C  IP +C  G +C + ++ ++ CKC PG+  S DG  C
Sbjct:   57 NVCGSRYNAY-CCPGWKTLPGGNQCIVPICRHSCG-DGFCSRPNMCTCPSGQISPSCGSRSIQHCSIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEVSQKC-EDIDECSTIPGVCD-GGECTN-TVSSYFCKCPPGFYTSPDGTRC 328          

HSP 12 Score: 104.76 bits (260), Expect = 3.275e-22
Identity = 120/427 (28.10%), Postives = 172/427 (40.28%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIAD--GYNYKCECNQGYIASSDGKSCK--------KTVDFCTRYNGV---------------VCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C  GF +  DG  C+D++EC    +C +G CINE GSF+C+C   +Q       C +   +CE  P +C  G  CV+    ++ C+C PG    LDG+ C     + +     YG Y    G+C+    G   K EC       + G+ C+        +    C+   G+               +CPNG C +L   Y C C+SGY      K C  I +    S LC +GQC   P + + C C  GF      K C                        DID C  S     C  G C N    + CEC P   LD     C E ++  T     +     +        S  C++           CQ    C  G+ + + G  C DI+EC + P +C  G C+NS GS++C C +G T+
Sbjct:  559 CNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYC-KDINECE-TPGICMNGR-CVNTD-GSYRCECFPGLAVGLDGRVC----VDTHMRSTCYGGY--RRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGS-FVCTCPKGFVYKPDLKTCE-----------------------DIDECESS----PCINGVCKNSPGSFICECSPESTLDPTKTICIETIK-GTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICGKGF-SRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTL 945          

HSP 13 Score: 101.293 bits (251), Expect = 4.029e-21
Identity = 120/448 (26.79%), Postives = 171/448 (38.17%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLCGPGMD-----------CVSLSIYNHLCKCLP-----GYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCP-NGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYI 2000
            C D NECQ    IC++G+C+N  GS+ C C+  +   P Q +C+  ++     E + N+C  G             C     +   C+  P      Y K          +    D C+     VC  G+C+ D  +Y C C  GY     G +C   VD     N    P N  C +    Y C C  GY    D + C  + +   +       C+     G+ C+C PGF               Q       +NE +     DI+ C           G C N    + CEC  GF LD+ G +C++  E +                    G+  C +G C      Y+C C  GY        C D +EC ++  +C   +C N+ GSY+C C  GF      GG  C D NEC  + + C  G C NT G + C C  GY 
Sbjct: 2291 CIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHD-VCRNGECVNDRGSYHCICKTGYTPDITGTAC---VDL-NECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCV-NTIGGFTCKCPPGFT--------------QHHTACIDNNECTS----DINLCGSK--------GVCQNTPGSFTCECQRGFSLDQSGASCEDVDECE--------------------GNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVDENEC-LSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGG--CQDINECGSSQAPCSYG-CSNTEGGYLCGCPPGYF 2681          

HSP 14 Score: 67.3958 bits (163), Expect = 9.555e-11
Identity = 36/104 (34.62%), Postives = 54/104 (51.92%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C  G+  ++    C D+DEC   P +C  G CIN+ GS++C C  G   + +    KC D +EC+    +C  G C NT  S+ C+C  G+ +S     CV V+
Sbjct:  231 CRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEV--SQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGFYTSPDGTRCVDVR 332          

HSP 15 Score: 61.6178 bits (148), Expect = 5.459e-9
Identity = 41/111 (36.94%), Postives = 57/111 (51.35%), Query Frame = 3
Query: 1674 LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKN----TYGSFQCQCNSG 1994
            +C  G CI +  S++C+C  G++ +   + C DIDECS  P +CD G C N+  SY C C  GF  +  P G +C D       T+L  NG C N    +    QC C+ G
Sbjct:  256 MCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGF--YTSPDGTRCVDVRPGYCYTAL-ANGRCSNQLPQSITKMQCCCDLG 363          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Mouse
Match: Ltbp1 (latent transforming growth factor beta binding protein 1 [Source:MGI Symbol;Acc:MGI:109151])

HSP 1 Score: 146.747 bits (369), Expect = 2.286e-35
Identity = 139/492 (28.25%), Postives = 213/492 (43.29%), Query Frame = 3
Query:  726 DINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCE-CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYIC-QCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +INEC  +  IC +G CIN    + C+C   Y+F      CV    +C Q+ +LC  G      +  + LC C  G++ S +G +C        D+     P +C  G+CI     ++CE C+ GY  S  G    + +D C + +   CP  +CV+    Y C  C  G+       +C  + +     +C +G C       Y C C  G++P    + C+ I                +  QG++           C  G C N    +RC C  G+ L      C++  E + +                     LC++G+C  +  S+QC CN GY+AS+ G  C DI+EC  + S+C  G CIN+ GSY C+C DGF +++  G   C D NEC +      +G C NT GSF C C  G+  S   + C  + +  N       + +C   SH +C  + G F C C  G  A  +   C  V++
Sbjct:  494 EINECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQLRKCVD-IDECAQVRHLCSQGR--CENTEGSFLCVCPAGFMASEEGTNC-------IDVDECLRPDMCRDGRCINTAGAFRCEYCDSGYRMSRRGYC--EDIDECLKPS--TCPEEQCVNTPGSYQCVPCTEGFRGW--NGQCLDVDECLQPKVCTNGSCT-NLEGSYMCSCHRGYSPTPDHRHCQDI---------------DECQQGNL-----------CMNGQCRNTDGSFRCTCGQGYQLSAAKDQCEDIDECEHHH--------------------LCSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINECLEDSSVCQGGDCINTAGSYDCTCPDGFQLNDNKG---CQDINECAQPGLCGSHGECLNTQGSFHCVCEQGFSISADGRTCEDIDECVN-------NTVCD--SHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNE 910          

HSP 2 Score: 128.257 bits (321), Expect = 1.448e-29
Identity = 134/482 (27.80%), Postives = 200/482 (41.49%), Query Frame = 3
Query:  699 FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKC-ECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC-DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSC 2135
            F E    C DI+EC Q   +C  G+C N  GSF C+C + +       +C+   +     P++C  G  C++ +       C  GY  S  G           D+     P  C   +C+    +Y+C  C +G+    +G+     VD C +    VC NG C +L   Y+C C  GY+ + D + C  I +    +LC +GQC    +  + C C  G+       QC                        DID C + +    C  G C N +  ++C C  G+     G  C++  E   +                   S +C  G CI +  SY C C  G+Q + D K C DI+EC+  P +C   G C+N+ GS+ C C  GF+I     G  C D +EC   T    +G C NT GSF+C C  G+ +    Q CV V +          S +C +   +C+   G F+C C
Sbjct:  527 FSEQLRKCVDIDECAQVRHLCSQGRCENTEGSFLCVCPAGFMASEEGTNCIDVDECLR--PDMCRDGR-CINTAGAFRCEYCDSGYRMSRRGYC--------EDIDECLKPSTCPEEQCVNTPGSYQCVPCTEGF-RGWNGQCLD--VDECLQPK--VCTNGSCTNLEGSYMCSCHRGYSPTPDHRHCQDIDECQQGNLCMNGQCR-NTDGSFRCTCGQGYQLSAAKDQCE-----------------------DIDECEHHHL---CSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINECLED-------------------SSVCQGGDCINTAGSYDCTCPDGFQLN-DNKGCQDINECA-QPGLCGSHGECLNTQGSFHCVCEQGFSISA--DGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELL------SGVCGEA--FCENVEGSFLCVC 934          

HSP 3 Score: 125.946 bits (315), Expect = 7.050e-29
Identity = 150/587 (25.55%), Postives = 233/587 (39.69%), Query Frame = 3
Query:  552 GECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRC----------ELGRCEKGFIEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV-------QRKKKCEQIPNLCGPGMDC---VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRF------YGP-------YVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPD----GQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ-CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQC-SCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            G CF       C K   GL   +E CCG    +WG + CQ+C          ++  C +G+  ++   CQDINECQ   +C +G+C+N  GS+RC C   +  DP  + CV       + K  C +   L  PG  C   +S+ +   +C C  G       + C      K +          +GP             K I      K     G    S G S   T+    ++  VV      V +        ++  +S+      T + ++   ++ PD    G CI  P   Y C C  G+    + ++C                        DID C  +  R  C  G C N +  + C C  GF+  ++G  C +  E     M                    C +GRCI +  +++C+ C++GY+ S  G  C DIDEC + PS C +  C+N+PGSYQC  C +GF   N     +C D +EC +   +C NG C N  GS+ C C+ GY  +   + C  +        + +   +C   +  C+ ++G F C+C  G         C  + +
Sbjct:  231 GRCFQETIGSQCGKALPGLS-KQEDCCGTVGTSWGFNKCQKCPKKQSYHGYTQMMECLQGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCSCKMGFGPDPTFSSCVPDPPVISEEKGPCYR---LVSPGRHCMHPLSVHLTKQICCCSVGKAWGPHCEKCPLPGTAKEEPVEALTSSWEHGPRGAEPEVVTAPPEKEIPSLDQEKTRLEPGQPQLSPGVS---TIHLHPQFPVVVEKTSPPVPVE----VAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVR-YTCICYEGYKFSEQLRKCV-----------------------DIDEC--AQVRHLCSQGRCENTEGSFLCVCPAGFMASEEGTNCIDVDECLRPDM--------------------CRDGRCINTAGAFRCEYCDSGYRMSRRG-YCEDIDEC-LKPSTCPEEQCVNTPGSYQCVPCTEGFRGWNG----QCLDVDECLQ-PKVCTNGSCTNLEGSYMCSCHRGYSPTPDHRHCQDID-------ECQQGNLCM--NGQCRNTDGSFRCTCGQGYQLSAAKDQCEDIDE 744          

HSP 4 Score: 110.923 bits (276), Expect = 3.482e-24
Identity = 114/416 (27.40%), Postives = 174/416 (41.83%), Query Frame = 3
Query:  687 CEKGFI--EIDGICQDINECQWSQICKSGKCINERGSFRC-LCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDID-FCFYSYYRDQCKG----------------GACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFD 1859
            C  GF+  E    C D++EC    +C+ G+CIN  G+FRC  C S Y+        + R+  CE I     P+ C P   CV+         C  G+ +  +G+          D+     P VC  G C     +Y C C++GY  + D + C+  +D C +  G +C NG+C +    + C C  GY  S  + +C  I +     LC  GQC       ++C C  G+     G  C  I ++  E        D  ++ G  D  C   +  +  KG                G C+N +  + C C  GF +   G+ C++  E   N            T CD  G   C+N     +  S++C C  G+QA  DG+ C D++EC +   +C +  C N  GS+ C C D
Sbjct:  563 CPAGFMASEEGTNCIDVDECLRPDMCRDGRCINTAGAFRCEYCDSGYR--------MSRRGYCEDIDECLKPSTC-PEEQCVNTPGSYQCVPCTEGF-RGWNGQC--------LDVDECLQPKVCTNGSCTNLEGSYMCSCHRGYSPTPDHRHCQD-IDECQQ--GNLCMNGQCRNTDGSFRCTCGQGYQLSAAKDQCEDIDECEHHHLCSHGQCR-NTEGSFQCVCNQGYRASVLGDHCEDI-NECLEDSSVCQGGDCINTAGSYDCTCPDGFQLNDNKGCQDINECAQPGLCGSHGECLNTQGSFHCVCEQGFSISADGRTCEDIDECVNN------------TVCDSHG--FCDN-----TAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCAD 936          

HSP 5 Score: 90.5077 bits (223), Expect = 6.522e-18
Identity = 105/403 (26.05%), Postives = 176/403 (43.67%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVC-HFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVC-PNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCL---PGFAPMGKGKQCRRIMSDQSEIG--PTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQA--------CKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C+DI+EC+   +C  G+C N  GSF+C+C+  Y+   V  D  +   +C +  ++C  G DC++ +  ++ C C  G+  + D K C        D+     P +C   G+C+    ++ C C QG+  S+DG++C+  +D C   N  VC  +G C + +  + C C  G+ +  D + C  +  C+L    +C +  C       + C C      ++PM    QCR  +++ S +   P    ++   +  D   C      +  K   C      +   CE  P  V   QG A         K  V    +  +    ++    +C  FG  +C NG C+ +   Y+C C  G         C D+DEC  +P+ C  G C+N+ GSY C C     +
Sbjct:  739 CEDIDECEHHHLCSHGQCRNTEGSFQCVCNQGYRAS-VLGDHCEDINECLEDSSVCQ-GGDCIN-TAGSYDCTCPDGFQLN-DNKGCQ-------DINECAQPGLCGSHGECLNTQGSFHCVCEQGFSISADGRTCED-IDECV--NNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELL-SGVCGEAFC-ENVEGSFLCVCADENQEYSPMTG--QCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPV---QGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQ-DPNSCIDGQCVNTEGSYNCFCTHPMVL 1119          

HSP 6 Score: 76.6406 bits (187), Expect = 1.010e-13
Identity = 116/481 (24.12%), Postives = 171/481 (35.55%), Query Frame = 3
Query:  720 CQDINECQW-SQICKSGKCINERGSFRCLCSSSYQ-FDPVQADCVQR--------------KKKCEQIPNLCGPGMDCVSLSIYNHLCKCL--PGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY-RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSD----------IDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET---TSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTE 2066
            C D+NEC+  S +C    C N  GSF C+C+   Q + P+   C  R              KK+C    N      + ++ ++    C C    G+  + +   C  Q   ++         +C  GK +            G  +   G    K  D C  +   +C NG C++    Y C C  G      + +C  + +    + C DGQC+      Y C C          K+C         + PT SNE  + +    D C+     +       +  +  Y  C CL G     Q   C  +      Q+ ++  +                 GR    G       +  Y    D     D           +EC I  + C+ G C+     Y C CFDG+  H       C D NEC+E     SLCKN  C NT GS++C C  GYI S+K   C  +  NS    D E
Sbjct:  905 CVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTE-------MCPRGKGLVPA---------GESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQDPNSCIDGQCV-NTEGSYNCFCTHPMVLDASEKRC---------VQPTESNEQIEETDVYQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVT-----------------GRRRPYGRDALVDFSEQYGPETDPYFIQDRFLNSFEELQAEECGIL-NGCENGRCVRVQEGYTCDCFDGY--HLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEGSYKCLCLPGYIPSDKPNYCTPL--NSALNLDKE 1337          

HSP 7 Score: 65.0846 bits (157), Expect = 3.596e-10
Identity = 134/601 (22.30%), Postives = 205/601 (34.11%), Query Frame = 3
Query:  267 VCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGF-IEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQ-FDPVQADCVQR--------------KKKCEQIPNLCGPGMDCVSLSIYNHLCKCL--PGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY-RCECLPGFVLDKQGQACK-----------------ERVEYKTNQMNDVASSFSLKTQC----DKF-GSFL------------CNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI---NPSICDQGTCINSPGSYQCSCFDGFTIHNMP 1883
             C  G++L+    C     +N C + G C     C  + G                                      C C+ GF+    G++C +I   EC   ++  VC  H +    +     G+F         RC    C +GF    DG  C D+NEC+  S +C    C N  GSF C+C+   Q + P+   C  R              KK+C    N      + ++ ++    C C    G+  + +   C  Q   ++         +C  GK +            G  +   G    K  D C  +   +C NG C++    Y C C  G      + +C  + +    + C DGQC+      Y C C          K+C         + PT SNE  + +    D C+     +       +  +  Y  C CL G     Q   C                   R  Y  + + D +  +  +T      D+F  SF             C NGRC+     Y C C  GY   +    C D++ECS      S+C    CIN+ GSY+C C  G+   + P
Sbjct:  808 TCPDGFQLNDNKGCQD---INECAQPGLCGSHGECLNTQGSF-----------------------------------HCVCEQGFSISADGRTCEDI--DEC---VNNTVCDSHGFCDNTA-----GSF---------RC---LCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTE-------MCPRGKGLVPA---------GESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQDPNSCIDGQCV-NTEGSYNCFCTHPMVLDASEKRC---------VQPTESNEQIEETDVYQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRRPYGRDALVDFSEQYGPETDPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEGSYKCLCLPGYIPSDKP 1322          

HSP 8 Score: 65.0846 bits (157), Expect = 4.226e-10
Identity = 102/392 (26.02%), Postives = 150/392 (38.27%), Query Frame = 3
Query:  720 CQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVC-HFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQC--------------------DSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPN-NGYECRCLPGFAPMGKGKQCRRI------MSDQSEIGP-----TSSNEDSKSSQG----DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDE 1781
            C+DINEC + S +C+ G CIN  GS+ C C   +Q +  +    Q   +C Q P LCG   +C++     H C C  G+  S DG++C        D+       VC   G C     +++C C QG+ A  DG+ C   V+ C   +GV C    C ++   ++C C                    DSG       +K     +L   SLC +   +  PN    EC C  G    G G  C          ++ +E+ P       + E S  + G    D D C   +  + CK G C+N +  Y C C  G   D     C     +  ++  D  S               C +G+C+ +  SY C C          K C    E
Sbjct:  780 CEDINECLEDSSVCQGGDCINTAGSYDCTCPDGFQLNDNKG--CQDINECAQ-PGLCGSHGECLNTQGSFH-CVCEQGFSISADGRTCE-------DIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVD-VNECELLSGV-CGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDN---VLAPNVTKQECCCTSG---AGWGDNCEIFPCPVQGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADECLL-FGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQC-----FDMDECQDPNS---------------CIDGQCVNTEGSYNCFCTHPMVLDASEKRCVQPTE 1131          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Mouse
Match: Ltbp1 (latent transforming growth factor beta binding protein 1 [Source:MGI Symbol;Acc:MGI:109151])

HSP 1 Score: 145.976 bits (367), Expect = 3.863e-35
Identity = 139/492 (28.25%), Postives = 213/492 (43.29%), Query Frame = 3
Query:  726 DINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCE-CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYIC-QCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +INEC  +  IC +G CIN    + C+C   Y+F      CV    +C Q+ +LC  G      +  + LC C  G++ S +G +C        D+     P +C  G+CI     ++CE C+ GY  S  G    + +D C + +   CP  +CV+    Y C  C  G+       +C  + +     +C +G C       Y C C  G++P    + C+ I                +  QG++           C  G C N    +RC C  G+ L      C++  E + +                     LC++G+C  +  S+QC CN GY+AS+ G  C DI+EC  + S+C  G CIN+ GSY C+C DGF +++  G   C D NEC +      +G C NT GSF C C  G+  S   + C  + +  N       + +C   SH +C  + G F C C  G  A  +   C  V++
Sbjct:  547 EINECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQLRKCVD-IDECAQVRHLCSQGR--CENTEGSFLCVCPAGFMASEEGTNC-------IDVDECLRPDMCRDGRCINTAGAFRCEYCDSGYRMSRRGYC--EDIDECLKPS--TCPEEQCVNTPGSYQCVPCTEGFRGW--NGQCLDVDECLQPKVCTNGSCT-NLEGSYMCSCHRGYSPTPDHRHCQDI---------------DECQQGNL-----------CMNGQCRNTDGSFRCTCGQGYQLSAAKDQCEDIDECEHHH--------------------LCSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINECLEDSSVCQGGDCINTAGSYDCTCPDGFQLNDNKG---CQDINECAQPGLCGSHGECLNTQGSFHCVCEQGFSISADGRTCEDIDECVN-------NTVCD--SHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNE 963          

HSP 2 Score: 127.487 bits (319), Expect = 2.206e-29
Identity = 134/482 (27.80%), Postives = 201/482 (41.70%), Query Frame = 3
Query:  699 FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKC-ECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC-DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSC 2135
            F E    C DI+EC Q   +C  G+C N  GSF C+C + +       +C+   +     P++C  G  C++ +       C  GY  S  G           D+     P  C   +C+    +Y+C  C +G+    +G+     VD C +    VC NG C +L   Y+C C  GY+ + D + C  I +    +LC +GQC    +  + C C  G+       QC                        DID C + +    C  G C N +  ++C C  G+     G  C++        +N+               S +C  G CI +  SY C C  G+Q + D K C DI+EC+  P +C   G C+N+ GS+ C C  GF+I     G  C D +EC   T    +G C NT GSF+C C  G+ +    Q CV V +          S +C +   +C+   G F+C C
Sbjct:  580 FSEQLRKCVDIDECAQVRHLCSQGRCENTEGSFLCVCPAGFMASEEGTNCIDVDECLR--PDMCRDGR-CINTAGAFRCEYCDSGYRMSRRGYC--------EDIDECLKPSTCPEEQCVNTPGSYQCVPCTEGF-RGWNGQCLD--VDECLQPK--VCTNGSCTNLEGSYMCSCHRGYSPTPDHRHCQDIDECQQGNLCMNGQCR-NTDGSFRCTCGQGYQLSAAKDQCE-----------------------DIDECEHHHL---CSHGQCRNTEGSFQCVCNQGYRASVLGDHCED--------INECLED-----------SSVCQGGDCINTAGSYDCTCPDGFQLN-DNKGCQDINECA-QPGLCGSHGECLNTQGSFHCVCEQGFSISA--DGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELL------SGVCGEA--FCENVEGSFLCVC 987          

HSP 3 Score: 110.153 bits (274), Expect = 5.090e-24
Identity = 114/416 (27.40%), Postives = 174/416 (41.83%), Query Frame = 3
Query:  687 CEKGFI--EIDGICQDINECQWSQICKSGKCINERGSFRC-LCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDID-FCFYSYYRDQCKG----------------GACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFD 1859
            C  GF+  E    C D++EC    +C+ G+CIN  G+FRC  C S Y+        + R+  CE I     P+ C P   CV+         C  G+ +  +G+          D+     P VC  G C     +Y C C++GY  + D + C+  +D C +  G +C NG+C +    + C C  GY  S  + +C  I +     LC  GQC       ++C C  G+     G  C  I ++  E        D  ++ G  D  C   +  +  KG                G C+N +  + C C  GF +   G+ C++  E   N            T CD  G   C+N     +  S++C C  G+QA  DG+ C D++EC +   +C +  C N  GS+ C C D
Sbjct:  616 CPAGFMASEEGTNCIDVDECLRPDMCRDGRCINTAGAFRCEYCDSGYR--------MSRRGYCEDIDECLKPSTC-PEEQCVNTPGSYQCVPCTEGF-RGWNGQC--------LDVDECLQPKVCTNGSCTNLEGSYMCSCHRGYSPTPDHRHCQD-IDECQQ--GNLCMNGQCRNTDGSFRCTCGQGYQLSAAKDQCEDIDECEHHHLCSHGQCR-NTEGSFQCVCNQGYRASVLGDHCEDI-NECLEDSSVCQGGDCINTAGSYDCTCPDGFQLNDNKGCQDINECAQPGLCGSHGECLNTQGSFHCVCEQGFSISADGRTCEDIDECVNN------------TVCDSHG--FCDN-----TAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCAD 989          

HSP 4 Score: 90.1225 bits (222), Expect = 9.073e-18
Identity = 105/403 (26.05%), Postives = 176/403 (43.67%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVC-HFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVC-PNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCL---PGFAPMGKGKQCRRIMSDQSEIG--PTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQA--------CKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C+DI+EC+   +C  G+C N  GSF+C+C+  Y+   V  D  +   +C +  ++C  G DC++ +  ++ C C  G+  + D K C        D+     P +C   G+C+    ++ C C QG+  S+DG++C+  +D C   N  VC  +G C + +  + C C  G+ +  D + C  +  C+L    +C +  C       + C C      ++PM    QCR  +++ S +   P    ++   +  D   C      +  K   C      +   CE  P  V   QG A         K  V    +  +    ++    +C  FG  +C NG C+ +   Y+C C  G         C D+DEC  +P+ C  G C+N+ GSY C C     +
Sbjct:  792 CEDIDECEHHHLCSHGQCRNTEGSFQCVCNQGYRAS-VLGDHCEDINECLEDSSVCQ-GGDCIN-TAGSYDCTCPDGFQLN-DNKGCQ-------DINECAQPGLCGSHGECLNTQGSFHCVCEQGFSISADGRTCED-IDECV--NNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELL-SGVCGEAFC-ENVEGSFLCVCADENQEYSPMTG--QCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPV---QGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQ-DPNSCIDGQCVNTEGSYNCFCTHPMVL 1172          

HSP 5 Score: 76.2554 bits (186), Expect = 1.330e-13
Identity = 116/481 (24.12%), Postives = 171/481 (35.55%), Query Frame = 3
Query:  720 CQDINECQW-SQICKSGKCINERGSFRCLCSSSYQ-FDPVQADCVQR--------------KKKCEQIPNLCGPGMDCVSLSIYNHLCKCL--PGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY-RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSD----------IDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET---TSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTE 2066
            C D+NEC+  S +C    C N  GSF C+C+   Q + P+   C  R              KK+C    N      + ++ ++    C C    G+  + +   C  Q   ++         +C  GK +            G  +   G    K  D C  +   +C NG C++    Y C C  G      + +C  + +    + C DGQC+      Y C C          K+C         + PT SNE  + +    D C+     +       +  +  Y  C CL G     Q   C  +      Q+ ++  +                 GR    G       +  Y    D     D           +EC I  + C+ G C+     Y C CFDG+  H       C D NEC+E     SLCKN  C NT GS++C C  GYI S+K   C  +  NS    D E
Sbjct:  958 CVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTE-------MCPRGKGLVPA---------GESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQDPNSCIDGQCV-NTEGSYNCFCTHPMVLDASEKRC---------VQPTESNEQIEETDVYQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVT-----------------GRRRPYGRDALVDFSEQYGPETDPYFIQDRFLNSFEELQAEECGIL-NGCENGRCVRVQEGYTCDCFDGY--HLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEGSYKCLCLPGYIPSDKPNYCTPL--NSALNLDKE 1390          

HSP 6 Score: 64.6994 bits (156), Expect = 5.741e-10
Identity = 134/601 (22.30%), Postives = 205/601 (34.11%), Query Frame = 3
Query:  267 VCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGF-IEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQ-FDPVQADCVQR--------------KKKCEQIPNLCGPGMDCVSLSIYNHLCKCL--PGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY-RCECLPGFVLDKQGQACK-----------------ERVEYKTNQMNDVASSFSLKTQC----DKF-GSFL------------CNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI---NPSICDQGTCINSPGSYQCSCFDGFTIHNMP 1883
             C  G++L+    C     +N C + G C     C  + G                                      C C+ GF+    G++C +I   EC   ++  VC  H +    +     G+F         RC    C +GF    DG  C D+NEC+  S +C    C N  GSF C+C+   Q + P+   C  R              KK+C    N      + ++ ++    C C    G+  + +   C  Q   ++         +C  GK +            G  +   G    K  D C  +   +C NG C++    Y C C  G      + +C  + +    + C DGQC+      Y C C          K+C         + PT SNE  + +    D C+     +       +  +  Y  C CL G     Q   C                   R  Y  + + D +  +  +T      D+F  SF             C NGRC+     Y C C  GY   +    C D++ECS      S+C    CIN+ GSY+C C  G+   + P
Sbjct:  861 TCPDGFQLNDNKGCQD---INECAQPGLCGSHGECLNTQGSF-----------------------------------HCVCEQGFSISADGRTCEDI--DEC---VNNTVCDSHGFCDNTA-----GSF---------RC---LCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTE-------MCPRGKGLVPA---------GESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQDPNSCIDGQCV-NTEGSYNCFCTHPMVLDASEKRC---------VQPTESNEQIEETDVYQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRRPYGRDALVDFSEQYGPETDPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEGSYKCLCLPGYIPSDKP 1375          

HSP 7 Score: 64.6994 bits (156), Expect = 5.840e-10
Identity = 102/392 (26.02%), Postives = 150/392 (38.27%), Query Frame = 3
Query:  720 CQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVC-HFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQC--------------------DSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPN-NGYECRCLPGFAPMGKGKQCRRI------MSDQSEIGP-----TSSNEDSKSSQG----DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDE 1781
            C+DINEC + S +C+ G CIN  GS+ C C   +Q +  +    Q   +C Q P LCG   +C++     H C C  G+  S DG++C        D+       VC   G C     +++C C QG+ A  DG+ C   V+ C   +GV C    C ++   ++C C                    DSG       +K     +L   SLC +   +  PN    EC C  G    G G  C          ++ +E+ P       + E S  + G    D D C   +  + CK G C+N +  Y C C  G   D     C     +  ++  D  S               C +G+C+ +  SY C C          K C    E
Sbjct:  833 CEDINECLEDSSVCQGGDCINTAGSYDCTCPDGFQLNDNKG--CQDINECAQ-PGLCGSHGECLNTQGSFH-CVCEQGFSISADGRTCE-------DIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVD-VNECELLSGV-CGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDN---VLAPNVTKQECCCTSG---AGWGDNCEIFPCPVQGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADECLL-FGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQC-----FDMDECQDPNS---------------CIDGQCVNTEGSYNCFCTHPMVLDASEKRCVQPTE 1184          

HSP 8 Score: 63.5438 bits (153), Expect = 1.212e-9
Identity = 49/155 (31.61%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  552 GECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRC----------ELGRCEKGFIEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV-------QRKKKCEQIPNLCGPGMDC---VSLSIYNHLCKCLPG 950
            G CF       C K   GL   +E CCG    +WG + CQ+C          ++  C +G+  ++   CQDINECQ   +C +G+C+N  GS+RC C   +  DP  + CV       + K  C +   L  PG  C   +S+ +   +C C  G
Sbjct:  231 GRCFQETIGSQCGKALPGLS-KQEDCCGTVGTSWGFNKCQKCPKKQSYHGYTQMMECLQGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCSCKMGFGPDPTFSSCVPDPPVISEEKGPCYR---LVSPGRHCMHPLSVHLTKQICCCSVG 381          
BLAST of Latent transforming growth factor beta binding protein 3 vs. UniProt/SwissProt
Match: sp|Q61555|FBN2_MOUSE (Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 7.468e-50
Identity = 170/552 (30.80%), Postives = 241/552 (43.66%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-GRCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC----------EQIPNL-----------CGPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
             C+C PG     TG  C + + G C+L++    C  +  G  L  E CC     AWG PC+RCEL   C +GF  I G+ C+D+NEC+ +  +C +G+C+N +GSF C C      D     C+  R + C            +P                G +C          Y  LC   PG+    D  +  +      + C+ + P +C +GKC     ++KC CN G+    + ++C   +D C R +  +C +G CV+    + C+C  GY S +   K C  I  C+  P  LC  G C+      ++C C     P+G             E+ P  S ED      DI+ C  S   + C+ G C+NM   Y+C C PG+      Q C            D+     +   CD          +C  S  SY+C C+ GY    DG+ C+DIDEC  NP ICD G C N PG Y+C C+DGF    +M     C D NEC    ++C  G C+NT GSF C C  GY        C  V +
Sbjct:  867 HCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSE-CCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILT-GRPFYKDINECKAF-PGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTD-IDEC-RISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPL-LCRGGTCV-NTEGSFQCDC-----PLGH------------ELSP--SREDCV----DINEC--SLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC-----------TDIDECMIMNGGCDT---------QCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM---KTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDE 1363          

HSP 2 Score: 181.03 bits (458), Expect = 4.073e-45
Identity = 171/622 (27.49%), Postives = 266/622 (42.77%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
             C+C  G T    G+ C +I    CFL      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  +C  GKC N  GSF+C C++ +  D  + +C     +C   P+LCG G+ CV+ +  +  C+C  GY           ++    D C    P +C  G C+    +++C+C  G+  S   + C   ++ C+  + + C NGKCV++   Y C C+ GY ++ DR+ CT I +    +   D QC       YEC C  G+A M  G+ C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+  +  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C D+DEC+     C     C+N+PGSY+C+C +GFT      G  C D +EC E T+LC+NG C N  G+++C+C  G+  ++  + C  + + S Q        IC      C    G+F C C +G +     G C  + +  D
Sbjct:  972 HCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECI-HPVPGKFRMDACCCAVGAAWGTECEECP----KPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTD-IDECRISPDLCGSGI-CVN-TPGSFECECFEGYESGFM----MMKNCMDIDECE-RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT-NSEGSYECSCSEGYALMPDGRSCADI--DECENNP-----------------------DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC------DLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVG--NGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGD----GFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQ-------NICV--FGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD 1531          

HSP 3 Score: 168.703 bits (426), Expect = 3.309e-41
Identity = 162/611 (26.51%), Postives = 260/611 (42.55%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE--RVEYKT--------NQMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC C PG      G+ C +  +   C+  + +GVC++   G     E CC      +G+PCQ C         G C  G  I +DG  +DINEC     IC +G C N RGS+RC C+S Y+ D    +C+    +C     LC  G+     +  ++ C C PGYV   + ++C   +  + + C          G C  +  ++ CEC+ G   SS G  C  ++                 NG    +  C +L   +      C+ D+     + R K   C  +  C+++P  +CP+G+C+      + C C  G    G G+ C  I                      ++ CF  +  D+C        +    C C  G     + + C +    EY+T            D+ +        ++  +F  +C  G+C  +  S++C+CN G+   ++ + C+DIDEC I+P +C  G C+N+PGS++C CF+G+    M     C D +EC     LC+ G C NT GSFQC C  G+  S  ++DCV + + S          +C+  +  C    G + CSC  G  A  +   C  + +
Sbjct:  674 RCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDG--RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCID-IDECLVNRLLCDNGL--CRNTPGSYSCTCPPGYVFRTETETCEDVNECESNPCVN--------GACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFP-GVCPNGRCV-NSKGSFHCECPEGLTLDGTGRVCLDIR---------------------MEHCFLKWDEDECIHPVPGKFRMDACC-CAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMM-MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLS------DNLCR--NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDE 1238          

HSP 4 Score: 164.466 bits (415), Expect = 6.233e-40
Identity = 194/731 (26.54%), Postives = 284/731 (38.85%), Query Frame = 3
Query:  216 QTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYI----CQCDSG--YTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA---PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG---------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVR 2234
            Q +    ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS+G I+ +C  +                       +                 N G      RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ                                           IP LC  G +C++ ++ +  C+C  G+ +S      + Q     D C    P VC  G C     +Y C C +G++ S+DG  C       T ++G+V  NG+C       +    C C+ G  ++     + C        R LC DG     P  G     +PG +   P G G          +   P   +       G                      ID C   ++ + C  G CI   + YRCEC  G+  D  G                           D+  S  C+NG C+ +  SY C+C+ G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +     G  C D +ECT TT++C NG+C N  GSF+C C  G+I +   + C  V        + +   IC   + +C  + G F C CP GL   ++  +C           +I   V VR
Sbjct:   80 QEILRGPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSSGQISPTCGAKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQ------------------------------------------AIPGLC-QGGNCIN-TVGSFECRCPAGHKQSE-----TTQKCEDIDECSVI-PGVCETGDCSNTVGSYFCLCPRGFVTSTDGSRCIDQRAG-TCFSGLV--NGRCAQELPGRMAKAQCCCEPGRCWSIGTIPEACPVRGSEEYRRLCLDGL----PMGG-----IPGSSVSRPGGTGSTGNGYGPGGTGFLPIPGDNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDIC--KHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC----------------------IDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT--DGKNCVDHDECT-TTNMCLNGMCINEDGSFKCVCKPGFILAPNGRYCTDVD-------ECQTPGICM--NGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVR 710          

HSP 5 Score: 148.673 bits (374), Expect = 6.195e-35
Identity = 169/615 (27.48%), Postives = 234/615 (38.05%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEIGPTSSNEDSKSS-------------------------------------QGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF +   G C   P     +K  CC +      WGDPC+ C           C  G   +  +    +D+NEC  S  IC +G+CIN  GSFRC C   Y  D     CV   +    I N CG G  C ++ I +  C C  G+     G   + +  N+        P +C F +C+    +Y+C C  GY    D K CK   +     +        C +L   ++C C  G     D + C   + C   P  +C +G+C+      Y C C  GF     G +C           ++    ++  +S N  +KS                                        DID C        C  G C+N    +RC C  G+  D  G AC +  E                +Q  K  +F+C N +      SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC    SLC   GIC+NT GSF C+C  G+       +C  V +               +C H C+   G + C CP G
Sbjct: 2073 QCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKC-SVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDEC--SIGNPCGNGT-CTNV-IGSFECTCNEGFEP---GPMMNCEDINECAQ----NPLLCAF-RCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKP-GICENGRCV-NIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDEC--KVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDEC---------------SQSPKPCNFICKNTK-----GSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC-QFLCVNTLGGFTCKCPPGFTQHHT----ACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGN----------HRCQHGCQNILGGYRCGCPQG 2635          

HSP 6 Score: 136.346 bits (342), Expect = 3.641e-31
Identity = 155/609 (25.45%), Postives = 226/609 (37.11%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLS-RG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC----------------------------------EL-GRCEKG------------------FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK----------CE-QIPNLCGPGMDCVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L    RG   +      G+ +S+  CC +   AWG+PC+ C                                  EL G C+ G                    E   IC+DI+EC     +C  G C N  G++ C+C   Y       +C+  +K           CE ++P      M C + ++                  +  +C  +PG+   +         A   D C+   P +C  G CI    +++CEC  G+  +     C+  +D C+  + +   N  C++    Y C+C +G+  S      DR +C  I ++    LC D Q        Y+C C  GF        C                        D+D C     R  C  G C N    Y C C PGF L               N   D+        +C  F   +C NGRC     S++C CN GY+ + DGK C D +EC   P  C  GTC N  GS++C C  G+ + +      C D NEC E  ++C  G C NT G FQC C  G++ S+  + C   +
Sbjct: 1548 ECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDI-----HTGKAVDIDECKEI-PGICANGVCINQIGSFRCECPTGFSYNDLLLVCED-IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQ------GSYQCICNNGFKASQDQTMCM-----------------------DVDEC----ERHPCGNGTCKNTVGSYNCLCYPGFELTHN------------NDCLDI-------DECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSE----NCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTR 2093          

HSP 7 Score: 130.954 bits (328), Expect = 1.872e-29
Identity = 147/537 (27.37%), Postives = 218/537 (40.60%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP---------------RSLCP-------------------------DGQC-IPQPNNGYECRC----LPGFAPMGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSF--LCNNG------------------------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RCE   C  GF +  +G C D NEC +   +C  G C++ +GS++C+C++ ++    Q  C+    +CE+ P  CG G    ++  YN  C C PG+  +              D C  +   VC  G+C  +  ++KC CN+GY  + DGK+C  T + C    G   P G C +L   + C C  GY    +     + CD  P               + +CP                         +G+C +P+  N  + +C    +PG    G G  C     D             G   S  D++    D++ C  S     C  G CIN    +RCEC  G+ LD  G  C +  E        + +     T  +  GSF   CN G                        RC+ +  SY+C C  GY    D K+C D+DEC+     C+     C N  G++ C C  G      P G  C D NEC     +C+NG C N  GS++C+CN G+ SS+   +C+
Sbjct: 1868 RCE---CAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMD-VDECERHP--CGNGTCKNTVGSYN--CLCYPGFELT------HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNE-CVALPGSCSP-GTCQNLEGSFRCICPPGYEVRSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPG---EGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTRE---DVNECLES--PGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECS------IGNPCGNGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMA--RRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECL 2372          

HSP 8 Score: 126.716 bits (317), Expect = 3.789e-28
Identity = 157/571 (27.50%), Postives = 232/571 (40.63%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR-------------DQCKGGA--------CINMKNHYRCECLPGFVLD-----------------KQGQACKERVEYKTN-QMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGG------PKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDT-------EPSKI---------CKKCSHYCKYSN-----GLFVCSCPNGLDAVLETGLCAKVSQ 2189
            E GF+ +   C DI+EC+ + + C+ G C+N  GSF+C C   ++  P + DCV    +C    NLC  G  CV++ I  + C C PGY  + D     +Q     D C           +C     +Y+C C++GY    DG+SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL P ++C  G+C       + C C  G++       C  +  D+ EIG  + N D  +S  ++   F    R             D+C  G         C+N    YRC C  GF  D                 + GQ       Y+   +M    +S S   Q     SF  +C  G C      + C C+ GY+    G  C+DIDEC+ +P  C  G C+N+PG Y+C+C   F ++    G        CY +       SL  N           C C+ G    N  + C  V  NS + Y          P+ I         C++    C+  N     G F C CP G     ET +C  + +
Sbjct: 1140 ESGFMMMKN-CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLCRNG-KCVNM-IGTYQCSCNPGYQATPD-----RQGCTDIDECMIMNGGC--DTQCTNSEGSYECSCSEGYALMPDGRSCAD-IDECEN-NPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNP-NICMFGEC-ENTKGSFICHCQLGYSVKKGTTGCTDV--DECEIG--AHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA-DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPV--NSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDE 1688          

HSP 9 Score: 122.479 bits (306), Expect = 8.385e-27
Identity = 134/530 (25.28%), Postives = 215/530 (40.57%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV-------EYKTNQMNDVASSFSLKTQC----DKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGL------NNVYFELFSATDREDFRSKVTTQFNDTVLDKCESSTEDKIKPGV 2387
            Q    C+   NLC  G    ++S Y   C+C  GY +  +G                     C  G C+    +Y C+C+ G+  +   ++C   +D C + NGV+C NG+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                        D+D C        C  G CIN +  +RC+C PG  +   G+ C +         E K             K++C      +G          ++ + +   C++G   ++DG+   DI+EC+++P IC  G C N  GSY+C+C  G+       G  C D +EC     LC NG+C+NT GS+ C C  GY+   + + C  V +      ++ P       +  C+ + G F C C  G   +  TGL    S       +I DN R   +IN           +     S  +R +  +     F       CE   E ++ PGV
Sbjct:  486 QTIDICKHHANLCLNGRCIPTVSSYR--CECNMGYKQDANGDCIDVDECTSNP---------CSNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQ-NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE-DGSFKCVCKPGFILAPNGRYCT-----------------------DVDECQTPGI---CMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGR---DINECALDPDICANGICENLRGSYRCNCNSGYEPD--ASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNE-----CESNPCV-----NGACRNNLGSFHCECSPG-SKLSSTGLICIDSLKGTCWLNIQDN-RCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGV 958          

HSP 10 Score: 117.857 bits (294), Expect = 2.268e-25
Identity = 132/513 (25.73%), Postives = 201/513 (39.18%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC---KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQCRRIMSDQS---EIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECS---------------------------------------INPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKY 2057
            C+DINEC  + +  + +C+N  GS+ C C   Y     Q  C    +  E + +    GM C +L I   +C C PG  +  DG+ C  ++      CR   P +C  G+C+    +Y+CECN+G+ +SS G  C   ++ + F      +        +L     C CD G    +  + C        + +CP G           EC+ +P     G   QC   M       ++G T+  + S ++  D+D C  S     C    C N K  Y+C C  G+VL + G+ CK+  E +T Q N      +    F+ K                +C    S     G C  +  S+ C+C  G+     G  C D+DEC                                         NP  C   +C N+ GSY+C+C  GF+         C+D NEC+ + + C  G C NT G + C C  GY    +   CVS    +  +Y
Sbjct: 2244 CEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNL-IGTFMCICPPGMARRPDGEGCVDENE-----CRTK-PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNG---QCVNTMGSFRCFCKVGYTT--DISGTACVDLDEC--SQSPKPCNF-ICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECSNPGACGSASCYNTLGSYKCACPSGFSFDQFSSA--CHDVNECSSSKNPCSYG-CSNTEGGYLCGCPPGYFRVGQGH-CVSGMGFNKGQY 2737          

HSP 11 Score: 108.612 bits (270), Expect = 1.406e-22
Identity = 119/438 (27.17%), Postives = 173/438 (39.50%), Query Frame = 3
Query:  717 ICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ------------RKKKCEQIPN---------LCGPGMDCVSLS---------IYNHLCKCLPGYVK-------SLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA--PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
             C D+NEC  +  IC  G+C N +GSF C C   Y        C                  C  +P            G G+ C+ L            N  C   PG  +       + DG +CS       D C      +C  G+C+     Y+CEC  G+  +SD +SC+  +D C+  N  +C  G C +L   + C CD GY        CT I +      C +G C+  P   YEC C P F   P G G    R+ +   + GP      S +++  +        R  C    C ++   +   CE  P     +    C     ++ N +  +        +C +    LC  G CI +  S+QC+C  GY  S + ++C DIDEC  +P +C  GTC N+ G+Y C C   +   N  GG  C D
Sbjct: 1315 TCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSD-----VDECA-ENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQD-IDECSFQN--ICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGR-YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGV-----GVSRSSC----CCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDID---ECQELPG-LCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVN--GGHNCMD 1727          

HSP 12 Score: 103.605 bits (257), Expect = 4.980e-21
Identity = 106/399 (26.57%), Postives = 162/399 (40.60%), Query Frame = 3
Query:  684 RCEKGF--IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            +C  GF        C DI+EC Q   +CK+G+C+N  GSF+C+C++ ++      +CV   +      N+C  GM C++    +  C C PG++ + +G+ C+       D C+   P +C  G CI +  +++C+C  G     DG+ C  T    T Y  +    G CV                             +P ++     C   P+ G+   C P   P     +   + S  S IG T    D      D D          C  G C N++  YRC C  G+  D  G+ C +  E   N++                   LC+NG C  +  SY C C  GY    + + C D++EC  NP  C  G C N+ GS+ C C  G  +
Sbjct:  552 KCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDEC--TTTNMCLNGM-CINED-GSFKCVCKPGFILAPNGRYCT-----DVDECQT--PGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEI--KKGVCVR---------------------------PFPGAVTKSECCCANPDYGFGEPCQP--CPAKNSAEFHGLCS--SGIGITVDGRDINECALDPDI---------CANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRL-------------------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESNP--CVNGACRNNLGSFHCECSPGSKL 876          

HSP 13 Score: 93.2041 bits (230), Expect = 7.515e-18
Identity = 132/532 (24.81%), Postives = 205/532 (38.53%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL--DGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIM-SDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-------RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC----IESGSSYQCQCNT--GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C +GF      C D++EC + + +C++G+C+N  G++RC C   +        C Q   +C    N+C  G            C  LPG    +  DG    +   N  D+     P  C  G C+     Y+C C   +  +  G  C         + F  R +G +  N +     +   C C  G       + C  +      +LCP G+   P P      +  EC+ LPG     +G  C     S Q E        +      DID CF   +   C  G C N   +Y C C P ++    G  C +       R    T   N++  + + +  C  +      N  C        + ++  C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++     C D +EC+   +LC +N  C N+ GS++C+C +G+           +  N       E  +I   CSH  C    G + C C NG  A  +  +C  V +
Sbjct: 1429 CSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSC-QDIDEC-SFQNICVFGT-----------CNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC---QGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFA--HPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLL--LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF----------KLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDE 1930          

HSP 14 Score: 77.7962 bits (190), Expect = 4.184e-13
Identity = 114/461 (24.73%), Postives = 174/461 (37.74%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQL-SKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC+C  GF    +G  C +   G CF  + + +C        L +K  CC      WG  C+ C L                    Q+ +IC  G                Y  D    D      +C+ +P+LC  G  CV+ ++ +  C C  GY   + G +C        D C    P  C+F  C     +Y+C C +GY+   DGK+CK   +  T+ +        CV+    + C+C  G+T  +      + C   P      G C   P + + C C  GF+    G  C                        D+D C  ++   +C+ G C N+   YRC C  G+V             Y+ NQ  D       + +C   G+  C +  C  +  SY+C C +G+        C D++ECS + + C  G C N+ G Y C C  G+
Sbjct: 2355 RCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPL----------------PGTAQYKKICPHGP--------------GYATDGRDID------ECKVMPSLCTNGQ-CVN-TMGSFRCFCKVGYTTDISGTACVD-----LDECS-QSPKPCNF-ICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC---QFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGS-FSCECQRGFSLDASGLNCE-----------------------DVDECDGNH---RCQHG-CQNILGGYRCGCPQGYVQ-----------HYQWNQCVD-------ENECSNPGA--CGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYG-CSNTEGGYLCGCPPGY 2718          
BLAST of Latent transforming growth factor beta binding protein 3 vs. UniProt/SwissProt
Match: sp|P35556|FBN2_HUMAN (Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3)

HSP 1 Score: 192.971 bits (489), Expect = 6.602e-49
Identity = 164/546 (30.04%), Postives = 239/546 (43.77%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGP-------------------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++    C  +  G  L  E CC     AWG PC+RCEL   C +G   I G+ C+D+NEC+ +  +C +G+C+N +GSF C C      D     C+  R ++C  +   + C   +  V        C C  G     + + C K    +Y+        +C  G   A         N+G + +  G+   K ++ C  + G+ C  GKC +    + C+C+SG+    + + CT I  C + P  LC  G C+  P + +EC C  G+ +     K C  I  D+ E  P                      +E S S +  +D    S   + C+ G C+NM   Y+C C PG+      Q C            D+     +   CD          +C  S  SY+C C+ GY    DG+ C+DIDEC  NP ICD G C N PG Y+C C+DGF    +M     C D NEC   +++C  G C+NT GSF C C  GY        C  V +
Sbjct:  875 CECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSE-CCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDEC---IHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYET-------LCPRGAGFA---------NRGDVLT--GRPFYKDINECKAFPGM-CTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISP-DLCGSGICVNTPGS-FECECFEGYESGFMMMKNCMDI--DECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-----------DIDECMIMNGGCDT---------QCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM---KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDE 1370          

HSP 2 Score: 181.03 bits (458), Expect = 3.934e-45
Identity = 172/622 (27.65%), Postives = 267/622 (42.93%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
             C+C  G T    G+ C +I   +C+L      C+ HP   +   + CC A   AWG  C+ C     + G  E + +C                   +DINEC+ +  +C  GKC N  GSF+C C+S +  D  + +C     +C   P+LCG G+ CV+ +  +  C+C  GY           ++    D C    P +C  G C+    +++C+C  G+  S   + C   ++ C+  + + C NGKCV++   Y C C+ GY ++ DR+ CT I +    +   D QC       YEC C  G+A M  G+ C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C +  E       D+ S+  +  +C+   GSF+C+                             +  C+    S++C C  G+    +G  C D+DECS     C     C+N+PGSY+C+C +GFT      G  C D +EC E  +LC+NG C N  G+++C+C  G+  ++  + C  + + S Q        IC      C    G+F C C +G +     G C  + +  D
Sbjct:  979 HCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECI-HPVPGKFRMDACCCAVGAAWGTECEECP----KPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTD-IDECRISPDLCGSGI-CVN-TPGSFECECFEGYESGFM----MMKNCMDIDECE-RNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCT-NSEGSYECSCSEGYALMPDGRSCADI--DECENNP-----------------------DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNEC------DLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIG--NGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGD----GFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQ-------NICV--FGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD 1538          

HSP 3 Score: 166.777 bits (421), Expect = 1.187e-40
Identity = 163/611 (26.68%), Postives = 260/611 (42.55%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE--RVEYKT--------NQMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC C PG      G+ C +  +   C+  + +GVC++   G     E CC      +G+PCQ C         G C  G  I +DG  +DINEC     IC +G C N RGS+RC C+S Y+ D    +C+    +C     LC  G+     +  ++ C C PGYV   + ++C   +  + + C          G C  +  ++ CEC+ G   SS G  C  ++                 NG    +  C +L   +      C+ D+       R K   C  +  C+++P  +CP+G+C+      + C C  G    G G+ C  I  +Q                     C+  +  D+C        +    C C  G     + + C +    EY+T            DV +        ++  +F  +C  G+C  +  S++C+CN+G+   ++ + C+DIDEC I+P +C  G C+N+PGS++C CF+G+    M     C D +EC     LC+ G C NT GSFQC C  G+  S  ++DCV + + S          +C+  +  C    G + CSC  G  A  +   C  + +
Sbjct:  681 RCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG--RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCID-IDECLVNRLLCDNGL--CRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVN--------GACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFP-GVCPNGRCV-NSKGSFHCECPEGLTLDGTGRVCLDIRMEQ---------------------CYLKWDEDECIHPVPGKFRMDACC-CAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMM-MKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLS------DNLCR--NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDE 1245          

HSP 4 Score: 145.976 bits (367), Expect = 4.075e-34
Identity = 172/625 (27.52%), Postives = 241/625 (38.56%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCE-------LGRCEKGFIEIDGIC---QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCT-------------------------------------------RYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT-------------SICDLYP--RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C PGF     G+ C +     CF +   G C   P     +K  CC +      WGDPC+ C           C  G   +  +    +D+NEC  S  IC +G+CIN  GSFRC C   Y  D     CV   +    I N CG G  C ++ I +  C C  G+     G   + +  N+        P +C F +C+    +Y+C C  GY    D K CK  +D C                                            R    +C NG+CV++   Y C+C+ G+ SS    +C              +IC +    R+L    +C      G+  +C     P+    Q ++I       GP  + +       DID C      + C  G CIN    +RC C  G+  D  G +C +  E                +Q  K  +++C N     +  SYQC C  GY    DGK C D+DEC      C Q  C+N+ G + C C  GFT H+      C D NEC    SLC   GIC+NT GSF C+C  G+       +C  V +               +C H C+   G + C CP G
Sbjct: 2080 QCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKC-SVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDEC--SIGNPCGNGT-CTNV-IGSFECNCNEGFEP---GPMMNCEDINECAQ----NPLLCAF-RCMNTFGSYECTCPIGYALREDQKMCKD-LDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCE--LCPLPGTAQYKKICPH----GPGYTTDGR-----DIDEC--KVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDEC---------------SQSPKPCNYICKN-----TEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC-QFLCVNTLGGFTCKCPPGFTQHHT----ACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNH----------RCQHGCQNILGGYRCGCPQG 2642          

HSP 5 Score: 137.117 bits (344), Expect = 2.083e-31
Identity = 128/452 (28.32%), Postives = 199/452 (44.03%), Query Frame = 3
Query:  723 QDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQ----------GQACKERVEYKTNQMNDVASSFSLKTQCDK------FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            Q I+ C+  + +C +G+CI    S+RC C+  Y+ D    DC+      E   N C  G DCV+ +  ++ CKC  G+ ++      +KQ+    D C   G  +C  G+C+    +++C CN G+  ++DGK+C    D CT  N  +C NG C++    + C C  G+  + + + CT + +     +C +G CI      + C C PG A    G+                              C  ++ R  C GG    +K        PG V   +          G+ C+      + + + + SS    T   +          +C NG C     SY+C CN+GY+    G+ C DIDEC +N  +CD G C N+PGSY C+C  G+          C D NEC   ++ C NG C+N  GSF C+C+ G   S+    C+
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQD-ANGDCIDVD---ECTSNPCTNG-DCVN-TPGSYYCKCHAGFQRTP-----TKQACIDIDECIQNG-VLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDH-DECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCI-NSEGSFRCDCPPGLAVGMDGR-----------------------------VCVDTHMRSTCYGG----IKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTET--ETCEDINEC--ESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICI 891          

HSP 6 Score: 136.732 bits (343), Expect = 3.430e-31
Identity = 155/609 (25.45%), Postives = 226/609 (37.11%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLS-RG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC----------------------------------EL-GRCEKG------------------FIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK----------CE-QIPNLCGPGMDCVSLSI------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             C C P F    TG  C +   G C+L    RG   +      G+ +S+  CC +   AWG+PC+ C                                  EL G C+ G                    E   IC+DI+EC     +C  G C N  G++ C+C   Y       +C+  +K           CE ++P      M C + ++                  +  +C  +PG+   +         A   D C+   P +C  G CI    +++CEC  G+  +     C+  +D C+  + +   N  C++    Y C+C +G+  S      DR +C  I ++    LC D Q        Y+C C  GF        C                        D+D C     R  C  G C N    Y C C PGF L               N   D+        +C  F   +C NGRC     S++C CN GY+ + DGK C D +EC   P  C  GTC N  GS++C C  G+ + +      C D NEC E  ++C  G C NT G FQC C  G++ S+  + C   +
Sbjct: 1555 ECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDI-----HTGKAVDIDECKEI-PGICANGVCINQIGSFRCECPTGFSYNDLLLVCED-IDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQ------GSYQCICHNGFKASQDQTMCM-----------------------DVDEC----ERHPCGNGTCKNTVGSYNCLCYPGFELTHN------------NDCLDI-------DECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE----NCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR 2100          

HSP 7 Score: 130.954 bits (328), Expect = 1.764e-29
Identity = 147/537 (27.37%), Postives = 216/537 (40.22%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP---------------RSLCP-------------------------DGQC-IPQPNNGYECRC----LPGFAPMGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCN--------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RCE   C  GF +  +G C D NEC +   +C  G C++ +GS++C+C + ++    Q  C+    +CE+ P  CG G    ++  YN  C C PG+  +              D C  +   VC  G+C  +  ++KC CN+GY  + DGK+C  T + C    G   P G C +L   + C C  GY    +     + CD  P               + LCP                         +G+C +P+  N  + +C    +PG    G G  C     D             G   S  D++    D++ C  S     C  G CIN    +RCEC  G+ LD  G  C +  E        + +     T  +  GSF CN                            RC+ +  SY+C C  GY    D K+C D+DEC+     C+     C N  G++ C C  G      P G  C D NEC     +C+NG C N  GS++C+CN G+ SS+   +C+
Sbjct: 1875 RCE---CAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMD-VDECERHP--CGNGTCKNTVGSYN--CLCYPGFELT------HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNE-CVALPGSCSP-GTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPG---EGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTRE---DVNECLES--PGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECS------IGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMA--RRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECL 2379          

HSP 8 Score: 122.865 bits (307), Expect = 6.218e-27
Identity = 156/571 (27.32%), Postives = 230/571 (40.28%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYR-------------DQCKGGA--------CINMKNHYRCECLPGFVLD----KQGQACKERVEYKTN--------------QMNDVASSFSLKTQCDKFGSF--LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGG------PKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDT-------EPSKI---------CKKCSHYCKYSN-----GLFVCSCPNGLDAVLETGLCAKVSQ 2189
            E GF+ +   C DI+EC+ + + C+ G C+N  GSF+C C   ++  P + DCV    +C    NLC  G  CV++ I  + C C PGY  + D     +Q     D C           +C     +Y+C C++GY    DG+SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL   ++C  G+C       + C C  G++       C  +  D+ EIG  + N D  +S  +I   F    R             D+C  G         C+N    YRC C  GF  D         C E +    N              +M    +S S   Q     SF  +C  G C      + C C+ GY+    G  C+DIDEC+ +P  C  G C+N+PG Y+C+C   F ++    G        CY +       SL  N           C C+ G    N  + C  V  NS + Y          P+ I         C++    C+  N     G F C CP G     +T +C  + +
Sbjct: 1147 ESGFMMMKN-CMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD-INECSLSDNLCRNG-KCVNM-IGTYQCSCNPGYQATPD-----RQGCTDIDECMIMNGGC--DTQCTNSEGSYECSCSEGYALMPDGRSCAD-IDECEN-NPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLN-SNICMFGEC-ENTKGSFICHCQLGYSVKKGTTGCTDV--DECEIG--AHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA-DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPV--NSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDE 1695          

HSP 9 Score: 120.168 bits (300), Expect = 4.182e-26
Identity = 106/414 (25.60%), Postives = 172/414 (41.55%), Query Frame = 3
Query:  849 QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC-----------------IESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            Q    C+   NLC  G    ++S Y   C+C  GY +  +G                     C  G C+    +Y C+C+ G+  +   ++C   +D C + NGV+C NG+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                        D+D C        C  G CIN +  +RC+C PG  +   G+ C +        M         K  C +          C                  ++ + +   C++G   ++DG+   DI+EC+++P IC  G C N  GSY+C+C  G+       G  C D +EC     LC NG+C+NT GS+ C C  GY+   + + C  + +
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYR--CECNMGYKQDANGDCIDVDECTSNP---------CTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQ-NGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINE-DGSFKCICKPGFVLAPNGRYCT-----------------------DVDEC---QTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVD------THMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGR---DINECALDPDICANGICENLRGSYRCNCNSGYEPD--ASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINE 855          

HSP 10 Score: 117.857 bits (294), Expect = 2.368e-25
Identity = 121/406 (29.80%), Postives = 176/406 (43.35%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSE--IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDG 1862
            RCE   C  G+ +  +G C D++EC  S  C +G C+N  GS+ C C + +Q  P +  C+    +C Q   LC  G  CV+    +  C C  G+  + DGK+C       +D C      +C  G CI +  ++KC C  G++ + +G+ C   VD C      +C NG C++    + C C  G     D + C    D + RS C      G C+ P P    +  C       G G+ C+   +  S    G  SS         DI+ C  +   D C  G C N++  YRC C  G+  D  G+ C +  E   N++                   LC+NG C  +  SY C C  GY    + + C DI+EC  NP  C  G C N+ GS+ C C  G
Sbjct:  518 RCE---CNMGYKQDANGDCIDVDECT-SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQNGVLCKNGR-CVNTD-GSFQCICNAGFELTTDGKNCV-----DHDECTTTN--MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTD-VDECQTPG--ICMNGHCINSEGSFRCDCPPGLAVGMDGRVCV---DTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINEC--ALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRL-------------------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNP--CVNGACRNNLGSFNCECSPG 880          

HSP 11 Score: 116.316 bits (290), Expect = 5.655e-25
Identity = 135/519 (26.01%), Postives = 205/519 (39.50%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC---KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY-ECRCLPGFAPMGKGKQCRRIMSDQS---EIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECS---------------------------------------INPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKY---DTE 2066
            C+DINEC  + +  + +C+N  GS+ C C   Y     Q  C    +  E + +    GM C +L I   +C C PG  +  DG+ C  ++      CR   P +C  G+C+    +Y+CECN+G+ +SS G  C   ++ + F      +        +L     C CD G    +  + C        + +CP G           EC+ +P     G   QC   M       ++G T+  + S +S  D+D C  S     C    C N +  Y+C C  G+VL + G+ CK+  E +T Q N      +    F+ K                +C    S     G C  +  S+ C+C  G+     G  C D+DEC                                         NP+ C   +C N+ GSY+C+C  GF+         C+D NEC+ + + C  G C NT G + C C  GY    +   CVS    +  +Y   DTE
Sbjct: 2251 CEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNL-IGTFMCICPPGMARRPDGEGCVDENE-----CRTK-PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNG---QCINTMGSFRCFCKVGYTT--DISGTSCIDLDEC--SQSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQF--SSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGYYRVGQGH-CVSGMGFNKGQYLSLDTE 2750          

HSP 12 Score: 113.235 bits (282), Expect = 6.059e-24
Identity = 121/472 (25.64%), Postives = 182/472 (38.56%), Query Frame = 3
Query: 1026 PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC----TSIC-----------DLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIG--PTSSNEDSKSSQGD---------------------------------------------IDFCFYSYYRDQCKGGA--CINMK-----NHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVR 2234
            P +C  G CI    +++C C  G+  S   + C+  +D C+   G+ C  G+C +    Y C C  GY +S D  +C    T +C           +L  R      QC  +P   +    +P   P+   ++ RR+  D   +G  P S+      + G+                                                   +   D CK  A  C+N +     + YRCEC  G+  D  G                           D+  S  C NG C+ +  SY C+C+ G+Q +   + C DIDEC  N  +C  G C+N+ GS+QC C  GF +     G  C D +ECT TT++C NG+C N  GSF+C C  G++ +   + C  V        + +   IC   + +C  S G F C CP GL   ++  +C            I   V VR
Sbjct:  284 PGICQGGNCINTVGSFECRCPAGHKQSETTQKCED-IDECSIIPGI-CETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGLVNGRCAQELPGRMT--KMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC----------------------IDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTT--DGKNCVDHDECT-TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD-------ECQTPGICM--NGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVR 717          

HSP 13 Score: 111.694 bits (278), Expect = 1.535e-23
Identity = 120/438 (27.40%), Postives = 173/438 (39.50%), Query Frame = 3
Query:  717 ICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ------------RKKKCEQIPN---------LCGPGMDCVSLS---------IYNHLCKCLPGYVK-------SLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA--PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
             C D+NEC   S IC  G+C N +GSF C C   Y        C                  C  IP            G G+ C+ L            N  C   PG  +       + DG +CS       ++       +C  G+C+     Y+CEC  G+  +SD +SC+  +D C+  N  +C  G C +L   + C CD GY        CT I +      C +G C+  P   YEC C P F   P G G    R+ +   + GP      S +++  +        R  C    C ++   +   CE  P     +    C     ++ N +  +        +C +    LC  G CI +  S+QC+C  GY  S D ++C DIDEC  +P +C  GTC N+ G+Y C C   +   N  GG  C D
Sbjct: 1322 TCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENI------NLCENGQCLNVPGAYRCECEMGFTPASDSRSCQD-IDECSFQN--ICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGR-YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGV-----GVSRSSC----CCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDID---ECQELPG-LCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVN--GGHNCMD 1734          

HSP 14 Score: 110.153 bits (274), Expect = 4.975e-23
Identity = 92/287 (32.06%), Postives = 128/287 (44.60%), Query Frame = 3
Query:  216 QTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ 989
            Q V    ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS+G I+S+C  +                       +                 N G      RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    IC+ G CIN  GSF C C + ++       C +   +C  IP +C  G    S ++ ++ C C  GYV S DG  C  Q
Sbjct:   80 QDVLRGPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNSCG-DGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKC-EDIDECSIIPGICETGE--CSNTVGSYFCVCPRGYVTSTDGSRCIDQ 361          

HSP 15 Score: 93.2041 bits (230), Expect = 8.395e-18
Identity = 132/533 (24.77%), Postives = 207/533 (38.84%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSL--DGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTS--SNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-------RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC----IESGSSYQCQCNT--GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C +GF      C D++EC  +  +C++G+C+N  G++RC C   +        C Q   +C    N+C  G            C  LPG    +  DG    +   N  D+     P  C  G C+     Y+C C   +  +  G  C         + F  R +G +  N +     +   C C  G       + C  +      +LCP G+   P P      +  EC+ LPG     +G  C           P     +ED++  + DID CF   +   C  G C N   +Y C C P ++    G  C +       R    T   N++  + + +  C  +      N  C        + ++  C    G+   +      DIDEC   P IC  G CIN  GS++C C  GF+ +++     C D +EC+   +LC +N  C N+ GS++C+C +G+           +  N       E  +I   CSH  C    G + C C NG  A  +  +C  V +
Sbjct: 1436 CSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSC-QDIDEC-SFQNICVFGT-----------CNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC---QGGNCINTFGSFQCECPQGYYLSEDTRICE-DIDECFA--HPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLL--LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGF----------KLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDE 1937          

HSP 16 Score: 77.0258 bits (188), Expect = 7.321e-13
Identity = 110/461 (23.86%), Postives = 169/461 (36.66%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQL-SKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC+C  GF    +G  C +   G CF  + + +C        L +K  CC      WG  C+ C L                    Q+ +IC  G                Y  D    D      +C+ +PNLC  G  C++ ++ +  C C  GY   + G SC        D C    P  C++  C     +Y+C C +GY+   DGK+CK   +  T+ +        CV+    + C+C  G+T  +      + C   P      G C   P + + C C  GF+    G  C                        D+D C  ++   +C+ G C N+   YRC C  G++   Q   C +  E                          C +  C  +  SY+C C +G+        C D++ECS + + C+ G C N+ G Y C C  G+
Sbjct: 2362 RCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPL----------------PGTAQYKKICPHGP--------------GYTTDGRDID------ECKVMPNLCTNGQ-CIN-TMGSFRCFCKVGYTTDISGTSCID-----LDECS-QSPKPCNY-ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNC---QFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGS-FSCECQRGFSLDATGLNCE-----------------------DVDECDGNH---RCQHG-CQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNA--------------------CGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYG-CSNTEGGYLCGCPPGY 2725          

HSP 17 Score: 68.1662 bits (165), Expect = 3.860e-10
Identity = 37/101 (36.63%), Postives = 52/101 (51.49%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            C  G+  ++    C D+DEC   P IC  G CIN+ GS++C C  G          KC D +EC+    +C+ G C NT GS+ C C  GY++S     C+
Sbjct:  261 CRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETT--QKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCI 359          

HSP 18 Score: 64.3142 bits (155), Expect = 5.060e-9
Identity = 82/294 (27.89%), Postives = 126/294 (42.86%), Query Frame = 3
Query: 1077 CECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV--EYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGI 1949
            C C+ G I+S+ G    K++  C+    V C NG   + ++D+ CQC  GY  +Y  +  C + C    R + P+            C C+ GF     G QC R        GP  +  +++  QG +     +  +  C   A I     + CE  P      Q Q C+       +T    DV    ++          +C  G CI +  S++C+C  G++ S   + C DIDECSI P IC+ G C N+ GSY C C  G+       G +C D     + T +C +G+
Sbjct:  130 CTCSSGQISSTCGS---KSIQQCS----VRCMNGG--TCADDH-CQCQKGYIGTYCGQPVCENGCQNGGRCIGPN-----------RCACVYGFT----GPQCER----DYRTGPCFTQVNNQMCQGQLTGIVCT--KTLCC--ATIGRAWGHPCEMCPA-----QPQPCRRGFIPNIRTGACQDVDECQAIPG--------ICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTST--DGSRCID-----QRTGMCFSGL 370          
BLAST of Latent transforming growth factor beta binding protein 3 vs. UniProt/SwissProt
Match: sp|Q75N90|FBN3_HUMAN (Fibrillin-3 OS=Homo sapiens OX=9606 GN=FBN3 PE=2 SV=3)

HSP 1 Score: 188.734 bits (478), Expect = 1.275e-47
Identity = 162/551 (29.40%), Postives = 237/551 (43.01%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-RCEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLS--IYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQ--CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN-------QMNDVASSF------SLKTQCDKFGSFLCNNGR---------CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     +G  C +   G C+L +    C  +  G  L  E CC     AWG PC+RCE+   C +GF  + G+ C D+NEC+ +  +C +G+C+N  GSFRC C      D     CV  R + C      + CG     V+L       +C C  G V  ++ ++C               P    F      G  +    ++ +++   G+   K V+ C  + G+ C +G C +    + C C  G+      + CT I  C + P  LC  G C+  P + +EC C PG+                       S      +  D+D C     RD   C+GG C N    Y+C+C PG  L  +G AC++  E   +       Q  +V  +F        ++  D+ G    N  R         CI +  SY+C C  GY    DG+ C+D+DEC  NP +CDQG C N PG ++C C+DGF     P    C D +EC     +C +G C+NT GSF C C  GY+       C  V +
Sbjct:  789 CKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSE-CCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECG-----VTLPGKYRMDVCCCSIGAVWGVECEACPD-------------PESLEFASLCPRGLGFA---SRDFLS---GRPFYKDVNECKVFPGL-CTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISP-DLCGQGTCVNTPGS-FECECFPGY----------------------ESGFMLMKNCMDVDEC----ARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMA--TPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDE 1283          

HSP 2 Score: 172.17 bits (435), Expect = 2.652e-42
Identity = 164/625 (26.24%), Postives = 252/625 (40.32%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE--------------LGRCEKGFIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCF-----DGFTIH-------------------NMPG-------------GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            RC+C  G     +G+ C ++    CFL      C     G +   ++CC +    WG  C+ C               LG   + F+      +D+NEC+ +  +C  G C N  GSF C C+  +  D  + +C     +C   P+LCG G  CV+ +  +  C+C PGY    +  K+C        D      P +C  G C     +YKC+C  G+  ++ G +C+  +D C+  +G+ CP+G+CV++   + C C +G+ S+ DR+ C  I +   ++   D  CI      Y C C  G++ M  G+ C  +  D+ E  P                         C  G C NM   +RC C  GF+     + C +  E   N                     +C +G C  +  S+ C C  GY        CSD+DEC +    CD   +C+N PGS+ C C      DGF  H                   N+PG             G  C DR+EC E   LC NG C N  G ++C+C  G+  +   + C  V + +          +C   S  C+   G+F C C  G +     G C  +++  D
Sbjct:  893 RCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPG-KYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTD-IDECRISPDLCGQGT-CVN-TPGSFECECFPGYESGFMLMKNCMDVDECARD------PLLCRGGTCTNTDGSYKCQCPPGHELTAKGTACED-IDECSLSDGL-CPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECRVQNGGCDVHCI-NTEGSYRCSCGQGYSLMPDGRACADV--DECEENPRV-----------------------CDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLN-------------------PHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQ-------GNLCAFGS--CENLPGMFRCICNGGYELDRGGGNCTDINECAD 1451          

HSP 3 Score: 148.288 bits (373), Expect = 6.987e-35
Identity = 164/608 (26.97%), Postives = 231/608 (37.99%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYR-LDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXX----------------------XXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADC-------------------------VQRKKKCEQ--------IPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG-KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            ++CG   +++ CC G+R       C +PIC   CG  G C +PN C C++G +A SC     S  + S  N   CR                         N G      RC C  GF G  C  +   G CF  +    C     GL  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G C+N  GSF C C   ++     A C                          +R+  C++        +P LC P        +       LPG+     G            M    GP      +    G + +   + G   S+ G  +  +T+D C  +   +C NG+C+   + Y C+C+ GYT    R +C  + D    S C  G C+  P   Y CRC PGF      + C                        D+D C  S     C  G C+N +  ++C C  GF L   G+ C +  E  T+ M                    C NG C+    S+ C C  G+  +  G  C DIDEC   P IC  G C N+ GS++C C  G  +
Sbjct:   58 NVCGSRFHAY-CCPGWRTFPGRSQCVVPICRRACGE-GFCSQPNLCTCADGTLAPSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLFPG----LLGFGSNGMGPPLGP-----ARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICRHFTN-LCLNGRCLPTPSSYRCECNVGYTQDV-RGECIDV-DECTSSPCHHGDCVNIPGT-YHCRCYPGFQATPTRQACV-----------------------DVDECIVS--GGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTM--------------------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQ-TPGICVNGHCTNTEGSFRCQCLGGLAV 604          

HSP 4 Score: 143.665 bits (361), Expect = 2.190e-33
Identity = 124/427 (29.04%), Postives = 194/427 (45.43%), Query Frame = 3
Query:  723 QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK--TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSG 1994
            Q I+ C+ ++ +C +G+C+    S+RC C+  Y  D V+ +C+    +C   P   G   DCV++    H C+C PG+  +      ++Q+    D C   G  +CH G+C+    +++C CN G+  S DGK+C   VD        +C NG C++    + C C  G+  +     C  I +     +C +G C       + C+CL G A    G+ C       +  G       ++   G +            K   C    +H       GF    Q    K+  E++    + +  +   +   +C      +C NG C     SY+C CN GY+A   GK C+D+DEC++N  +CD G C NSPGSY CSC  GF  H       C D +EC   +S C +G+C+N  GS+ C+C  G
Sbjct:  407 QTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQD-VRGECID-VDECTSSPCHHG---DCVNIPGTYH-CRCYPGFQATP-----TRQACVDVDECIVSG-GLCHLGRCVNTEGSFQCVCNAGFELSPDGKNC---VDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCT-NTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVT-----------KSECCCANPDH-------GFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINEC-ALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGF--HFWQDTEICKDVDEC--LSSPCVSGVCRNLAGSYTCKCGPG 794          

HSP 5 Score: 143.665 bits (361), Expect = 2.492e-33
Identity = 156/612 (25.49%), Postives = 253/612 (41.34%), Query Frame = 3
Query:  564 LSLSRGVCMKHPYG-------LQLSKELCCGAFQV--AWGDPCQRCEL----------GRCEKGFIE--IDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-----DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER------VEYKTNQMNDVASSFSLKTQC-------DKFGSF--LCNNGRCIESGSSYQCQCNTGYQASL---DGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFD 2210
            + + + VC +H  G         +++++CC ++ +  AW  PC+ C            G    GF+     G   DI+EC +   IC +G CIN+ GSFRC C + + ++ +   C +   +C    + C    DC+++   ++ CKC  GY  S  G    +    +        P VC  G C+    +Y C C++G+ AS+D   C   +D C R     C NG C ++   Y C C  G+  ++     D  +CT++       +C  G C+      + C C  GF     GK C       S  G T      ++ +G                  DID C  S   + C  G C N    ++C C PGFVL   G  C +         ++  + +   +  + KT+C       + +G    LC      E  +++Q  C  G+ A     D +   D++EC+ NP +C  G C+N+ GS++C C  G+++     G  C D +EC+     C  G C N  G F+C C  G+        C  + + S              C+  C  + G ++C+CP G     +  +C  V +  D Q D
Sbjct: 1646 MDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLAC-EDVDECGSRESPCQQNADCINIP-GSYRCKCTRGYKLSPGGACVGRNECREI-------PNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMD-IDECDRQ---PCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVG----QVCRFGHCL-NTAGSFHCLCQDGFELTADGKNCVDTNECLSLAG-TCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDEC--SEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQ----EGSAAFQELCPFGHGAVPGPDDSR--EDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFT--GINCVDTDECS-VGHPCGQGTCTNVIGGFECACADGF-EPGLMMTCEDIDECSLNPL---------LCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQD 2217          

HSP 6 Score: 129.798 bits (325), Expect = 4.340e-29
Identity = 146/592 (24.66%), Postives = 215/592 (36.32%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSL----SRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-----------------------------------GRCEKG------------------FIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKC----------EQIPNLCGPGMDCVSLSI---YNHLCKCLPGYVKSLDGKSCSKQSAN-----------KYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            +G  C +   G CFL        G+      G+ +++  CC +   AWG+PC+ C +                                   G C+ G                    E   IC+DI+EC   S IC  G C N  G++ C+C + Y       +C+  +K             ++       M C S +I   +N  C+  P  +       C  Q+               D C    P +C  G CI    +++CEC  G+  +S   +C+  VD C         N  C+++   Y C+C  GY  S       R +C  I      ++C  G C+      Y C C  GF        C                        DID C     R  C  G C N+   Y C C PGFV+   G      V++                +C      +C  G C+ +  S+ C C  G++ + DGK C D +EC      C  GTC N  GS++C C  GF + +      C D +EC+E  +LC  G C N+ GSFQC C  G++ S+    C   +
Sbjct: 1480 SGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEI-PAICANGICINQIGSFRCECPAGFNYNSILLACED-VDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPGGACVGRNECREI-----PNVCSHGDCM-DTEGSYMCLCHRGFQASADQTLCM-----------------------DIDEC----DRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDC----VDFD---------------ECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQS----DHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTR 2013          

HSP 7 Score: 127.487 bits (319), Expect = 2.268e-28
Identity = 171/668 (25.60%), Postives = 247/668 (36.98%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCELGRCEKGFIEIDGIC--------------QDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNG-KCVSLSNDYICQCDSGYTS-SYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQ--SEIGPTSSNEDSKSSQG--------------------------------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD------------NSNQKYD-------TEPSKICK-----KC--------SHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +C C PGF     G  C +     CF     G C   P     +K  CC + +    WGDPC+ C     ++G      +C              +D+NEC  +  +C +G C+N  GSFRC C   Y  D    +CV   +    + + CG G  C ++ I    C C  G+   L        +    D C    P +C F +C     +Y C C  GY    DG  C+  VD C          G +C +L   + C C  G        + CT  + C   P  LC +G+C+      + C C  GF P     +C  I      +E+  T     S SS+                                             D+D C    +   C  G CIN    +RC C  G+  D     C +  E                +Q  K  +FLC N +      S+ C C  GY    DG+ C D+DEC+     C Q  C+N+ G++ C C  GFT H+      C+D +EC+     C  +G C NT GSF+C+C+ G+   +    C  V +            N    Y        T+ S+  +     +C        S  C+ + G F C CP+G D     G C +V +
Sbjct: 1993 QCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSV-PKAFNTTKTRCCCSKRPGEGWGDPCELCP----QEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDEC--SVGHPCGQGT-CTNV-IGGFECACADGFEPGL------MMTCEDIDECSL-NPLLCAF-RCHNTEGSYLCTCPAGYTLREDGAMCRD-VDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQP-DLCVNGRCV-NTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHL--CAHGECINSLGSFRCHCQAGYTPDATATTCLDMDEC---------------SQVPKPCTFLCKNTK-----GSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNC-QFLCVNTVGAFTCRCPPGFTQHHQ----ACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDE 2613          

HSP 8 Score: 125.176 bits (313), Expect = 1.050e-27
Identity = 144/528 (27.27%), Postives = 206/528 (39.02%), Query Frame = 3
Query:  684 RCEKGF-IEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR----KKCT--------SICDLYPRS---LCPDG-------------------------QC-IPQPNNGYECRCLPGFAP-MGKGKQCRRIMSDQSEI---------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSF----------SLKTQCD-----KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPG-GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            +C +G+ +   G C   NEC +   +C  G C++  GS+ CLC   +Q    Q  C+    +C++ P  CG G     +  YN  C C PG+V + +G          +D C      VC FG C+    ++ C C  G+  ++DGK+C  T + C    G   P G C +L   + C C  G+    D      +C+          C   P S   LCP G                         +C +P+  N  + RC     P  G G  C     + S           G     +DS+    D++ C  +     C  G C+N    +RCEC  G+ LD  G  C +  E             +V   F           L   C+          LC   RC  +  SY C C  GY    DG +C D+DEC+     C      C N  G++ C C  G  +  +PG G  C D NEC     LC NG C NT GSF+C C+ G+  S    +C  ++
Sbjct: 1790 KCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMD-IDECDRQP--CGNGTCKNIIGSYN--CLCFPGFVVTHNGD------CVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNE-CLSLAGTCLP-GTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSRE---DVNEC--AENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAF-RCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNLIGTFACVCPPG--MRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIR 2296          

HSP 9 Score: 115.161 bits (287), Expect = 1.399e-24
Identity = 136/570 (23.86%), Postives = 224/570 (39.30%), Query Frame = 3
Query:  717 ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP----RSLCPDGQC-IPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK---------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYFELFSATDREDFRSKVTTQFNDTVLDK 2348
             C+DI+EC  + +  + +C N  GS+ C C + Y      A C    +  +   +    GM+C +L I    C C PG ++ L G   S +     + C    P +C  G+C+    +++C+C++G+  S     C   +     +  V+    + +S S++ + + +              +C L      R LCP G     +  +  ECR L      G+            + G T   + + ++  D+D C  S     C    C N K  + C C  G++L++ G+ CK+  E  + Q N      +   +F+ +                +C         +G C  +  S++C+C+ G+     G  C D++EC   P  C  G C N  G Y+CSC  GFT H+     +C D NEC  +   C +  C+NT G F+C C SG+        C  V + + ++           CS+ C  + G F+C CP G     + G C           D PD   +    +           S  DR    +    Q N   LD 
Sbjct: 2163 TCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARGMECKNL-IGTFACVCPPG-MRPLPG---SGEGCTDDNECHAQ-PDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHD-IRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECINSLGSFRCHCQAGYTP--DATATTCLDMDEC--SQVPKPCTF-LCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGCEDVNECD-GPHRCQHG-CQNQLGGYRCSCPQGFTQHSQ--WAQCVDENECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRR---------GPCSYSCANTPGGFLCGCPQGYFRAGQ-GHCVSGLGFSPGPQDTPDKEELLS--SEACYECKINGLSPRDRPRRSAHRDHQVNLATLDS 2704          

HSP 10 Score: 114.39 bits (285), Expect = 2.415e-24
Identity = 143/546 (26.19%), Postives = 216/546 (39.56%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI---MSDQSEIGPTSSNEDSKSS------QGDIDFCFYSYYRDQCK-------GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKT----------QCDKFGS-----------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG----TCINSPG----SYQCSCFDGFTIHNM----------------PGGPK---------CYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCP 2138
            C+DI+EC  S  +C  G+C+N  G+F+C C + +Q  P +  CV    +C      C   + C++    ++ C C  GY    DG++C+       D C    P VC  G C      ++C C  G++A+ D ++C   VD C   N  +C +G C +    ++C C  GY        C+ +  C++   +      C+  P + + CRCLPG+  +G G +C  +   +S +    P     +   S      QG     F+   RD+C         G C+N    YRCEC  GF   +  +AC++  E     +    S  +L            + D+ G              C NG CI +  SY C C   ++ +  G  C D    +      D+G    +C    G       C C  G    N                 PGG             D +EC E   LC+ G C NT+GSFQC+C  GY  S   + C  + + S        S IC   + Y    N  + C CP
Sbjct: 1111 CEDIDECSLSDGLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVD-INECRVQNGGCD--VHCINTE-GSYRCSCGQGYSLMPDGRACAD-----VDECE-ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVD-VDECD-LNPHICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGS-FSCRCLPGW--VGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTH------SGICGPGTCYNTLGN--YTCVCP 1633          

HSP 11 Score: 114.005 bits (284), Expect = 3.575e-24
Identity = 113/457 (24.73%), Postives = 185/457 (40.48%), Query Frame = 3
Query:  894 GMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDL---YPRSLCPDGQCIPQPNNGYECRCL---------PGFAP---------MGKGKQCRRIMSDQSE------IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            G+ C       H C+   G++ ++   +C        D C+   P +C  G C+    ++ C C  G+  S    +C+        Y    C        S  +  +C       Y R++C   CD    +     P+  C P+ +N ++  C          PG  P         MG      R+    S+      +GP +SN  + +    ID C   ++ + C  G C+   + YRCEC  G+  D +G+                          D+  S  C++G C+    +Y C+C  G+QA+   + C D+DEC ++  +C  G C+N+ GS+QC C  GF +   P G  C D NEC  T+++C NG+C N  GSF C C  G++ +     C+ +        + +   IC   + +C  + G F C C  GL    +  +C   
Sbjct:  219 GLPCELCPAQPHPCR--RGFIPNIHTGAC-----QDVDECQAV-PGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACED-------YRAGAC-------FSVLFGGRCAGDLAGHYTRRQC--CCDRGRCWAAGPVPE-LCPPRGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDIC--RHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGEC----------------------IDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELS--PDGKNCVDHNECA-TSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDID-------ECQTPGICV--NGHCTNTEGSFRCQCLGGLAVGTDGRVCVDT 614          

HSP 12 Score: 114.005 bits (284), Expect = 3.637e-24
Identity = 122/425 (28.71%), Postives = 176/425 (41.41%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCI-PQPNNGYECRCLPGFAPMGKGKQCRRIMS-DQSEIGPTSSNEDSKSSQG-DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECT 1919
            RCE   C  G+ + + G C D++EC  S  C  G C+N  G++ C C   +Q  P +  CV    +C     LC  G  CV+    +  C C  G+  S DGK+C   +             +C  G C+ +  ++ C C  G++ +  G  C   +D C      +C NG C +    + CQC  G     D + C    D + RS C      G C  P P    +  C       G G+ C+   + D +E     S+    ++ G DI+ C  +   + C  G C N++  YRC C  G+     G+ C +  E   N                   S LC+NG C  S  SY C C  G+    D ++C D+DEC  +P  C  G C N  GSY C C  G  +   P G  C D  + T
Sbjct:  432 RCE---CNVGYTQDVRGECIDVDECT-SSPCHHGDCVNIPGTYHCRCYPGFQATPTRQACVD-VDECIVSGGLCHLGR-CVNTE-GSFQCVCNAGFELSPDGKNCVDHNECATST-------MCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMD-IDECQTPG--ICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCV---DTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINEC--ALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALN-------------------SLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSP--CVSGVCRNLAGSYTCKCGPGSRLD--PSGTFCLDSTKGT 811          

HSP 13 Score: 111.309 bits (277), Expect = 2.036e-23
Identity = 110/428 (25.70%), Postives = 169/428 (39.49%), Query Frame = 3
Query: 1005 DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINS-PGS-----------------------------YQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
            D+CR +   +C  G+C+    +Y+CECN GY     G+     VD CT      C +G CV++   Y C+C  G+ ++  R+ C  + + +    LC  G+C+      ++C C  GF     GK C               NE + S+               C  G C+N    + C C PGF+L   G  C +  E +T                      +C NG C  +  S++CQC  G     DG++C D    S      ++G+C    PG+                             +Q  C  G  I          D NEC     +C NG+C+N  GS++C CN GY +    +DC  V + +        S +C   + +C+ S G + CSCP G     +T +C  V + +
Sbjct:  410 DICRHF-TNLCLNGRCLPTPSSYRCECNVGYTQDVRGEC--IDVDECTSS---PCHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCV-NTEGSFQCVCNAGFELSPDGKNC------------VDHNECATSTM--------------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQT--------------------PGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITT-----DGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALN------SLLCD--NGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECL 771          

HSP 14 Score: 109.383 bits (272), Expect = 9.767e-23
Identity = 127/496 (25.60%), Postives = 185/496 (37.30%), Query Frame = 3
Query:  720 CQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDID-FCFYSYYRDQ----------------CKGGACINMKNHYRCECLPGFVLDKQGQACKE--------------------------------------RVEYKTNQMNDVASSFSLKTQCDKFGSF--------------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC---KNGICKN 1958
            C D++EC+ + ++C  G C N  G  RCLC   +   P    CV    +C+  P++C  G DC + +  + +C C  GY+       CS       D C   G        C+    ++ C C  G++   DG  C   +D C        P G C+++   Y C C  G+        DR +C    DL     C +GQC+  P  GY C C  GF P    + C+ +  D+   G   +    ++  G     C   Y  D+                C  G CIN    Y C C   F L+  G  C +                                      R      ++  +A++   +T C     F                    LC  G C+ +  S+QC+C  GY  S   ++C DIDECS +  IC  GTC N+ G+Y C C   +   N  GG  C D  +     S+C    NG C+N
Sbjct: 1194 CADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVD-VDECDLNPHICLHG-DCEN-TKGSFVCHCQLGYMVRKGATGCSD-----VDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVG--DGFECHD-LDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDL-----CDNGQCLNAPG-GYRCECEMGFDPTEDHRACQDV--DECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVN--GGNNCMDMRK-----SVCFRHYNGTCQN 1663          

HSP 15 Score: 103.605 bits (257), Expect = 4.866e-21
Identity = 113/426 (26.53%), Postives = 165/426 (38.73%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ--------SANKYDMCRFYGPYVCHFGKCIA----------------DGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSL-CPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C  GF +  DG  C D NEC  S +C +G C+NE GSF CLC   +   P    C+   +   Q P +C  G    + +  +  C+CL G     DG+ C           +  K    R +   V     C A                D   ++  C+ G   ++DG+   +        +  VC NG C +L   Y C C+ GY +    K CT + +    SL C +G C   P + Y C C PGF      + C+                       D+D C  S     C  G C N+   Y C+C PG  LD  G  C +  +  T  +    S   +  Q     S  C            +C+    C  G+ A + G  C D++EC   P +C  G C+N+ GS++C C +G  +
Sbjct:  516 CNAGFELSPDGKNCVDHNECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDEC--QTPGICVNGH--CTNTEGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKDSAEFQALCSSGLGITTDGRDINECA-----LDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGS-YSCSCPPGFHFWQDTEICK-----------------------DVDECLSS----PCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTK-GTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGF-ARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLML 902          
BLAST of Latent transforming growth factor beta binding protein 3 vs. UniProt/SwissProt
Match: sp|Q61554|FBN1_MOUSE (Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 1.813e-46
Identity = 172/587 (29.30%), Postives = 244/587 (41.57%), Query Frame = 3
Query:  501 CQCKP----GFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCE--------QIPNLCGPGMDCVSLSI-------------------YNHLCKCLPGYVKS--LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            C+C P      T   C E + G C+ ++  G C  +  G  L  E CC +   AWG PC  C+L   C KGF  I G  C+DINEC+ +  +CK+G C+N RGSF+C C +    D     C+  R + C          +P      MD    S+                   Y  LC   PG+      +GK   K      + C+   P +C  GKC     ++KC C+ G+   S+ ++C   +D C R +  +C  G+CV+   D+ C+CD GY S +   K C  I +     L   G         Y C C PG                  ++ P      + S+  DI+ C  S   + C  G C+N+   Y+C C PG+        C            D+     +   C+ F         C  S  SY+C C  G+    D + C+DIDEC  NP+ICD G C N PG Y+C C+DGF          C D NEC    ++C +G C+NT GSF C C+ GY     K  C  + +     ++     +C         + G F CSC  G 
Sbjct:  832 CECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSE-CCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKD----INECKMI-PSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDEC-RISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGH-----------------QLSP------NISACIDINECELS--ANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCV-----------DIDECSIMNGGCETF---------CTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASE--DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTN-------TAGSFKCSCSPGW 1356          

HSP 2 Score: 169.474 bits (428), Expect = 1.917e-41
Identity = 181/632 (28.64%), Postives = 262/632 (41.46%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRCEL--------------GRCEKGFIEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQC---IPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLC--------------------------NNGR---CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDN 2222
            +C+C  G T    G+ C +I    CFL      C   P   +   + CC +   AWG + C+ C L              G   K         +DINEC+    +C  GKC N  GSF+C C S +  D  + +C     +C   P+LCG G  CV+ +  +  CKC  GY    +  K+C      + D      P +C  G C     +Y+CEC  G+  S +  +C    +     +  +CP+G+CV+L   Y C C+ GY  ++DR  C  I  C +       +G C       +  YEC C PGFA M   + C  I  D+ E  P                       + C GG C N+   YRC C  GF+  +  + C +  E       D+  +  L   C+   GSF+C                          N GR   C  +  S++C C+ G+    DG  C+D+DECS    +C Q   C N+ GSY+C C DG+T      G  C D +EC+E  +LC NG C N  G ++C+C+ G++ S   + C  + + S          IC      C    GLF C C  G +     G C  V++ +D    I  N
Sbjct:  936 KCECPNGMTLDATGRICLDIRLETCFLKYDDEECTL-PIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDECRISPDLCGRGQ-CVN-TPGDFECKCDEGYESGFMMMKNCMDIDECQRD------PLLCRGGICHNTEGSYRCECPPGHQLSPNISACIDINE--CELSANLCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIM------NGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDI--DECEDNP-----------------------NICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNEC------DLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGD----GFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECS-------LPNICV--FGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGN 1503          

HSP 3 Score: 155.221 bits (391), Expect = 5.225e-37
Identity = 167/583 (28.64%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSL-SRG----VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE---------LGRCEKGFI--EIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQS-----ANKY--------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG-----------------KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCP-DGQCIPQPNNGYECRCLPGFAPMGKGK-----QCRRIMSDQSE------IGP--------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C C P F    T   C +  +G C+L +  RG        +  G+ +SK  CC +   AWG PC+ C          L    +GF    I  I +DI+ECQ    +C+ GKCIN  GSF+C C + Y  +     C     +CE  P +CGPG      ++ N+ C C P Y++   G +C          N Y        ++       +C     I   +N  CE  Q  I S+D                        +D C    G VC NG C+++   + C+C  G+  +     C  I +     +C  + +CI      Y C C PG+     G+     +C+ I +  S       +G           +N D      DI+ C     RD C  G C N    + C C  GF+L               N   DV        +C      LC NG+C+ +  S+QC+CN GY+ + DG+ C DI+EC ++P  C  GTC N  GSY+C C  G+++ N     KC D +EC E   +C  G C NT GSF+C C  G+  S+  + C  ++
Sbjct: 1513 CDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVC-DDVNECE-TPGICGPGT--CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPG-VCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECI-NTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCL-DINEC----ERDACGNGTCRNTIGSFNCRCNHGFILSHN------------NDCIDV-------DECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQN----DKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLR 2059          

HSP 4 Score: 152.91 bits (385), Expect = 2.738e-36
Identity = 189/702 (26.92%), Postives = 272/702 (38.75%), Query Frame = 3
Query:  270 CCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----EEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQ-VAWGDPCQRCELGRCEKGFIEI-----------DGICQDINECQWSQICKSGKCINERGSFRCLCSSSY-------------------------------------QFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ---SANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY-----PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            C  GY +  +G   + I  N C  +     P TCQ  +G     C      + D+  +      E E         T  + +C C  GF    TG+ C ++    C+     G C   P     SK+ CC A +   WGDPC+ C     ++ F +I           D    D++EC+   +C+ G+CIN  GS+RC C   Y                                      F+P      +   +C Q P LC     CV+ +  ++ CKC  GYV   D + C  +   +  K+D             +C      Y C C  GY    DG+ C    +  T+    +C NG+C++    Y C+C+ G+T+S  + +C    + Y      +++C  G     P    EC C  G    G G  C        EI P       K          ++  DID C      D C+ G C+N +  Y C C  G+  D  G AC +      N+ N          Q  K  +F+C N     +  SYQC C  GY    DG+ C D+DEC+     C Q  C+N+ G + C C  GFT H+      C D NECT   +LC   G+C+NT GSF C+C  G+        C  V +               +C H C+   G + CSCP G
Sbjct: 1960 CNEGYEVAPDGRTCVDI--NECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEP-DEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLC--AFRCVN-TYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTE-------KQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPG--ICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGG---RGWGPHC--------EICPFEGTVAYKKLCPHGRGFMTNGADIDEC--KVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVD-----LNECN----------QAPKPCNFICKN-----TEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGN----------HRCQHGCQNIIGGYRCSCPQG 2597          

HSP 5 Score: 150.984 bits (380), Expect = 1.039e-35
Identity = 148/471 (31.42%), Postives = 208/471 (44.16%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGP-----------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGA--------CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            E GF+ +   C DI+ECQ   + C+ G C N  GS+RC C   +Q  P  + C+    +CE   NLC P   CV+L I  + C C PGY  + D   C        D C         F  C     +Y+C C  G+    D +SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL P ++C  G C       + C C  G++       C  I  ++ EIG            T+ +     S G I         D+C  G         C N    YRC C  G+  D  G  C +  E   N +N                  LC NG+C+ +   Y+C+C+ G+  S DGK C DIDECS+ P+IC  GTC N PG ++C C  G+ +     G  C D NEC + T+ C +G C NT GS+ C C   +  +  +  CV  +
Sbjct: 1104 ESGFMMMKN-CMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACID-INECELSANLC-PHGRCVNL-IGKYQCACNPGYHPTHDRLFCVD-----IDECSIMNGGCETF--CTNSDGSYECSCQPGFALMPDQRSCTD-IDECED-NPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP-NICLSGTC-ENTKGSFICHCDMGYSGKKGKTGCTDI--NECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGD--GFTCTDLDECSEN-LN------------------LCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSL-PNICVFGTCHNLPGLFRCECEIGYELDR--SGGNCTDVNECLDPTT-CISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTR 1532          

HSP 6 Score: 146.747 bits (369), Expect = 2.199e-34
Identity = 122/431 (28.31%), Postives = 200/431 (46.40%), Query Frame = 3
Query:  753 ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER--VEYKT--NQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
            +C++G+CI   GS+RC C+  +Q D ++ +C+    +CE+ P     G +C++ +  ++ C C  GY  +L     ++      D C   G  +C+ G+CI    ++ C CN G+  + DGK+C+  +D C+  N  +C NG C++    + C C  G+  + D + C  I +     +C +G+C+   +  Y C C PG A    G+ C       +                    C+  Y R QC       +     C     +   +  Q C  +   EY+   +    + S+ +   +C      +C NG C     +Y+C CN+GY+  + GK C DI+EC +N  +CD G C N+PGS+ C+C  GF     P    C D +EC   +S C NG+CKN+ GSF C+C+        K  C+  
Sbjct:  461 LCQNGRCIPTPGSYRCECNKGFQLD-IRGECID-VDECEKNPCT---GGECIN-NQGSYTCHCRAGYQSTL-----TRTECRDIDECLQNG-RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCED-MDECSIRN--MCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCV-NTDGSYRCECFPGLAVGLDGRVCVDTHMRST--------------------CYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINEC-ALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYK--PDLKTCEDIDEC--ESSPCINGVCKNSPGSFICECSPESTLDPTKTICIET 850          

HSP 7 Score: 144.436 bits (363), Expect = 1.247e-33
Identity = 176/667 (26.39%), Postives = 257/667 (38.53%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQ-VAWGDPCQRCELGRCEKGFIEI-----------DGICQDINECQWSQICKSGKCINERGSFRCLCSSSY-------------------------------------QFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ---SANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY-----PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSK----------SSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD---NSNQKYDTEPSKICKKCS-------HY---------------------CKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            +C C  GF    TG+ C ++    C+     G C   P     SK+ CC A +   WGDPC+ C     ++ F +I           D    D++EC+   +C+ G+CIN  GS+RC C   Y                                      F+P      +   +C Q P LC     CV+ +  ++ CKC  GYV   D + C  +   +  K+D             +C      Y C C  GY    DG+ C    +  T+    +C NG+C++    Y C+C+ G+T+S  + +C    + Y      +++C  G     P    EC C  G    G G  C        EI P       K          ++  DID C      D C+ G C+N +  Y C C  G+  D  G AC +      N+ N          Q  K  +F+C N     +  SYQC C  GY    DG+ C D+DEC+     C Q  C+N+ G + C C  GFT H+      C D NECT   +LC   G+C+NT GSF C+C  G+        C  V +   N   ++  +      +CS       HY                     C  + G + C CP G      +G C  +++
Sbjct: 2039 KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEP-DEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCA--FRCVN-TYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTE-------KQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPG--ICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGG---RGWGPHC--------EICPFEGTVAYKKLCPHGRGFMTNGADIDEC--KVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVD-----LNECN----------QAPKPCNFICKN-----TEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNC-QFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDINE 2653          

HSP 8 Score: 132.494 bits (332), Expect = 7.331e-30
Identity = 157/559 (28.09%), Postives = 229/559 (40.97%), Query Frame = 3
Query:  498 RCQCKPGF----TGK-----SCSEIVN----GECFLSLSRGVCMKHP-YGLQLSKELCCGAFQV---AWGDPCQRCELG----RCEKGFI-EIDGICQDINECQWSQ--ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT-VDFC-TRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQ----------CDKFGS-----FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC--DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RC CKPG+    TG+      C EI N    G+C  ++    C+ H  +   + + +C    +    A G+   R  +G    RC  GFI   +  C D++EC      +C++G+C+N  GSF+C C+  Y+  P    CV    +C   P  C PG  C +L   ++ C C PGY  SL    C        D C    P +C  G C     ++KC C +G+  SS G+ C+   + +C  ++ G  C + K  + S    C    G       + C +  D   R +CP G  I                                 +GP         S  D+D C      D C+ G CIN    YRCEC  G++L  +G  C +  E             +V   F    +          C+          LC   RC+ +  SY+C+C  GY    D ++C D DEC+     C   Q  C N  G+Y C C  G+     P G  C D NEC     +C+NG C NT GS+ C+CN G+ +S  + +C+
Sbjct: 1834 RCDCKPGYRLTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVD-INECVLDPGKCAPGT-CQNLD-GSYRCICPPGY--SLQNDKCE-----DIDEC-VEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGII--------------------------------VGP-------DDSAVDMDEC---KEPDVCRHGQCINTDGSYRCECPFGYIL--EGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGY--QRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECL 2334          

HSP 9 Score: 118.242 bits (295), Expect = 1.650e-25
Identity = 135/549 (24.59%), Postives = 225/549 (40.98%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLS---RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQ-----------------------RCELGRCEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC CK G+TG   +     EC  +L+    G C+  P G +   ++  G    A G  C+                       RCE   CE G+ E+D   G C D+NEC     C SG C+N  GS+ C C   ++ +P +  CV  R   C       G   D      + + +    C C  G       + C   + ++Y +       +C  G    +G+      N   +   D       +D C    G+ C  GKC++    + C+C +GY  + D + C  + +     +C  G C     N Y C C P +  +  G  C   M  +  +   +   D+++  G++    ++  +  C     I    +  CE  P    D+    C  +   +   + D+ +   +     +    +C NG CI    S++C+C  G+  +    +C DIDEC   P       CIN+ GSY+C C  G+ + +     +C DRNEC E  ++C +G C +T GSF C C++G+ ++  +  C+ + +
Sbjct: 1390 RCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDM--GFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCE---CEIGY-ELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKI-------LCPGG----EGFRP----NPITVILED-------IDECQELPGL-CQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGN-YTCICPPDYMQVNGGNNC---MDMRRSLCYRNYYADNQTCDGEL---LFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQ---RPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTG---QCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINE 1896          

HSP 10 Score: 117.087 bits (292), Expect = 3.649e-25
Identity = 114/424 (26.89%), Postives = 170/424 (40.09%), Query Frame = 3
Query:  996 NKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCIN----SPGSYQCSCFDGFTIHNMPGGP---------------------KCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            N  D C+    Y+C  G+CI    +Y+CECN+G+     G+     VD C +     C  G+C++    Y C C +GY S+  R +C  I + L    +C +G+CI   +  + C C  GF     GK C                        D+D C     R+ C  G CIN    ++C C PGF L   G+ CK+  E +T                      +C NGRC+ +  SY+C+C  G    LDG++C D    S       +G C+     +    +C C         P  P                        D NEC     +C NGIC+N  G+++C CNSGY      ++CV + +          S +C   +  C+ + G FVC+CP G     +   C  + +
Sbjct:  450 NVTDYCQLV-RYLCQNGRCIPTPGSYRCECNKGFQLDIRGEC--IDVDECEKN---PCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICNNGRCI-NTDGSFHCVCNAGFHVTRDGKNCE-----------------------DMDEC---SIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECET--------------------PGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLN------SLLCD--NGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDE 812          

HSP 11 Score: 114.39 bits (285), Expect = 2.642e-24
Identity = 89/277 (32.13%), Postives = 128/277 (46.21%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC 980
            ++CG   N++ CC G++    G+ C +PIC + CG +G C RPN C C +G I+ SC                          +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GSF C C + ++F+ V   C +   +C  IP +C  G +C + ++ ++ CKC PG+  S DG  C
Sbjct:   57 NVCGSRYNAY-CCPGWKTLPGGNQCIVPICRHSCG-DGFCSRPNMCTCPSGQISPSCGSRSIQHCSIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEVSQKC-EDIDECSTIPGVCD-GGECTN-TVSSYFCKCPPGFYTSPDGTRC 328          

HSP 12 Score: 104.76 bits (260), Expect = 2.291e-21
Identity = 120/427 (28.10%), Postives = 172/427 (40.28%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIAD--GYNYKCECNQGYIASSDGKSCK--------KTVDFCTRYNGV---------------VCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C  GF +  DG  C+D++EC    +C +G CINE GSF+C+C   +Q       C +   +CE  P +C  G  CV+    ++ C+C PG    LDG+ C     + +     YG Y    G+C+    G   K EC       + G+ C+        +    C+   G+               +CPNG C +L   Y C C+SGY      K C  I +    S LC +GQC   P + + C C  GF      K C                        DID C  S     C  G C N    + CEC P   LD     C E ++  T     +     +        S  C++           CQ    C  G+ + + G  C DI+EC + P +C  G C+NS GS++C C +G T+
Sbjct:  559 CNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYC-KDINECE-TPGICMNGR-CVNTD-GSYRCECFPGLAVGLDGRVC----VDTHMRSTCYGGY--RRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNGQCRNTPGS-FVCTCPKGFVYKPDLKTCE-----------------------DIDECESS----PCINGVCKNSPGSFICECSPESTLDPTKTICIETIK-GTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICGKGF-SRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTL 945          

HSP 13 Score: 101.293 bits (251), Expect = 2.819e-20
Identity = 120/448 (26.79%), Postives = 171/448 (38.17%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLCGPGMD-----------CVSLSIYNHLCKCLP-----GYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCP-NGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYI 2000
            C D NECQ    IC++G+C+N  GS+ C C+  +   P Q +C+  ++     E + N+C  G             C     +   C+  P      Y K          +    D C+     VC  G+C+ D  +Y C C  GY     G +C   VD     N    P N  C +    Y C C  GY    D + C  + +   +       C+     G+ C+C PGF               Q       +NE +     DI+ C           G C N    + CEC  GF LD+ G +C++  E +                    G+  C +G C      Y+C C  GY        C D +EC ++  +C   +C N+ GSY+C C  GF      GG  C D NEC  + + C  G C NT G + C C  GY 
Sbjct: 2291 CIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHD-VCRNGECVNDRGSYHCICKTGYTPDITGTAC---VDL-NECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCV-NTIGGFTCKCPPGFT--------------QHHTACIDNNECTS----DINLCGSK--------GVCQNTPGSFTCECQRGFSLDQSGASCEDVDECE--------------------GNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVDENEC-LSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGG--CQDINECGSSQAPCSYG-CSNTEGGYLCGCPPGYF 2681          

HSP 14 Score: 67.3958 bits (163), Expect = 6.684e-10
Identity = 36/104 (34.62%), Postives = 54/104 (51.92%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C  G+  ++    C D+DEC   P +C  G CIN+ GS++C C  G   + +    KC D +EC+    +C  G C NT  S+ C+C  G+ +S     CV V+
Sbjct:  231 CRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEV--SQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGFYTSPDGTRCVDVR 332          

HSP 15 Score: 61.6178 bits (148), Expect = 3.819e-8
Identity = 41/111 (36.94%), Postives = 57/111 (51.35%), Query Frame = 3
Query: 1674 LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKN----TYGSFQCQCNSG 1994
            +C  G CI +  S++C+C  G++ +   + C DIDECS  P +CD G C N+  SY C C  GF  +  P G +C D       T+L  NG C N    +    QC C+ G
Sbjct:  256 MCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGVCDGGECTNTVSSYFCKCPPGF--YTSPDGTRCVDVRPGYCYTAL-ANGRCSNQLPQSITKMQCCCDLG 363          
BLAST of Latent transforming growth factor beta binding protein 3 vs. UniProt/SwissProt
Match: sp|P98133|FBN1_BOVIN (Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 3.612e-46
Identity = 168/576 (29.17%), Postives = 243/576 (42.19%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCE--------QIPNLCGPGMDCVSLSI-------------------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            T   C E + G C+ ++  G C  +  G  L K  CC +   AWG PC  C++   C KG+  I G  C+DI+EC+ +  +CK+G C+N +GSF+C C S    D     C+  R + C          +P      MD    S+                   Y  LC   PG+          K+     + C+   P +C  GKC     ++KC C+ G+   S+ ++C   +D C R +  +C  G+CV+   D+ C+CD GY S +   K C  I  C   P  LC  G C+      Y C C PG                  ++ P      + S+  DI+ C  S +   C  G C+N+   Y+C C PG+        C            D+     +   C+ F         C  S  SY+C C  G+    D + C+DIDEC  NP+ICD G C N PG Y+C C+DGF          C D NEC    ++C +G C+NT GSF C C+ GY     K  C  + +     ++ +   +C         + G F CSC  G 
Sbjct:  841 TKTICIETIKGTCWQTVIDGRCEININGATL-KSQCCSSLGAAWGSPCTPCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPVAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEITNG--KRFFKDINECKMI-PNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDEC-RISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPL-LCRGGVCL-NTEGSYRCECPPGH-----------------QLAP------NISACIDINECELSAHL--CPHGRCVNLIGKYQCACNPGYHSTPDRLFCV-----------DIDECSIMNGGCETF---------CTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASE--DMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCDRHAVCTN-------TAGSFKCSCSPGW 1354          

HSP 2 Score: 168.318 bits (425), Expect = 3.826e-41
Identity = 174/624 (27.88%), Postives = 260/624 (41.67%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRCEL--------------GRCEKGFIEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYP---RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            +CQC  G T    G+ C +I    CFL      C   P   +   + CC +   AWG + C+ C +              G   K         +DINEC+    +C  GKC N  GSF+C C S +  D  + +C     +C   P+LCG G  CV+ +  +  CKC  GY    +  K+C      + D      P +C  G C+    +Y+CEC  G+  + +  +C    +     +  +CP+G+CV+L   Y C C+ GY S+ DR  C  I  C +      + C + +        YEC C PGFA M   + C  I  D+ E  P                       + C GG C N+   YRC C  GF+  +  + C +  E       D+  +  L   C+   GSF+C+                             +  C  +  S++C C+ G+    DG  C+D+DECS    +C Q   C N+ GSY+C C +G+T      G  C D +EC+E  +LC NG C N  G ++C+C+ G++ S   + C  + + S          IC      C    GLF C C  G +     G C  V++ +D
Sbjct:  934 KCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTL-PVAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEITNGKRFFKDINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTD-IDECRISPDLCGRGQ-CVN-TPGDFECKCDEGYESGFMMMKNCMDIDECQRD------PLLCRGGVCLNTEGSYRCECPPGHQLAPNISACIDINE--CELSAHLCPHGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSE------GSYECSCQPGFALMPDQRSCTDI--DECEDNP-----------------------NICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNEC------DLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGD----GFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECS-------LPNICV--FGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLD 1493          

HSP 3 Score: 157.147 bits (396), Expect = 1.433e-37
Identity = 167/578 (28.89%), Postives = 239/578 (41.35%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSL-SRG----VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE---------LGRCEKGFI--EIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQS-----ANKY--------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG-----------------KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCP-DGQCIPQPNNGYECRCLPGFAPMGKGK-----QCRRIMSDQSE---IGPTSSN----EDSKSSQGDIDFCF--YSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C C P F    T   C +  +G C+L +  RG        +  G+ +SK  CC +   AWG PC+ C          L    +GF    I  I +DI+ECQ    +C+ GKCIN  GSF+C C + Y  +     C     +CE  P +CGPG      ++ N+ C C P Y++   G +C          N Y        ++       +C     I   +N  CE  Q  I S+D                        +D C    G VC NG C+++   + C+C  G+  +     C  I +     +C  + +CI      Y C C PG+     G+     +C+ I +  S    I    S          +  D   C       RD C  G C N    + C C  GF+L               N   DV        +C      LC NG+CI +  S+QCQCN GY+ + DG+ C DI+EC ++P  C  GTC N  GSY+C C  G+++ N     KC D +EC E   +C  G C NT GSF+C C  G+  S+  + C  ++
Sbjct: 1511 CDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVC-DDVNECE-TPGICGPGT--CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPG-VCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECI-NTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHN------------NDCIDV-------DECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLDPRKCAPGTCQNLDGSYRCICPPGYSLQN----DKCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDLR 2057          

HSP 4 Score: 150.984 bits (380), Expect = 1.183e-35
Identity = 125/434 (28.80%), Postives = 202/434 (46.54%), Query Frame = 3
Query:  744 WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER--VEYKT--NQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
            +  +C++G+CI   GS+RC C+  +Q D ++ +C+    +CE+ P     G +C++    ++ C+C PGY  +L     ++      D C   G  +C+ G+CI    ++ C CN G+  + DGK+C+  +D C+  N  +C NG C++    + C C  G+  + D + C  I +     +C +G+C+   +  Y C C PG A    G+ C       +                    C+  Y R QC       +     C     +   +  Q C  +   EY+   +    + S+ S   +C      +C NG C     +Y+C CN+GY+    GK C DI+EC +N  +CD G C N+PGS+ C+C  GF     P    C D +EC   +S C NG+CKN+ GSF C+C+S       K  C+  
Sbjct:  456 FRYLCQNGRCIPTPGSYRCECNKGFQLD-LRGECID-VDECEKNPCA---GGECINTQ-GSYTCQCRPGYQSTL-----TRTECRDIDECLQNG-RICNNGRCINTDGSFHCVCNAGFHVTRDGKNCED-MDECSIRN--MCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCV-NTDGSYRCECFPGLAVGLDGRVCVDTHMRST--------------------CYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSAGSDINEC-ALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYK--PELKTCEDIDEC--ESSPCINGVCKNSPGSFICECSSESTLDPTKTICIET 848          

HSP 5 Score: 150.984 bits (380), Expect = 1.214e-35
Identity = 147/471 (31.21%), Postives = 209/471 (44.37%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWSQI-CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGP-----------TSSNEDSKSSQGDIDFCFYSYYRDQCKGGA--------CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            E GF+ +   C DI+ECQ   + C+ G C+N  GS+RC C   +Q  P  + C+    +CE   +LC P   CV+L I  + C C PGY  + D   C        D C         F  C     +Y+C C  G+    D +SC   +D C   N  +C  G+C ++  +Y C C  G+ +S D K C  +  CDL P ++C  G C       + C C  G++       C  I  ++ EIG            T+ +     S G I         D+C  G         C N    YRC C  G+  D  G  C +  E   N +N                  LC NG+C+ +   Y+C+C+ G+  S DGK C DIDECS+ P+IC  GTC N PG ++C C  G+ +     G  C D NEC + T+ C +G C NT GS+ C C   +  +  +  CV  +
Sbjct: 1102 ESGFMMMKN-CMDIDECQRDPLLCRGGVCLNTEGSYRCECPPGHQLAPNISACID-INECELSAHLC-PHGRCVNL-IGKYQCACNPGYHSTPDRLFCVD-----IDECSIMNGGCETF--CTNSEGSYECSCQPGFALMPDQRSCTD-IDECED-NPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP-NICLSGTC-ENTKGSFICHCDMGYSGKKGKTGCTDI--NECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGD--GFTCTDLDECSEN-LN------------------LCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSL-PNICVFGTCHNLPGLFRCECEIGYELDR--SGGNCTDVNECLDPTT-CISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTR 1530          

HSP 6 Score: 132.494 bits (332), Expect = 6.335e-30
Identity = 165/618 (26.70%), Postives = 241/618 (39.00%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQ-VAWGDPCQRCELGRCEKGFIEI-----------DGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------RRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQ-ACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD----------------------------------------QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C  GF    TG+ C ++    C+     G C   P     SK+ CC A +   WGDPC+ C     ++ F +I           D    D++EC+   +CK G+CIN  GS+RC C   Y       +CV   +    + N CG G  C ++ I    C C  G+     G   + +  N+        P +C F +C+    +Y+C+C  GY+   D + CK   +     +       +C +L   Y+C C  GY    D + C   + C   P  +C +G+C+      Y C C  GF       +C           ++ +  +IG ++ N  +KS     + C        C GG       H  CE  P      QG  A K+   +    M + A     K   D     +C NG C+    SY C C TGY   + G  C D++EC+  P  C+                                        Q  C+N+ GS+ C C  GFT H+      C D NECT   +LC   GIC+NT GSF C+C  G+        C  V +               +C H C+   G + CSCP G
Sbjct: 2037 KCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEP-DEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILQ--GNECVDTDEC--SVGNPCGNGT-CKNV-IGGFECTCEEGFEP---GPMMTCEDINECAQ----NPLLCAF-RCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGYQRRPDGEGCVDENECQTKP-GICENGRCL-NTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKS-----ECC--------CDGGR--GWGPH--CEICP-----FQGTVAFKKLCPHGRGFMTNGADIDECKVIHD-----VCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFTQHHT----ACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDPSGASCEDVDECEGN----------HRCQHGCQNIIGGYRCSCPQG 2595          

HSP 7 Score: 131.339 bits (329), Expect = 1.383e-29
Identity = 160/559 (28.62%), Postives = 223/559 (39.89%), Query Frame = 3
Query:  498 RCQCKPGF----TGK-----SCSEIVN----GECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQ----RCELG----RCEKGFI-EIDGICQDINECQW--SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT-VDFC-TRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQ----------CDKFGS-----FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC--DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RC CKPG+    TG+      C EI N    G+C  ++    C+ H      + +  C        D C     R  +G    RC  GFI   +  C D++EC      +C++G+CIN  GSF+C C+  Y+  P    CV    +C   P  C PG  C +L   ++ C C PGY  SL    C        D C    P +C  G C     ++KC C  G+  SS G+ C+   + +C  ++ G  C + K  + S    C    G       + C +  D   R +CP G  I                                 +GP         S  D+D C      D CK G CIN    YRCEC  G++L  QG  C +  E             +V   F    +          C+          LC   RC+ +  SY+C+C  GY    D ++C D DEC      C   Q  C N  G+Y C C  G+     P G  C D NEC     +C+NG C NT GS+ C+CN G+ +S  + +C+
Sbjct: 1832 RCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVD-INECLLDPRKCAPGT-CQNLD-GSYRCICPPGY--SLQNDKCE-----DIDEC-VEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGI--------------------------------IVGP-------DDSAVDMDECKEP---DVCKHGQCINTDGSYRCECPFGYIL--QGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF-RCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGY--QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECL 2332          

HSP 8 Score: 130.183 bits (326), Expect = 3.150e-29
Identity = 175/660 (26.52%), Postives = 262/660 (39.70%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLS---RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQ-----------------------RCELGRCEKGFIEID---GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKY----------------------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT----SIC--DLYPRSLCPDGQCIPQPNNGYECRCLP-GFAPMGKGKQCRRIMSDQSEI-----GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN---QMNDVASSFSLKTQCD-----KFGSF--------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNEC-TETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            RC CK G+TG   +     EC  +L+    G C+  P G +   ++  G    A G  C+                       RCE   CE G+ E+D   G C D+NEC     C SG C+N  GS+ C C   ++ +P +  CV  R   C       G   D      + + +    C C  G       + C   + ++Y                      D C+   P +C  GKCI    +++C C  GY  + D + C   V+ C      +C  G C +   +Y C C   Y        C     S+C  + Y  +   DG+ +        C     G A     +QC    +D+         P    +       DID C        C+ G CINM   +RCEC  GF  + +   C++  E +     Q N    + +   +CD     +F S               +C++G+CI++  S+ C C+TG++ + D  +C DI+EC  +   C  GTC N+ GS+ C C  GF + HN      C D +EC T   +LC+NG C NT GSFQCQCN GY  +   + CV + +         P          C+  +G + C CP G    L+   C  + + V+
Sbjct: 1388 RCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDM--GFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCE---CEIGY-ELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQEL-PGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDD-VNECETPG--ICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDEC--REIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERD--ACGNGTCRNTIGSFNCRCNHGFILSHNN----DCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLDPRKCAPGT--------CQNLDGSYRCICPPGYS--LQNDKCEDIDECVE 2019          

HSP 9 Score: 124.405 bits (311), Expect = 2.110e-27
Identity = 117/430 (27.21%), Postives = 173/430 (40.23%), Query Frame = 3
Query:  993 ANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCI------------------------------NSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
             N  D C+ +  Y+C  G+CI    +Y+CECN+G+     G+     VD C +     C  G+C++    Y CQC  GY S+  R +C  I + L    +C +G+CI   +  + C C  GF     GK C                        D+D C     R+ C  G CIN    ++C C PGF L   G+ CK+  E +T                      +C NGRC+ +  SY+C+C  G    LDG++C D    S       +G C+                               +   YQ  C  G  I +        D NEC     +C NGIC+N  G+++C CNSGY   +  ++CV + +          S +C   +  C+ + G FVC+CP G     E   C  + +
Sbjct:  447 VNVTDYCQLFR-YLCQNGRCIPTPGSYRCECNKGFQLDLRGECID--VDECEKN---PCAGGECINTQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICNNGRCI-NTDGSFHCVCNAGFHVTRDGKNCE-----------------------DMDEC---SIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECET--------------------PGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSAGS-----DINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLN------SLLCD--NGQCRNTPGSFVCTCPKGFIYKPELKTCEDIDE 810          

HSP 10 Score: 118.242 bits (295), Expect = 1.707e-25
Identity = 117/440 (26.59%), Postives = 180/440 (40.91%), Query Frame = 3
Query: 1026 PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQC---IPQPNNGYECRC------------LPGFAPMGKGKQCRRIMSDQSEIG--------------------------------------PTSSNEDSKSSQGDI-DFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            P +C  G CI    +++C+C  G+  +   + C+  +D C+   G+ C  G+C +  + Y C+C  G+ +S D  +C  +   Y  +   +G+C   +PQ     +C C             P   P+   +   ++ S    I                                       P  S E  +    ++ D+C    +R  C+ G CI     YRCEC  GF LD +G+ C +  E + N                      C  G CI +  SY CQC  GYQ++L    C DIDEC  N  IC+ G CIN+ GS+ C C  GF  H    G  C D +EC+   ++C NG+C N  GSF+C C  G+  ++  + C  +        + E   IC   +  C  ++G + C C  GL   L+  +C   
Sbjct:  254 PGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCED-IDECSTIPGI-CDGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALANGRCSNQLPQSITKMQCCCDVGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPERPGYPPPPLGPVPPVQPVPPGFPPGPQIMIPRPPVEYPYPSREPPRVLPVNVTDYC--QLFRYLCQNGRCIPTPGSYRCECNKGFQLDLRGE-CIDVDECEKNP---------------------CAGGECINTQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGF--HVTRDGKNCEDMDECS-IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDIN-------ECETPGICM--NGRCVNTDGSYRCECFPGLAVGLDGRVCVDT 655          

HSP 11 Score: 116.316 bits (290), Expect = 5.785e-25
Identity = 90/277 (32.49%), Postives = 128/277 (46.21%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC 980
            ++CG   N++ CC G++    G+ C +PIC + CG +G C RPN C C +G IA SC                          +                 N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GSF C C + ++F+ V   C +   +C  IP +C  G +C + ++ ++ CKC PG+  S DG  C
Sbjct:   57 NVCGSRYNAY-CCPGWKTLPGGNQCIVPICRHSCG-DGFCSRPNMCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKC-EDIDECSTIPGICD-GGECTN-TVSSYFCKCPPGFYTSPDGTRC 328          

HSP 12 Score: 104.76 bits (260), Expect = 2.214e-21
Identity = 124/433 (28.64%), Postives = 175/433 (40.42%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIAD--GYNYKCECNQGYIASSDGKSCK--------KTVDFCTRYNGV---------------VCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C  GF +  DG  C+D++EC    +C +G CINE GSF+C+C   +Q       C +   +CE  P +C  G  CV+    ++ C+C PG    LDG+ C     + +     YG Y    G+C+    G   K EC       + G+ C+        +    C+   G+               +CPNG C +L   Y C C+SGY      K C  I +    S LC +GQC   P + + C C  GF    + K C                        DID C  S     C  G C N    + CEC     LD     C E ++    Q           +  +LK+QC       C++           CQ    C  GY + + G  C DIDEC + P +C  G C+NS GS++C C  G T+
Sbjct:  557 CNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYC-KDINECE-TPGICMNGR-CVNTD-GSYRCECFPGLAVGLDGRVC----VDTHMRSTCYGGY--KRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGS-FVCTCPKGFIYKPELKTCE-----------------------DIDECESS----PCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQC-------CSSLGAAWGSPCTPCQVDPICGKGY-SRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPSGMTL 943          

HSP 13 Score: 67.3958 bits (163), Expect = 6.516e-10
Identity = 35/104 (33.65%), Postives = 54/104 (51.92%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C  G+  ++    C D+DEC   P +C  G CIN+ GS++C C  G   + +    KC D +EC+    +C  G C NT  S+ C+C  G+ +S     C+ V+
Sbjct:  231 CRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEV--SQKCEDIDECSTIPGICDGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVR 332          
BLAST of Latent transforming growth factor beta binding protein 3 vs. TrEMBL
Match: G4V5Q9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_001100 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.177e-81
Identity = 193/573 (33.68%), Postives = 296/573 (51.66%), Query Frame = 3
Query:  162 MILSVGLLSIFGLFFAHLQTVHG-ESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED---QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCSEIVNGECFLSLSRGVCM--------KHPY-GLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQR-KKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQ-------GDIDFCFYSYYRDQCKGGACIN---MKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFL-------------CNNGRCIE-SGSSYQCQCNTGYQASLDGKLC 1766
            M  ++ LL    +++ ++   +G  SHIC       VCC G+R      C IP+C   CG  G C++PNTC CS+  +  SC EED   +S+    +  EN+C ++CN  GTC +G C C+ G++G+ C   + G C+ SL RG+C+        ++ Y  + L+ E+CC A  +AWG+PCQ C++  C KG+ +IDGIC+DINEC+   +C+ G+CINE GS++C C  + QFD    DCV + K  CE  P  C  G  C+ L   ++ C C  G   S D KSC +     +D+C+ Y   VC  G+CI  G  Y+C CN+G+  S D K+C+  VD C+ + G +C NG+C+    D+ C+C+ G+T SYDR++C S C+    S+CP+G CI   N  YEC+C  G+      K+C  IM  +    P S+   +K+ Q       GD +   Y +  +  K    I+   + +           L ++    +++   +  Q++    ++   TQ    G+ L             CN G C+   G  Y C+C   Y A   G+ C
Sbjct:    1 MNQNIILLYSIVIYYLYVDYSYGIRSHICNKYNGQPVCCPGWRNGIGAPCIIPVCAGNCGERGECIKPNTCICSDRRLRFSCREEDIDEESDTMQLDQAENQCPDSCNEHGTCESGACICQTGYSGRKCETKLTGACYTSLKRGLCVNPMQYRISQYDYEAIPLTHEICCNALGIAWGEPCQICQITHCSKGYEQIDGICKDINECEVDGVCQRGQCINEEGSYKCNCPENTQFDKTTLDCVYKLKMPCESDPYRCHHGGKCIDLPSGDYKCICPWGTRTSQDRKSCIEDKELHFDICQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTCQYKVDICSVHRGYLCTNGQCIPAGRDFFCECNPGFTLSYDRRRCMSKCEELGPSICPNGYCIALSNGDYECQCEIGYQSTSDHKKC--IMQIEE---PNSNIHFAKTVQYYKNKYYGDKENEAYEHSIEMNKPKLQIDQSEIDDEKSYNWWQSDSLSRKSSGKQQKTYSQYKQLDSSDVTYEKPTQLHLRGTSLRSTPCGQDDIVKRCNGGICLNLGGDGYFCECLPSYLAINGGRAC 568          

HSP 2 Score: 74.3294 bits (181), Expect = 9.130e-10
Identity = 59/192 (30.73%), Postives = 91/192 (47.40%), Query Frame = 3
Query: 1500 GGACINMKN-HYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPS-ICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET-----TSLCKNGIC-KNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            GG CI++ +  Y+C C  G    +  ++C E          D    F +   C  + S +C NG+CI  G++Y+C CN G++ S D K C   +D CS++   +C  G CI +   + C C  GFT+         YDR  C         S+C NG C   + G ++CQC  GY S++  + C+   +  N
Sbjct:  259 GGKCIDLPSGDYKCICPWGTRTSQDRKSCIE----------DKELHFDI---CQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTCQYKVDICSVHRGYLCTNGQCIPAGRDFFCECNPGFTLS--------YDRRRCMSKCEELGPSICPNGYCIALSNGDYECQCEIGYQSTSDHKKCIMQIEEPN 429          

HSP 3 Score: 71.2478 bits (173), Expect = 7.363e-9
Identity = 69/244 (28.28%), Postives = 98/244 (40.16%), Query Frame = 3
Query: 1164 VCPNGKCVSLSNDYICQCDSGYTSSYDRK------KCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCF---YSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCIN-SPGSYQCSCFDGF 1865
            VC  G+C++    Y C C     + +D+       K    C+  P      G+CI  P+  Y+C C     P G                 T +++D KS   D +  F     Y    CK G CI   N Y C C  GF   +  + C+ +V+                  C     +LC NG+CI +G  + C+CN G+  S D + C    E  + PSIC  G CI  S G Y+C C  G+
Sbjct:  211 VCQRGQCINEEGSYKCNCPE--NTQFDKTTLDCVYKLKMPCESDPYRCHHGGKCIDLPSGDYKCIC-----PWG-----------------TRTSQDRKSCIEDKELHFDICQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTCQYKVDI-----------------CSVHRGYLCTNGQCIPAGRDFFCECNPGFTLSYDRRRCMSKCE-ELGPSICPNGYCIALSNGDYECQCEIGY 412          
BLAST of Latent transforming growth factor beta binding protein 3 vs. TrEMBL
Match: A0A3Q0KBG5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.307e-81
Identity = 196/582 (33.68%), Postives = 299/582 (51.37%), Query Frame = 3
Query:  162 MILSVGLLSIFGLFFAHLQTVHG-ESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED---QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCSEIVNGECFLSLSRGVCM--------KHPY-GLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQR-KKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQ-------GDIDFCFYSYYRDQCKGGACIN---MKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFL-------------CNNGRCIE-SGSSYQCQCNTGYQASLDGKLCSDIDECSIN 1793
            M  ++ LL    +++ ++   +G  SHIC       VCC G+R      C IP+C   CG  G C++PNTC CS+  +  SC EED   +S+    +  EN+C +NCN  GTC +G C C+ G++G+ C   + G C+ SL RG+C+        ++ Y  + L+ E+CC A  +AWG+PCQ C++  C KG+ +IDGIC+DINEC+   +C+ G+CINE GS++C C  + QFD    DCV + K  CE  P  C  G  C+ L   ++ C C  G   S D KSC +     +D+C+ Y   VC  G+CI  G  Y+C CN+G+  S D K+C+  VD C+ + G +C NG+C+    D+ C+C+ G+T SYDR++C S C+    S+CP+G CI   N  YEC+C  G+      K+C  IM  +    P S+   +K+ Q       GD +   Y +  +  K    I+   + +           L ++    +++   +  Q++    ++   TQ    G+ L             CN G C+   G  Y C+C   Y A   G+ C    E + N
Sbjct:    1 MNQNIILLYSIVIYYLYVDYSYGIRSHICNKYNGQPVCCPGWRNGIGAPCIIPVCAGNCGERGECIKPNTCICSDRRLRFSCREEDIDEESDTMQLDQAENQCPDNCNEHGTCESGACICQTGYSGRKCETKLTGACYTSLKRGLCVNPMQYRISQYDYEAIPLTHEICCNALGIAWGEPCQICQITHCSKGYEQIDGICKDINECEVDGVCQRGQCINEEGSYKCNCPENTQFDKTTLDCVYKLKMPCESDPYRCHHGGKCIDLPSGDYKCICPWGTRTSQDRKSCIEDKELHFDICQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTCQYKVDICSVHRGYLCTNGQCIPAGRDFFCECNPGFTLSYDRRRCMSKCEELGPSICPNGYCIALSNGDYECQCEIGYQSTSDHKKC--IMQIEE---PNSNIHFAKTVQYYKNKYYGDKENEAYEHSIEMNKPKLQIDQSEIDDEKSYNWWQSDSLSRKSSGKQQKTYSQYKQLDSSDVTYEKPTQLHLRGTSLRSTPCGQDDIVKRCNGGICLNLGGDGYFCECLPSYLAINGGRACVKHKEGANN 577          

HSP 2 Score: 74.3294 bits (181), Expect = 8.652e-10
Identity = 59/192 (30.73%), Postives = 91/192 (47.40%), Query Frame = 3
Query: 1500 GGACINMKN-HYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPS-ICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET-----TSLCKNGIC-KNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            GG CI++ +  Y+C C  G    +  ++C E          D    F +   C  + S +C NG+CI  G++Y+C CN G++ S D K C   +D CS++   +C  G CI +   + C C  GFT+         YDR  C         S+C NG C   + G ++CQC  GY S++  + C+   +  N
Sbjct:  259 GGKCIDLPSGDYKCICPWGTRTSQDRKSCIE----------DKELHFDI---CQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTCQYKVDICSVHRGYLCTNGQCIPAGRDFFCECNPGFTLS--------YDRRRCMSKCEELGPSICPNGYCIALSNGDYECQCEIGYQSTSDHKKCIMQIEEPN 429          

HSP 3 Score: 71.2478 bits (173), Expect = 7.039e-9
Identity = 69/244 (28.28%), Postives = 98/244 (40.16%), Query Frame = 3
Query: 1164 VCPNGKCVSLSNDYICQCDSGYTSSYDRK------KCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCF---YSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCIN-SPGSYQCSCFDGF 1865
            VC  G+C++    Y C C     + +D+       K    C+  P      G+CI  P+  Y+C C     P G                 T +++D KS   D +  F     Y    CK G CI   N Y C C  GF   +  + C+ +V+                  C     +LC NG+CI +G  + C+CN G+  S D + C    E  + PSIC  G CI  S G Y+C C  G+
Sbjct:  211 VCQRGQCINEEGSYKCNCPE--NTQFDKTTLDCVYKLKMPCESDPYRCHHGGKCIDLPSGDYKCIC-----PWG-----------------TRTSQDRKSCIEDKELHFDICQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTCQYKVDI-----------------CSVHRGYLCTNGQCIPAGRDFFCECNPGFTLSYDRRRCMSKCE-ELGPSICPNGYCIALSNGDYECQCEIGY 412          
BLAST of Latent transforming growth factor beta binding protein 3 vs. TrEMBL
Match: A0A095C1N8 (Fibrillin-2 OS=Schistosoma haematobium OX=6185 GN=MS3_03759 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.201e-76
Identity = 166/420 (39.52%), Postives = 238/420 (56.67%), Query Frame = 3
Query:  231 ESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED---QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCSEIVNGECFLSLSRGVCM--------KHPY-GLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV-QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQ 1451
            +SHIC       VCC G+R      C IP+C   CG  G C++PNTC CS+  +  SC EED   +S+    +  EN+C +NCN  GTC NG C C+ G++G  C   + G C++SL RG+C+        ++ Y  + L+ E+CC A  +AWG+PCQ C+   C KG+ +IDG+C+DINEC+   +C+ G+CINE GS++C C  +  FD    DCV   K  CE  P+ C  G  C+ L   ++ C C  G   S D KSC +     +D+C+ Y   VC  G+CI  G  Y+C CN+G+  S D K+C+  VD C+ + G +C NG C+    D+ C+C+ G+T SYDR++C S C+    S+CP+G CI   N  YEC+C  G+      K+C   M +     P S+   +KS Q
Sbjct:   27 KSHICSKYNGKPVCCPGWRNGIGAPCIIPVCAGNCGERGECIKPNTCICSDRRLRFSCKEEDIDEESDTMQLDQAENQCPDNCNERGTCENGACICRTGYSGLKCEIKLTGACYISLKRGLCVNPMQYRISQYDYEAIPLTHEVCCNALGIAWGEPCQICQSTHCGKGYEQIDGVCKDINECEVDGVCQRGQCINEEGSYKCNCPENTHFDKSTLDCVYTLKMPCELDPHRCHNGGKCIDLPSGDYKCICPWGTRTSQDRKSCIEDKEFHFDICQLYKSSVCKNGQCIPRGNTYECICNEGFEPSEDRKTCQYKVDICSVHRGYLCTNGHCIPAGRDFFCECNPGFTLSYDRRRCMSKCEELGPSICPNGYCIALSNGDYECQCELGYQSTPDHKKCIMQMEE-----PNSNVHFTKSVQ 441          

HSP 2 Score: 75.8702 bits (185), Expect = 2.785e-10
Identity = 73/255 (28.63%), Postives = 103/255 (40.39%), Query Frame = 3
Query: 1164 VCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI------CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCF---YSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCIN-SPGSYQCSCFDGFTIHNMPGGPKC 1898
            VC  G+C++    Y C C     + +D+     +      C+L P      G+CI  P+  Y+C C     P G                 T +++D KS   D +F F     Y    CK G CI   N Y C C  GF   +  + C+ +V+                  C     +LC NG CI +G  + C+CN G+  S D + C    E  + PSIC  G CI  S G Y+C C  G+   + P   KC
Sbjct:  213 VCQRGQCINEEGSYKCNCPE--NTHFDKSTLDCVYTLKMPCELDPHRCHNGGKCIDLPSGDYKCIC-----PWG-----------------TRTSQDRKSCIEDKEFHFDICQLYKSSVCKNGQCIPRGNTYECICNEGFEPSEDRKTCQYKVDI-----------------CSVHRGYLCTNGHCIPAGRDFFCECNPGFTLSYDRRRCMSKCE-ELGPSICPNGYCIALSNGDYECQCELGY--QSTPDHKKC 423          

HSP 3 Score: 75.485 bits (184), Expect = 4.209e-10
Identity = 59/192 (30.73%), Postives = 91/192 (47.40%), Query Frame = 3
Query: 1500 GGACINMKN-HYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCS-DIDECSINPS-ICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET-----TSLCKNGIC-KNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            GG CI++ +  Y+C C  G    +  ++C E  E+           F +   C  + S +C NG+CI  G++Y+C CN G++ S D K C   +D CS++   +C  G CI +   + C C  GFT+         YDR  C         S+C NG C   + G ++CQC  GY S+   + C+   +  N
Sbjct:  261 GGKCIDLPSGDYKCICPWGTRTSQDRKSCIEDKEFH----------FDI---CQLYKSSVCKNGQCIPRGNTYECICNEGFEPSEDRKTCQYKVDICSVHRGYLCTNGHCIPAGRDFFCECNPGFTLS--------YDRRRCMSKCEELGPSICPNGYCIALSNGDYECQCELGYQSTPDHKKCIMQMEEPN 431          
BLAST of Latent transforming growth factor beta binding protein 3 vs. TrEMBL
Match: G7YU07 (Fibrillin-2 OS=Clonorchis sinensis OX=79923 GN=CLF_110880 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 2.907e-76
Identity = 173/531 (32.58%), Postives = 264/531 (49.72%), Query Frame = 3
Query:  186 SIFG--LFFAHLQT-----VHGESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCSEIVNGECFLSLSRGVCM------KHPYGL--QLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC----RRIMSDQSEIGPTSSNEDSKSSQ-----------GDIDFCFYSYYR-------------------------------DQCKGGACINMKNH-YRCECLPGFVLDKQGQACKER 1592
            ++FG  L F  L       V     IC   +   +CCSG+  +    C+IP C   CG  G C+RPNTC C++  +  SCD  D+  +   +     C ++CN  G CV+G C+C  GF+G++C EI+   CF  L RG+C+      +H   +  ++S+E+CC +F +AWG+PC  C+   C +G+ + +G C+DI+ECQ   +C++GKC N  G F C C   Y F+     C      C      C PG  CV L   +  C C   Y  + D KSC ++ A  +D+C  Y   +C  G C++ G +Y+C+CN G+  S D KSC++ +D C  + G +CPNG+CVS   D+ C CD G+T S+DR++C + C+    ++CP+G+C+  P   YEC+C PG+      K C      +  +   I P  ++E +  S            G+  + + S+                                  +C GG C+N+  H Y CECLPGF    QG+ C  +
Sbjct:   10 TLFGAVLIFVSLSVTCSLGVDSNRRICAYGKKP-ICCSGWYNNISSPCSIPSCAGDCGDYGQCIRPNTCLCADRRLRFSCDA-DEPESMQHDQPSVTCVDDCNRRGRCVDGTCECDDGFSGEACEEILESACFAKLQRGLCVNPIQYSQHSGNVTTKMSREVCCNSFGIAWGEPCHPCQTSYCGRGYAQKNGSCRDIDECQIPGVCQNGKCSNHEGMFTCKCPDGYTFNEESLQCKPTTDICASHGQQCLPGGRCVPLKSGDFKCVCKWNYRSAGDQKSCIQKKAITFDICAVYSKSICKNGVCVSRGNSYECDCNDGFEPSVDRKSCRRKIDVCALHRGYLCPNGECVSFGRDFYCNCDPGFTPSFDRRRCLNHCERMGPNICPNGRCVAMPYGDYECQCYPGYERSTDRKHCVPEATSVTYELPPIMPYVNDEAASPSNFPYAPTARYTGGNQPYQWNSWRSHRAPSYPPFPRRSWSRPNGVSNAPCNQPHIVQRCSGGTCLNLGRHSYMCECLPGFDSYDQGRYCGTK 538          

HSP 2 Score: 70.8626 bits (172), Expect = 8.619e-9
Identity = 62/224 (27.68%), Postives = 105/224 (46.88%), Query Frame = 3
Query: 1428 NEDSKSSQGDIDFCFYSYYRDQC-KGGACINMKN-HYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLC-SDIDECSINPS-ICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET-----TSLCKNGIC-KNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEP 2069
            NE+S   +   D C  + +  QC  GG C+ +K+  ++C C   +      ++C ++           A +F +   C  +   +C NG C+  G+SY+C CN G++ S+D K C   ID C+++   +C  G C++    + C+C  GFT          +DR  C         ++C NG C    YG ++CQC  GY  S  ++ CV   + ++  Y+  P
Sbjct:  236 NEESLQCKPTTDIC--ASHGQQCLPGGRCVPLKSGDFKCVCKWNYRSAGDQKSCIQKK----------AITFDI---CAVYSKSICKNGVCVSRGNSYECDCNDGFEPSVDRKSCRRKIDVCALHRGYLCPNGECVSFGRDFYCNCDPGFTPS--------FDRRRCLNHCERMGPNICPNGRCVAMPYGDYECQCYPGYERSTDRKHCVP--EATSVTYELPP 434          
BLAST of Latent transforming growth factor beta binding protein 3 vs. TrEMBL
Match: A0A419PXF3 (Fibrillin-2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Fbn2 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 8.320e-71
Identity = 150/414 (36.23%), Postives = 227/414 (54.83%), Query Frame = 3
Query:  186 SIFG--LFFAHLQT-----VHGESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCSEIVNGECFLSLSRGVCM------KHPYGL--QLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC 1382
            ++FG  L F  L       V     IC   +   +CCSG+  +    C+IP C   CG  G C+RPNTC C++  +  SCD  D+  +   +     C ++CN  G CV+G C+C  GF+G++C EI+   CF  L RG+C+      +H   +  ++S+E+CC +F +AWG+PC  C+   C +G+ + +G C+DI+ECQ   +C++GKC N  G F C C   Y F+     C      C      C PG  CV L   +  C C   Y  + D KSC ++ A  +D+C  Y   +C  G C++ G +Y+C+CN G+  S D KSC++ +D C  + G +CPNG+CVS   D+ C CD G+T S+DR++C + C+    ++CP+G+C+  P   YEC+C PG+      K C
Sbjct:   10 TLFGAVLIFVSLSVTCSLGVDSNRRICAYGKKP-ICCSGWYNNISSPCSIPSCAGDCGDYGQCIRPNTCLCADRRLRFSCDA-DEPESMQHDQPSVTCVDDCNRRGRCVDGTCECDDGFSGEACEEILESACFAKLQRGLCVNPIQYSQHSGNVTTKMSREVCCNSFGIAWGEPCHPCQTSYCGRGYAQKNGSCRDIDECQIPGVCQNGKCSNHEGMFTCKCPDGYTFNEESLQCKPTTDICASHGQQCLPGGRCVPLKSGDFKCVCKWNYRSAGDQKSCIQKKAITFDICAVYSKSICKNGACVSRGNSYECDCNDGFEPSVDRKSCRRKIDVCALHRGYLCPNGECVSFGRDFYCNCDPGFTPSFDRRRCLNHCERMGPNICPNGRCVAMPYGDYECQCYPGYERSTDRKHC 421          

HSP 2 Score: 73.1738 bits (178), Expect = 2.385e-9
Identity = 62/224 (27.68%), Postives = 105/224 (46.88%), Query Frame = 3
Query: 1428 NEDSKSSQGDIDFCFYSYYRDQC-KGGACINMKN-HYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLC-SDIDECSINPS-ICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET-----TSLCKNGIC-KNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEP 2069
            NE+S   +   D C  + +  QC  GG C+ +K+  ++C C   +      ++C ++           A +F +   C  +   +C NG C+  G+SY+C CN G++ S+D K C   ID C+++   +C  G C++    + C+C  GFT          +DR  C         ++C NG C    YG ++CQC  GY  S  ++ CV   + ++  Y+  P
Sbjct:  236 NEESLQCKPTTDIC--ASHGQQCLPGGRCVPLKSGDFKCVCKWNYRSAGDQKSCIQKK----------AITFDI---CAVYSKSICKNGACVSRGNSYECDCNDGFEPSVDRKSCRRKIDVCALHRGYLCPNGECVSFGRDFYCNCDPGFT--------PSFDRRRCLNHCERMGPNICPNGRCVAMPYGDYECQCYPGYERSTDRKHCVP--EATSVTYELPP 434          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Cavefish
Match: fbn2a (fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4])

HSP 1 Score: 192.2 bits (487), Expect = 1.342e-49
Identity = 159/564 (28.19%), Postives = 233/564 (41.31%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDG-ICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSIN-----------------------------------------PSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+C PG     TG  C + + G C+L++  G C  +  G  L  E CC     AWG PC+ CE+   C++GF    G IC+D+NEC+ +  +C +G+C+N RGSF+C CS     D     CV  + +   +       +  VS       C C  G     + ++C +    +Y+     GP   + G  +                   G+   K ++ C  +  + C +G C +    + C+C+ G+    + + CT I  C + P  LC  G C+  P + +EC CLPG+ +     K C  I  D+ E  P                         C+GG+C N +  Y+C C PG  L   G AC++  E +                     + LC NG C+    +Y C C+TGYQ++ D K C+DIDEC+I                                          P ICD G C N PG Y C C+DGFT         C D NEC   +++C  G C+NT GSF C C  GY        C  + +
Sbjct:  728 CECSPGSKVDPTGLICIDSLKGTCWLTIQEGRCEVNINGGTLRSE-CCATLGAAWGSPCEPCEIDPVCQRGFARPRGTICEDVNECEVFPGVCPNGRCVNTRGSFKCQCSEGLTLDSTGRICVDIRLEHCYLTYDEDECVQPVSGRFRMDACCCTVGAAWGKECEACPEPGTREYEALCPRGPGFANRGDVLT------------------GRPVYKDINECKVFPSI-CAHGTCRNTIGSFRCRCNGGFALDAEERNCTDIDECKISP-DLCGHGACVNTPGS-FECDCLPGYESGFMMMKNCMDI--DECERNP-----------------------GLCRGGSCKNTEGSYQCVCPPGHQLSTDGDACEDVNECE-------------------LSATLCRNGECVNVAGTYHCSCSTGYQSTPDRKGCTDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSCTDVDECEEEPDICDGGQCTNVPGEYHCLCYDGFTSSMTT--KSCIDVNECELNSNICMFGECENTKGSFICHCEVGYSVKKGSSGCTDIDE 1223          

HSP 2 Score: 178.718 bits (452), Expect = 2.334e-45
Identity = 171/589 (29.03%), Postives = 258/589 (43.80%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI---------CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSN-------------------EDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN--------DVASSFSLK---------TQCDKF-----GSFLCN-NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            +CQC  G T    G+ C +I    C+L+     C++ P   +   + CC     AWG  C+ C     E G  E + +C                   +DINEC+ +  IC  G C N  GSFRC C+  +  D  + +C     +C+  P+LCG G  CV+ +  +  C CLPGY           ++    D C    P +C  G C     +Y+C C  G+  S+DG +C+  V+ C   +  +C NG+CV+++  Y C C +GY S+ DRK CT I         CDL    LC + +        Y C C   +A M   + C  +  D+ E  P   +                     S +++  ID        + C  G C N K  + C C  G+ + K    C +  E + +  N        ++  SFS            +CD       G+  C+ +G C+ +  S++C C  GY+   DG  CSDIDEC+ +  +C+ G C+N PGSYQC C  GF   + P    C D +ECT    +C  G+C+N  G+F+C C+ GY  +    +C  V +
Sbjct:  832 KCQCSEGLTLDSTGRICVDIRLEHCYLTYDEDECVQ-PVSGRFRMDACCCTVGAAWGKECEACP----EPGTREYEALCPRGPGFANRGDVLTGRPVYKDINECKVFPSICAHGTCRNTIGSFRCRCNGGFALDAEERNCTD-IDECKISPDLCGHGA-CVN-TPGSFECDCLPGYESGFM----MMKNCMDIDECE-RNPGLCRGGSCKNTEGSYQCVCPPGHQLSTDGDACED-VNEC-ELSATLCRNGECVNVAGTYHCSCSTGYQSTPDRKGCTDIDECTIENGGCDL----LCTNSE------GSYTCSCGQRYALMPDLRSCTDV--DECEEEPDICDGGQCTNVPGEYHCLCYDGFTSSMTTKSCIDVNECELNSNICMFGECENTKGSFICHCEVGYSVKKGSSGCTDIDECQIDAHNCDRNANCVNIPGSFSCTCMEGWIGNGVKCDDVDECIRGTHQCSPDGECVNTPGSFRCACTEGYKG--DGFTCSDIDECADSTHMCENGQCLNIPGSYQCECEIGFI--SDPDSRTCQDIDECTFQV-ICVFGLCENLPGAFRCVCDEGYELNRSGINCTDVDE 1388          

HSP 3 Score: 149.828 bits (377), Expect = 2.786e-36
Identity = 154/550 (28.00%), Postives = 238/550 (43.27%), Query Frame = 3
Query:  669 RCELGRCEKGFI--EIDGICQDINECQWSQIC--KSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCS---------------KQSANKY-----------------DMCRFYGPY--VCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINM-KNHYRCECLPGFVLDKQGQACKERVE--------YKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI-NPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLC 2174
            RCE   C +GF   ++  IC+DI+EC  S+I   ++  CIN  GS+RC CS  ++  P+ A C+ R + C + PNLC  G  CV +    ++C C  G+  + + K C                K +   Y                 D+    GPY  +C  G+C+    +++C C++GY  + DGK+C   V+ C    G   P G C +L   + C C  GYT   D     + C+  P ++C  G C   P + +EC C PGF     G++C                 D++     + FCF  +   +C      N  K    C  +P        + C +  E        +    +  +  +     +C +    +C+NG CI +  S++C+C  GY  +  G  C D+DEC++ NP  C  GTC N  G ++C+C +GF    M     C D NEC +   LC    C NT+G ++C C SGY      + C  + +     +D      C      CK   G F+C CP G+   ++  LC
Sbjct: 1686 RCE---CPRGFSYNDVLLICEDIDECSSSEILCQRNADCINSPGSYRCECSEGFKLSPIGA-CIDRNE-CLENPNLCSHG-KCVDMP-GGYICTCNTGFKATPNRKMCMDIDECVRQPCKNGTCKNTVGSYNCLCNAGFELTLNNQCTDVDECSGPYSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNCID-VNECLILPGTCAP-GTCQNLDGSFRCLCPKGYTVQDDHCVDVNECEEDP-NICLFGSCFNNPGS-FECVCKPGFVLSDNGRRCY----------------DTR-----VSFCFTRFENGKCSIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEHEAGFRDLCPFGVGIIPGIDDTSVDVNECVE-NPGICHNGHCINTDGSFRCECPMGYTLNYTGVHCVDVDECAVGNP--CGNGTCTNVIGGFECNCEEGFEPGPMMA---CEDINECGQNPLLCAF-RCINTFGGYECSCPSGYTLREDGRMCQDLDECVEGLHD------CDTRGMTCKNLIGTFMCICPPGMVRRMDDELC 2190          

HSP 4 Score: 144.821 bits (364), Expect = 1.195e-34
Identity = 165/618 (26.70%), Postives = 254/618 (41.10%), Query Frame = 3
Query:  525 GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQV--AWGDPCQRCEL----------GRCEKGFIEID---GICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCF----YSYYRDQCKG-------------GACINMKNHYRCECLPGFVLDKQGQACKE-RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC-----IESGSSYQCQ-CNTGYQASLDGKLCS--------------DIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFD 2210
            G +C ++    CF + +   C ++     ++  +CC A+ +  AW  PCQ C            G    GF EID   G   DI+EC +   IC SG CIN+ GSFRC C   + ++ V   C +   +C     LC    DC++ S  ++ C+C  G+  S  G    +             P +C  GKC+     Y C CN G+ A+ + K C   +D C R     C NG C +    Y C C++G+  + +  +CT +  C      LC +GQC+    + ++C C  G+     GK C  I  ++  I P +    +  +      C     Y+   D C               G+C N    + C C PGFVL   G+ C + RV +   +  +         +C    +F     RC      + G  Y C+ C   ++A     LC               D++EC  NP IC  G CIN+ GS++C C  G+T++    G  C D +EC    + C NG C N  G F+C C  G+        C  + +                C+  C  + G + CSCP+G     +  +C  + + V+   D
Sbjct: 1582 GNNCMDMRKSLCFRNYNGTAC-ENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGF-EIDIETGKPVDIDECNEIPGICASGVCINQIGSFRCECPRGFSYNDVLLIC-EDIDECSSSEILCQRNADCIN-SPGSYRCECSEGFKLSPIGACIDRNEC-------LENPNLCSHGKCVDMPGGYICTCNTGFKATPNRKMCMD-IDECVRQ---PCKNGTCKNTVGSYNCLCNAGFELTLN-NQCTDVDECSGPYSQLCRNGQCMNSVGS-FQCLCDEGYELTLDGKNC--IDVNECLILPGTCAPGTCQNLDGSFRCLCPKGYTVQDDHCVDVNECEEDPNICLFGSCFNNPGSFECVCKPGFVLSDNGRRCYDTRVSFCFTRFEN--------GKCSIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEHEAGFR-DLCPFGVGIIPGIDDTSVDVNECVENPGICHNGHCINTDGSFRCECPMGYTLNYT--GVHCVDVDECA-VGNPCGNGTCTNVIGGFECNCEEGF-EPGPMMACEDINECGQNPL---------LCAFRCINTFGGYECSCPSGYTLREDGRMCQDLDECVEGLHD 2158          

HSP 5 Score: 144.05 bits (362), Expect = 1.761e-34
Identity = 163/597 (27.30%), Postives = 237/597 (39.70%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFL-SLSRG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRC----------------------------------EL-GRCEKG-----------------FIEIDG-ICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCV-QRKKKCEQIPNLCGPGMDC---VSLSIYNHLCKCLPGYVKSLDG--KSCSKQSANKY-----------------------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            TG  C +   G CFL ++ RG   +      G+ +S+  CC +   AWG+PC+ C                                  EL G C+ G                 ++  D  IC+DI+EC  +  IC  G C N  G++ C+C   Y       +C+  RK  C +  N    G  C   ++ +I + +C C     K+ +   ++C +     +                       D C    P +C  G CI    +++CEC +G+  +     C+  +D C+    +   N  C++    Y C+C  G+  S      DR +C     L   +LC  G+C+  P  GY C C  GF      K C                        DID C     R  CK G C N    Y C C  GF L               NQ  DV        +C    S LC NG+C+ S  S+QC C+ GY+ +LDGK C D++EC I P  C  GTC N  GS++C C  G+T+ +      C D NEC E  ++C  G C N  GSF+C C  G++ S+  + C   +
Sbjct: 1420 TGIGCVDPRVGFCFLEAVPRGRGGLACSVEVGVGVSRSSCCCSLGRAWGNPCEGCPPVNTSDYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCVNTFGSFQCDCPGGYYLNADSRICEDIDECVVNPGICGPGTCYNTLGNYTCVCPQEYMQVNGGNNCMDMRKSLCFRNYN----GTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETGKPVDIDECNEI-PGICASGVCINQIGSFRCECPRGFSYNDVLLICED-IDECSSSEILCQRNADCINSPGSYRCECSEGFKLSPIGACIDRNEC-----LENPNLCSHGKCVDMPG-GYICTCNTGFKATPNRKMCM-----------------------DIDECV----RQPCKNGTCKNTVGSYNCLCNAGFELTLN------------NQCTDV-------DECSGPYSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNCIDVNECLILPGTCAPGTCQNLDGSFRCLCPKGYTVQD----DHCVDVNECEEDPNICLFGSCFNNPGSFECVCKPGFVLSDNGRRCYDTR 1954          

HSP 6 Score: 143.28 bits (360), Expect = 2.806e-34
Identity = 165/615 (26.83%), Postives = 233/615 (37.89%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCC--GAFQVAWGDPCQRCELGRCEKGFIE-----------IDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMK-NHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK-TQCD--KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD----------------------------------------QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD-NSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
             C CKPGF     G+ C +     CF     G C   P     +K  CC     +  WG PC+ C     E GF +           ID    D+NEC +   IC +G CIN  GSFRC C   Y  +     CV   +    + N CG G  C ++ I    C C  G+     G   + +  N+        P +C F +CI     Y+C C  GY    DG+ C+   +     +        C +L   ++C C  G     D + C   + C   P  +C +G+C+      Y C C  GF P     QC                      QG   FCF    +  C+  +         +C C  G     Q + C      K  ++      ++   T  D  K    +C NGRCI +  SY+C CN+GY AS+ G  C D+DEC+++P  C+                                        Q  C+N+ G + C C  GFT H+      C D NEC    SLC   G+C+N+ GSF C+C  G+        C  V + +SN            +C   C+   G + C+CP G
Sbjct: 1934 ECVCKPGFVLSDNGRRCYDTRVSFCFTRFENGKC-SIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEH-EAGFRDLCPFGVGIIPGIDDTSVDVNECVENPGICHNGHCINTDGSFRCECPMGYTLNYTGVHCVDVDEC--AVGNPCGNGT-CTNV-IGGFECNCEEGFEP---GPMMACEDINECGQ----NPLLCAF-RCINTFGGYECSCPSGYTLREDGRMCQDLDECVEGLHDCDTRGMTCKNLIGTFMCICPPGMVRRMDDELCQDENECRTKP-GICENGRCV-NTIGSYMCECGEGFQPDPTHTQCLDY------------------RQG---FCFTEVLQTMCQMSSSSRTAITKSQCCCDGGHGWGNQCELCPLPGTAKYKKLCPHGHGYATDGTDIDECKVIPDVCKNGRCINTMGSYRCHCNSGYTASIAGTACVDLDECAMSPKPCNFICKNTEGSYACSCPRGYILQEDSRSCKDLDECQVKRHNCQFMCVNTIGGFTCKCPPGFTQHHT----ACIDHNECAAEPSLCGAKGLCQNSPGSFSCECQRGFSLDTSGLHCEDVNECDSNH-----------RCQFGCENMLGGYRCNCPQG 2496          

HSP 7 Score: 141.354 bits (355), Expect = 1.394e-33
Identity = 152/612 (24.84%), Postives = 250/612 (40.85%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL-------GRCEKGF-IEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKKCT-----SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK-------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC+C  G      G+SC +  +   C+ ++ +GVC++           CC +   ++G+PCQ C           C  G    IDG   DINEC     IC +G C N RG +RC+C+  Y+ D      V    +C     LC  G+ C ++   ++ C C  GY    D ++C  +  N+ +         C  G C  +  ++ CEC+ G      G  C  ++                 NG    +  C +L   +      C+ D      + R + T     + C+++P  +CP+G+C+      ++C+C  G      G+ C  I                      ++ C+ +Y  D+C        +    C C  G    K+ +AC E    +   +      F+ +              +C  F S +C +G C  +  S++C+CN G+    + + C+DIDEC I+P +C  G C+N+PGS++C C  G+    M     C D +EC     LC+ G CKNT GS+QC C  G+  S     C  V +          + +C+  +  C    G + CSC  G  +  +   C  + +
Sbjct:  536 RCECLAGLAVGPDGRSCVDTHMRSTCYGAIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLDSAEFNALCPSGTGYAIDGT--DINECAMDPDICPNGACENLRGGYRCICNIGYETDQSGRSYVD---ECFVNRLLCDNGL-CRNVP-GSYTCTCPKGYSYRQDSETC--EDVNECES------SPCINGLCKNNAGSFACECSPGSKVDPTGLICIDSLKGTCWLTIQEGRCEVNINGGTLRSECCATLGAAWGSPCEPCEIDPVCQRGFARPRGTICEDVNECEVFP-GVCPNGRCV-NTRGSFKCQCSEGLTLDSTGRICVDIR---------------------LEHCYLTYDEDECVQPVSGRFRMDACC-CTVGAAWGKECEACPEPGTREYEALCPRGPGFANRGDVLTGRPVYKDINECKVFPS-ICAHGTCRNTIGSFRCRCNGGFALDAEERNCTDIDECKISPDLCGHGACVNTPGSFECDCLPGYESGFMM-MKNCMDIDECERNPGLCRGGSCKNTEGSYQCVCPPGHQLSTDGDACEDVNECELS------ATLCR--NGECVNVAGTYHCSCSTGYQSTPDRKGCTDIDE 1098          

HSP 8 Score: 129.413 bits (324), Expect = 6.829e-30
Identity = 150/562 (26.69%), Postives = 232/562 (41.28%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLCGPGMDC---VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKY----------------------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA----------PMGKG--KQCRRIMSDQSE--------IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQCDKFGSF-----------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF--TIHNMPGGPKCYDRNECTETTS-LCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            C++G+ +   GI C D++EC     C +G C+N  GS+ C C + ++ +P    CV  +      E +P   G G+ C   V + +    C C  G       + C   + + Y                      D C+   P +C  G C+    +++C+C  GY  ++D + C+  +D C   N  +C  G C +   +Y C C   Y        C  +     +SLC       +  NG  C     F            MGK   K C+      +E        I P    +       DID C  +     C  G CIN    +RCEC  GF  +     C++  E  ++++      + + S  S + +C +                     LC++G+C++    Y C CNTG++A+ + K+C DIDEC   P  C  GTC N+ GSY C C  GF  T++N     +C D +EC+   S LC+NG C N+ GSFQC C+ GY  +   ++C+ V +         P          C+  +G F C CP G
Sbjct: 1370 CDEGYELNRSGINCTDVDECLDPINCVNGHCVNTPGSYECNCPTDFELNPTGIGCVDPRVGFCFLEAVPRGRG-GLACSVEVGVGVSRSSCCCSLGRAWGNPCEGCPPVNTSDYNTLCPGGEGFRPNPITIILEDIDECQEL-PGLCQGGNCVNTFGSFQCDCPGGYYLNADSRICED-IDECV-VNPGICGPGTCYNTLGNYTCVCPQEYMQVNGGNNCMDM----RKSLC------FRNYNGTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETGKPVDIDEC--NEIPGICASGVCINQIGSFRCECPRGFSYNDVLLICEDIDECSSSEILCQRNADCINSPGSYRCECSEGFKLSPIGACIDRNECLENPNLCSHGKCVDMPGGYICTCNTGFKATPNRKMCMDIDECVRQP--CKNGTCKNTVGSYNCLCNAGFELTLNN-----QCTDVDECSGPYSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNCIDVNECLILPGTCAPGT--------CQNLDGSFRCLCPKG 1900          

HSP 9 Score: 121.324 bits (303), Expect = 2.059e-27
Identity = 118/426 (27.70%), Postives = 191/426 (44.84%), Query Frame = 3
Query:  702 IEIDG-ICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSL---SIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI---------MSDQSEIGPTSSNEDSKSSQG---------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
            +  DG  C+D+NEC+ S  +C++G+C+N  G++ C CS+ YQ  P        +K C  I         C  L   S  ++ C C   Y    D +SC+     + +      P +C  G+C      Y C C  G+ +S   KSC   V+ C   N  +C  G+C +    +IC C+ GY+       CT I  C +   +   +  C+  P + + C C+ G+  +G G +C  +          S   E   T  +     ++G         DID C  S +   C+ G C+N+   Y+CEC  GF+ D   + C++ ++  T Q+                   +C  G C     +++C C+ GY+ +  G  C+D+DEC ++P  C  G C+N+PGSY+C+C   F ++  P G  C D
Sbjct: 1044 LSTDGDACEDVNECELSATLCRNGECVNVAGTYHCSCSTGYQSTP-------DRKGCTDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSCTDVDECEEE------PDICDGGQCTNVPGEYHCLCYDGFTSSMTTKSCID-VNEC-ELNSNICMFGECENTKGSFICHCEVGYSVKKGSSGCTDIDECQIDAHNCDRNANCVNIPGS-FSCTCMEGW--IGNGVKCDDVDECIRGTHQCSPDGECVNTPGSFRCACTEGYKGDGFTCSDIDECADSTH--MCENGQCLNIPGSYQCECEIGFISDPDSRTCQD-IDECTFQV-------------------ICVFGLCENLPGAFRCVCDEGYELNRSGINCTDVDEC-LDPINCVNGHCVNTPGSYECNCPTDFELN--PTGIGCVD 1426          

HSP 10 Score: 98.2117 bits (243), Expect = 2.376e-20
Identity = 55/114 (48.25%), Postives = 75/114 (65.79%), Query Frame = 3
Query: 1674 LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKK 2015
            LC NGRCI  GSS++C+CN G++    G+ CSDIDEC  +P  C  G C+N+ GS+ C C  GF  H  PG   C+D +ECT +T++C NG+C N  GSF+C C  G+  ++KK
Sbjct:  391 LCLNGRCILVGSSHRCECNAGFRVDSLGE-CSDIDECVSDP--CTNGDCVNTAGSFYCKCHTGF--HRPPGKQACFDHDECT-STNMCLNGMCINEEGSFKCVCKHGFTLASKK 498          

HSP 11 Score: 94.3597 bits (233), Expect = 3.893e-19
Identity = 81/252 (32.14%), Postives = 111/252 (44.05%), Query Frame = 3
Query:  309 TIPICVNRCGRNGACVRPNTCQCSNGMIASSCD-----------------EED-----QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC 980
            TI IC N CG +G C RPN C C+ G IASSC                  EED     +             +   N G      RC C  GFTG  C  +   G CF  +   +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C+ G C+N  GS+ C C + ++ + V   C +   +C  + ++C  G    + S+ +  C C  GYV S D   C
Sbjct:   22 TIAICRNSCG-DGFCSRPNMCTCTTGQIASSCTVKSTQQCSIRCMNGGLCEEDHCQCQKGYTGTYCGQPVCEKKCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFSQVVNQMCQGQVSGIVCTKTLCCATIGRAWGHPCEECPAQPQPCRRGFIPNIRTGACQDVDECQAVPGLCQGGNCVNTVGSYECKCPAGHRLNEVTNKC-EDVDECSTVQHVCEGGQ--CTNSVGSFSCVCPSGYVLSADKTRC 269          

HSP 12 Score: 88.9669 bits (219), Expect = 1.887e-17
Identity = 140/579 (24.18%), Postives = 220/579 (38.00%), Query Frame = 3
Query:  684 RCEKGFIEIDGI--CQDINECQW-SQIC-KSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGF---------------------APMGKGK------------------QCRRIMSDQSEIGPTSSNEDSKS----SQG-----------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDEC-----------------SINPSIC----DQGTCINSP---------GSYQCSC---FDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
             CE G+    G   C DI+ECQ  +  C ++  C+N  GSF C C   +  + V+ D V    +C +  + C P  +CV+ +  +  C C  GY    DG +CS       D C     ++C  G+C+    +Y+CEC  G+I+  D ++C+  +D CT    V+C  G C +L   + C CD GY  +     CT + +      C +G C+  P + YEC C   F                      P G+G                      R   +  E  P  +  D  +     +G           DID C        C+GG C+N    ++C+C  G+ L+   + C++  E   N                     +C  G C  +  +Y C C   Y     G  C D+ +                  +I   IC    + G   N P           ++  C     GF I    G P   D +EC E   +C +G+C N  GSF+C+C  G+  ++    C  + + S+ +       +C++ +  C  S G + C C  G 
Sbjct: 1204 HCEVGYSVKKGSSGCTDIDECQIDAHNCDRNANCVNIPGSFSCTCMEGWIGNGVKCDDVD---ECIRGTHQCSPDGECVN-TPGSFRCACTEGYKG--DGFTCSD-----IDECA-DSTHMCENGQCLNIPGSYQCECEIGFISDPDSRTCQD-IDECTFQ--VICVFGLCENLPGAFRCVCDEGYELNRSGINCTDVDECLDPINCVNGHCVNTPGS-YECNCPTDFELNPTGIGCVDPRVGFCFLEAVPRGRGGLACSVEVGVGVSRSSCCCSLGRAWGNPCEGCPPVNTSDYNTLCPGGEGFRPNPITIILEDIDEC--QELPGLCQGGNCVNTFGSFQCDCPGGYYLNADSRICEDIDECVVN-------------------PGICGPGTCYNTLGNYTCVCPQEYMQVNGGNNCMDMRKSLCFRNYNGTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETGKP--VDIDECNEIPGICASGVCINQIGSFRCECPRGFSYNDVLLICEDIDECSSSEI------LCQR-NADCINSPGSYRCECSEGF 1736          

HSP 13 Score: 88.1965 bits (217), Expect = 2.909e-17
Identity = 115/457 (25.16%), Postives = 176/457 (38.51%), Query Frame = 3
Query:  684 RCEKGFIEIDG--ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQ-----------------IPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ-------SANKYDMC-RFYGPYVCHFGKCIADG------------------YNYKCECNQGY-IASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE---YKTNQMNDVASSF---SLKTQCDKFGSFLCNNGRCIESGSSY--QCQ-------CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            +C  GF    G   C D +EC  + +C +G CINE GSF+C+C   +             KKC +                  P +C  G  C++    ++ C+CL G     DG+SC           A K  +C R +   V     C A                    +N  C    GY I  +D   C    D        +CPNG C +L   Y C C+ GY +    +     C    R LC +G C   P + Y C C  G+                      S  +DS++ + D++ C  S     C  G C N    + CEC PG  +D  G  C + ++   + T Q      +    +L+++C            C   G+++   C+       C  G+ A   G +C D++EC + P +C  G C+N+ GS++C C +G T+
Sbjct:  446 KCHTGFHRPPGKQACFDHDECTSTNMCLNGMCINEEGSFKCVCKHGFTL---------ASKKCFECYMSAIWLFFVYIDECLTPGICLHGR-CINTE-GSYRCECLAGLAVGPDGRSCVDTHMRSTCYGAIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLDSAEFNALCPSGTGYAIDGTDINECAMDPD--------ICPNGACENLRGGYRCICNIGYETDQSGRSYVDEC-FVNRLLCDNGLCRNVPGS-YTCTCPKGY----------------------SYRQDSETCE-DVNECESS----PCINGLCKNNAGSFACECSPGSKVDPTGLICIDSLKGTCWLTIQEGRCEVNINGGTLRSEC------------CATLGAAWGSPCEPCEIDPVCQRGF-ARPRGTICEDVNECEVFPGVCPNGRCVNTRGSFKCQCSEGLTL 841          

HSP 14 Score: 85.5001 bits (210), Expect = 2.138e-16
Identity = 112/412 (27.18%), Postives = 176/412 (42.72%), Query Frame = 3
Query:  723 QDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGY-IASSDGKSCKKT--------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCIPQPNNGYECR--CLPGFAPMGKGKQCRRIMS-DQSEIGPTSSNEDSKSSQG-DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
            + IN+C     +C +G+CI    S RC C++ ++ D +  +C       E + + C  G DCV+ +  +  CKC  G+ +        KQ+   +D C      +C  G CI +  ++KC C  G+ +AS     C  +        +D C      +C +G+C++    Y C+C +G     D + C    D + RS C      G C+ +P      R  C    A    G+ C+   + D +E      +    +  G DI+ C  +   D C  GAC N++  YRC C  G+  D+ G++  +  E   N++                   LC+NG C     SY C C  GY    D + C D++EC  +P  C  G C N+ GS+ C C  G  +   P G  C D
Sbjct:  380 ETINKCLLIPNLCLNGRCILVGSSHRCECNAGFRVDSL-GECSDID---ECVSDPCTNG-DCVN-TAGSFYCKCHTGFHRPP-----GKQACFDHDECTSTN--MCLNGMCINEEGSFKCVCKHGFTLASKKCFECYMSAIWLFFVYIDECLTPG--ICLHGRCINTEGSYRCECLAGLAVGPDGRSCV---DTHMRSTCYGAIKKGVCV-RPFQAAVTRSACCCASASYSFGEPCQPCPTLDSAEFNALCPSGTGYAIDGTDINEC--AMDPDICPNGACENLRGGYRCICNIGYETDQSGRSYVD--ECFVNRL-------------------LCDNGLCRNVPGSYTCTCPKGYSYRQDSETCEDVNECESSP--CINGLCKNNAGSFACECSPGSKVD--PTGLICID 745          

HSP 15 Score: 75.8702 bits (185), Expect = 1.872e-13
Identity = 58/196 (29.59%), Postives = 90/196 (45.92%), Query Frame = 3
Query: 1494 CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD------------RNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNS 2045
            C  G CI + + +RCEC  GF +D  G+                       +  D+  S  C NG C+ +  S+ C+C+TG+      + C D DEC+ + ++C  G CIN  GS++C C  GFT+ +     KC++             +EC  T  +C +G C NT GS++C+C +G       + CV     S
Sbjct:  392 CLNGRCILVGSSHRCECNAGFRVDSLGEC----------------------SDIDECVSDPCTNGDCVNTAGSFYCKCHTGFHRPPGKQACFDHDECT-STNMCLNGMCINEEGSFKCVCKHGFTLASK----KCFECYMSAIWLFFVYIDECL-TPGICLHGRCINTEGSYRCECLAGLAVGPDGRSCVDTHMRS 559          

HSP 16 Score: 74.3294 bits (181), Expect = 5.978e-13
Identity = 38/100 (38.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query: 1725 CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
            C  G+  ++    C D+DEC   P +C  G C+N+ GSY+C C  G  ++ +    KC D +EC+    +C+ G C N+ GSF C C SGY+ S  K  C
Sbjct:  172 CRRGFIPNIRTGACQDVDECQAVPGLCQGGNCVNTVGSYECKCPAGHRLNEVTN--KCEDVDECSTVQHVCEGGQCTNSVGSFSCVCPSGYVLSADKTRC 269          

HSP 17 Score: 65.855 bits (159), Expect = 1.944e-10
Identity = 95/379 (25.07%), Postives = 144/379 (37.99%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVC-MKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-------RCEKGF-IEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYI----ASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFY--SYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQ 1577
            C+C  GF    T   C +   G CF  + + +C M       ++K  CC      WG+ C+ C L         C  G     DG   DI+EC+    +CK+G+CIN  GS+RC C+S Y        CV   + C   P  C     C +    ++ C C  GY+   D +SC        D C+    + C F  C+     + C+C  G+     A  D   C      C          G C +    + C+C  G++       C  + +      C  G        GY C C  G+    +  QC  +  ++     T  +    ++ G    C Y  + +++ C  G C N +  Y C C PG+    QG 
Sbjct: 2217 CECGEGFQPDPTHTQCLDYRQGFCFTEVLQTMCQMSSSSRTAITKSQCCCDGGHGWGNQCELCPLPGTAKYKKLCPHGHGYATDGT--DIDECKVIPDVCKNGRCINTMGSYRCHCNSGYTASIAGTACVDLDE-CAMSPKPCN--FICKNTE-GSYACSCPRGYILQEDSRSCKD-----LDECQVK-RHNCQF-MCVNTIGGFTCKCPPGFTQHHTACIDHNECAAEPSLCGA-------KGLCQNSPGSFSCECQRGFSLDTSGLHCEDVNECDSNHRCQFG--CENMLGGYRCNCPQGYTQHYQWNQC--VDENECSTPGTCGSASCYNTLGSFK-CAYECTSFKNPCNYG-CSNTQGGYLCGCPPGYYRVGQGH 2569          

HSP 18 Score: 56.9954 bits (136), Expect = 9.207e-8
Identity = 74/268 (27.61%), Postives = 106/268 (39.55%), Query Frame = 3
Query: 1077 CECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV--EYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C C  G IASS      K+   C+    + C NG    L  +  CQC  GYT +Y  +  C   C    R + P+            C C+ GF     G QC R        GP  S   ++  QG +     +  +  C   A I     + CE  P      Q Q C+       +T    DV    ++          LC  G C+ +  SY+C+C  G++ +     C D+DECS    +C+ G C NS GS+ C C  G+ +
Sbjct:   41 CTCTTGQIASS---CTVKSTQQCS----IRCMNG---GLCEEDHCQCQKGYTGTYCGQPVCEKKCQNGGRCIGPN-----------RCACVYGFT----GPQCER----DYRTGPCFSQVVNQMCQGQVSGIVCT--KTLCC--ATIGRAWGHPCEECPA-----QPQPCRRGFIPNIRTGACQDVDECQAVPG--------LCQGGNCVNTVGSYECKCPAGHRLNEVTNKCEDVDECSTVQHVCEGGQCTNSVGSFSCVCPSGYVL 262          

HSP 19 Score: 51.6026 bits (122), Expect = 4.139e-6
Identity = 31/84 (36.90%), Postives = 48/84 (57.14%), Query Frame = 3
Query: 1773 IDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
            I++C + P++C  G CI    S++C C  GF + ++    +C D +EC   +  C NG C NT GSF C+C++G+     KQ C
Sbjct:  382 INKCLLIPNLCLNGRCILVGSSHRCECNAGFRVDSLG---ECSDIDECV--SDPCTNGDCVNTAGSFYCKCHTGFHRPPGKQAC 460          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Cavefish
Match: fbn2b (fibrillin 2b [Source:ZFIN;Acc:ZDB-GENE-090112-3])

HSP 1 Score: 182.956 bits (463), Expect = 9.341e-47
Identity = 162/538 (30.11%), Postives = 236/538 (43.87%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDG-ICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEY-------KTNQMNDVASSF------SLKTQCDKFGSF------LCNNG---RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF-TIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            T   C + + G C+L++    C  +  G  L  E CC     AWG PC+RCE+   C +G   + G IC+DINEC+ +  +C +G C+N  GSFRC C+     D     CV  R + C  +   + CG  +          +C C  G    L+ +SC K    +Y         +C  G   A         N+G I +  G+   K V+ C  + G+ C +G C +    + C+C++G+  + + + CT I  C + P  LC  G C+  P + +EC C  G+ +     K C  I  D+ E  P                         C+GG C+N +  Y CEC  G  L   G +C++  E        +  Q  ++  S+        +   D+ G        + N G    C  S  SY+C C+ GY    D + C+DIDEC   P ICD G C N PG Y+C CFDGF +  +M     C D NEC    ++C +G C+NT GSF C C  GY        C  V +
Sbjct:  773 TNTVCVDSMKGTCWLNIQDNRCEVNINGATLKSE-CCSTLGAAWGSPCERCEVDTACPRGLARMKGLICEDINECEVFPGVCSNGVCVNTHGSFRCECAEGLTLDEGGRTCVDVRSEHCYMKWDEDECGEPL---PGRYRVDMCCCSVGAAWGLECESCPKPGTPEYRT-------ICPRGPGFA---------NRGDILT--GRPFYKDVNECKVFKGL-CTHGTCRNTIGSFKCRCNNGFALTMEERNCTDIDECAISP-DLCGQGTCVNTPGS-FECECFEGYESGFMMMKNCMDI--DECERDPL-----------------------LCRGGTCLNTEGSYECECPRGHQLSPGGSSCEDVNECELSDNLCRNGQCVNMVGSYQCSCDTGYQVTPDRQGCVDIDECTIMNGGCDTHCTNSEGSYECSCSEGYALMPDLRTCADIDECEDTPDICDGGQCTNIPGEYRCLCFDGFMSTMDM---RTCEDVNECDLNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDE 1257          

HSP 2 Score: 179.104 bits (453), Expect = 1.746e-45
Identity = 171/623 (27.45%), Postives = 267/623 (42.86%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLCN-----------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            RC+C  G T    G++C ++ +  C++      C   P   +   ++CC +   AWG  C+ C     + G  E   IC                   +D+NEC+ +  +C  G C N  GSF+C C++ +     + +C     +C   P+LCG G  CV+ +  +  C+C  GY    +  K+C      + D      P +C  G C+    +Y+CEC +G+  S  G SC+  V+ C   + + C NG+CV++   Y C CD+GY  + DR+ C  I +    +   D  C       YEC C  G+A M   + C  I  D+ E  P                       D C GG C N+   YRC C  GF+     + C++  E       D+  +  L   C+   GSF+C+                             +  C+    S++C+C  G+    DG  C D+DECS     C+    C+N+PGSY+C+C +GF       G  C D +EC E  +LC+NG C NT G ++C+C  G+  +   + C  + + + Q        IC   S  C+   G+F C C +G +     G C  V++  D
Sbjct:  866 RCECAEGLTLDEGGRTCVDVRSEHCYMKWDEDEC-GEPLPGRYRVDMCCCSVGAAWGLECESCP----KPGTPEYRTICPRGPGFANRGDILTGRPFYKDVNECKVFKGLCTHGTCRNTIGSFKCRCNNGFALTMEERNCTD-IDECAISPDLCGQGT-CVN-TPGSFECECFEGYESGFMMMKNCMDIDECERD------PLLCRGGTCLNTEGSYECECPRGHQLSPGGSSCED-VNECELSDNL-CRNGQCVNMVGSYQCSCDTGYQVTPDRQGCVDIDECTIMNGGCDTHCT-NSEGSYECSCSEGYALMPDLRTCADI--DECEDTP-----------------------DICDGGQCTNIPGEYRCLCFDGFMSTMDMRTCEDVNEC------DLNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGAHNCDMHAACVNVPGSFKCRCRDGWVG--DGIKCVDLDECSTEEHSCNPNANCVNTPGSYRCACKEGFNGD----GFSCSDMDECAENVNLCENGQCLNTPGGYRCECEMGFTPTEDTKACQDIDECNFQ-------NICVFGS--CQNLPGMFRCVCDDGYELDRSGGNCTDVNECAD 1425          

HSP 3 Score: 172.555 bits (436), Expect = 2.065e-43
Identity = 183/656 (27.90%), Postives = 261/656 (39.79%), Query Frame = 3
Query:  192 FGLFFAHLQTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXXXXXXXXXX-------------------XRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGM----DCVSLSIYNHLCKCLPGYVKSLDGKSCSKQS--------ANKYDMCRFYGPY-----VCHFGKCIADGYNYKCECNQGYIASSDGKSC----------------------KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTY 1964
            F  FF +        ++CG   +S+ CC G++    G+ C +PIC N CG +G C RPN C CS+G +A SC     S    +    N+    C  G T  +                    RC C  GFTG  C  +   G CF  ++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +C  G CIN  GS+ C C + ++         +  +KCE I     PG+    +C + +  +++C C  GYV S DG  C  Q         AN        G +      C  G+C A G+  +  C          K+C                        T+D C  +   +C NG+C+  +  Y C+C+ GY     R +C  + D    + C +G C+      Y C+C  G+      + C                        DID C  +     C+ G C+N    ++C C  GF L   G+ C +  E  T  M                    C NG CI    S++C C  G+  + +G+ C+DIDEC   P IC  G CINS GS+ C C  G  I     G  C D +  T      K G C   +
Sbjct:   20 FACFFCY------RPNVCGSRFHSY-CCPGWKTLPGGNQCIVPICRNTCG-DGFCSRPNMCTCSSGHLAPSCGAASCSVRCMNGGACNDDSCVCQKGYTGNHCGQPVCESGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEVCPAQPHPCRRGFIPNIRSGACQDVDECQAIPGLCAGGNCINTVGSYECKCPAGHRQS-------ETNQKCEDIDECALPGLCDGGECTN-TAGSYVCTCPRGYVSSADGSRCIDQRIGTCFSALANGRCAAELTGQFSKMQCCCDLGRCWALGHIPE-MCPVRGSGELFAKACDSPQSYASSPSPSPYPPELLLLHSTIDVCKHFTN-LCLNGRCIPTTASYRCECNMGYRQDM-RGECIDV-DECISNPCVNGDCV-NTQGSYHCKCHEGYQGTATKQACI-----------------------DIDECIVNGV--MCRNGRCVNTDGSFQCICNAGFDLSPDGKNCIDHDECATTNM--------------------CLNGMCINEDGSFKCICKQGFALAPNGRYCTDIDECQT-PGICMNGRCINSEGSFHCECPPGLAID--VDGRVCVDTHMRTTCYGAIKMGTCSRPF 606          

HSP 4 Score: 149.058 bits (375), Expect = 4.524e-36
Identity = 166/578 (28.72%), Postives = 242/578 (41.87%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSC--SEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCELGRCEKGFIEI------------DGICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGAC-INMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK----TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            +C C+PGF     G+ C     V+  CF     G C   P  L  +K  CC +      WGDPC+ C     E GF  +            DG  +D+NEC  +  IC +G CIN  GSFRC C   Y  D    +CV   +    I N CG G  C ++ +    C C  G+     G   + +  N+  +     P +C F +C+    +Y+C C  GY+   D + C+   +     +        C +L   ++C C  G T   D + C  +  C   P  LC +G+C+      Y C C  GF P   G +C                    + QG   FCF    +  C+ G+   N      C C  G     Q + C      +  +M  +   ++       +C+   + LC NG+CI S  S++C CN GY     G  C D+DECS +P  C+   C N+ GSY CSC  G+ +   P G  C D +EC+     C+  +C NT G F C+C SG+  +  +  C+   + +NQ     PS    + S  C  + G F C C  G 
Sbjct: 1931 QCICQPGFVLSDNGRRCFGKFTVDIFCFTRFEAGKC-SVPKALNTTKAKCCCSKMPGEGWGDPCELCPREN-EAGFNALCPYGHGTLPGPGDGR-EDMNECLDNPGICVNGMCINTDGSFRCECPFGYNLDYTGVNCVDTDEC--SIGNPCGNGT-CTNV-VGGFECSCQEGFEP---GPMMTCEDINECSL----NPLLCAF-RCVNTFGSYECMCPAGYVLRDDQRMCRDQDECTEGLDDCASRGMACKNLIGTFMCICPPGMTRRPDGEGCMDLNECRTKP-GLCKNGRCV-NTVGSYRCECSEGFEPSATGTEC------------------IDNRQG---FCFTEVLQTMCQQGSTNRNSVTKSECCCNGGRGWGPQCELCPLPGTVQYKKMCPLGPGYTTDGRDINECEVLPN-LCKNGQCINSVGSFRCHCNVGYTNDFSGTSCIDLDECSQSPKPCNF-LCKNTEGSYLCSCPRGYILQ--PDGKTCKDLDECSTKQHNCQF-LCVNTIGGFTCKCPSGF--TQHQTACIDNNECTNQ-----PSVCGSRAS--CLNTPGSFNCECQKGF 2456          

HSP 5 Score: 147.902 bits (372), Expect = 1.255e-35
Identity = 165/674 (24.48%), Postives = 255/674 (37.83%), Query Frame = 3
Query:  687 CEKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLD----------GKSC----SKQSANKYDMCR---------------FYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGF---------APMGKGKQCRRIMSDQSEI---GPTSSNE------------------DSKSSQG----------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-RVEYKTNQMND-------------------VASSFSL-------------KTQCDKFGSF------------------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------------PGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDV 2201
            C++GF +  +G  C DI+ECQ   IC +G+CIN  GSF C C      D     CV    +             C          +  PG V   +          G+ C    ++ SA    +C                   P +C  G C     +Y+C CN GY + S GK+C   ++ C   N ++C NG C +    + C C  G+    D + C  I +    S C +G C     + + C C  G              KG     I  ++ E+   G T  +E                  D+   +G          DI+ C    +   C  G C+N    +RCEC  G  LD+ G+ C + R E+   + ++                   V +++ L             +T C +   F                        LC +G C  +  S++C+CN G+  +++ + C+DIDEC+I+P +C QGTC+N+PGS++C CF+G+    M                                         PGG  C D NEC  + +LC+NG C N  GS+QC C++GY  +  +Q CV +          E + +   C  +C  S G + CSC  G   + +   CA + +  D 
Sbjct:  530 CKQGFALAPNGRYCTDIDECQTPGICMNGRCINSEGSFHCECPPGLAIDVDGRVCVDTHMR-----------TTCYGAIKMGTCSRPFPGAVTKSECCCANPEHGFGQPCQPCPARNSAEFQAVCSSGIGITTDGRDINECALDPEICQNGMCENLLGSYRCICNIGYESDSSGKNCVD-INECL-VNRLLCDNGLCRNTPGSFTCSCPKGFVFKADSETCEDI-NECESSPCVNGICRNLAGS-FTCECSHGSKLDSTNTVCVDSMKGTCWLNIQDNRCEVNINGATLKSECCSTLGAAWGSPCERCEVDTACPRGLARMKGLICEDINEC--EVFPGVCSNGVCVNTHGSFRCECAEGLTLDEGGRTCVDVRSEHCYMKWDEDECGEPLPGRYRVDMCCCSVGAAWGLECESCPKPGTPEYRTICPRGPGFANRGDILTGRPFYKDVNECKVFKGLCTHGTCRNTIGSFKCRCNNGFALTMEERNCTDIDECAISPDLCGQGTCVNTPGSFECECFEGYESGFMMMKNCMDIDECERDPLLCRGGTCLNTEGSYECECPRGHQLSPGGSSCEDVNECELSDNLCRNGQCVNMVGSYQCSCDTGYQVTPDRQGCVDID---------ECTIMNGGCDTHCTNSEGSYECSCSEGYALMPDLRTCADIDECEDT 1177          

HSP 6 Score: 142.51 bits (358), Expect = 5.133e-34
Identity = 151/548 (27.55%), Postives = 228/548 (41.61%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFL-SLSRG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE---------LGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSA-----NKYDMCRFYGPY-----VCHFGKCIADGYNYKCEC--------------NQGYIASSDGKSCKKT-VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS------YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
            TG  C +   G CFL +L RG   +      G+ +++  CC +   AWG+PC+ C          L    +GF    I  I +DI+ECQ    +C+ G C+N  GSF+C C + Y  +     C +   +C     +CGPG      ++ N+ C C P Y++   G +C          N  D C     +     +C     +   +N  CE               NQ      D  + K   +D C    G+ C NG C++    + C+C  G++ +       D  +C S  +L  R    +  CI  P + Y C C PGF                 ++ P+ +  D    +   + C +         G CI+M+  YRC C  GF        C            DV    +L  Q       +C +G+CI S  S+QC C  GY+ + D K C+D++EC   P  C  GTC N  GS++C C  G+ + N       Y  N+C    ++C+ G C NT GSFQC C  G++ S+  + C
Sbjct: 1454 TGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPPVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRIC-EDIDECTAHIGICGPGT--CYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNKPCEACPTPATSEYQLLCGNQAPGFIIDIHTGKPIDIDECREIPGI-CANGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQR----NANCINIPGS-YRCECSPGF-----------------KLSPSGACVDRNECKEKPNVCSH---------GDCIDMQGSYRCLCHNGFKATADQTMCM-----------DVDECTTLSGQ-------VCRHGQCINSLGSFQCLCQEGYELTPDNKNCADVNECVTFPGTCSPGTCQNLVGSFRCICPPGYAVQNDQLTCVVY-INDCEVEPNICQFGTCINTPGSFQCICQPGFVLSDNGRRC 1947          

HSP 7 Score: 136.732 bits (343), Expect = 3.930e-32
Identity = 154/541 (28.47%), Postives = 214/541 (39.56%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEI--DGICQDINECQW--SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC--KKTVD-FC-TRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQ----------CD-----KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            RC+C PGF         +G C   + R  C + P    +     C   Q ++     RC    C  GF       +C D++EC     Q+C+ G+CIN  GSF+CLC   Y+  P   +C     +C   P  C PG  C +L + +  C C PGY    D  +C        + C    P +C FG CI    +++C C  G++ S +G+ C  K TVD FC TR+    C   K ++ +    C       S    +     C+L PR          +   G+   C     P G G          +  GP    ED      +   C           G CIN    +RCEC  G+ LD  G  C +  E             +V   F    Q          C+          LC   RC+ +  SY+C C  GY    D ++C D DEC+     C      C N  G++ C C  G T    P G  C D NEC     LCKNG C NT GS++C+C+ G+  S    +C+
Sbjct: 1762 RCECSPGFKLSP-----SGAC---VDRNECKEKP---NVCSHGDCIDMQGSY-----RC---LCHNGFKATADQTMCMDVDECTTLSGQVCRHGQCINSLGSFQCLCQEGYELTPDNKNCAD-VNECVTFPGTCSPGT-CQNL-VGSFRCICPPGYAVQNDQLTC----VVYINDCEVE-PNICQFGTCINTPGSFQCICQPGFVLSDNGRRCFGKFTVDIFCFTRFEAGKCSVPKALNTTKAKCC------CSKMPGEGWGDPCELCPR----------ENEAGFNALC-----PYGHG----------TLPGPGDGREDMNECLDNPGICV---------NGMCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCTNVVGGFECSCQEGFEPGPMMTCEDINECSLNPLLCAF-RCVNTFGSYECMCPAGYVLRDDQRMCRDQDECTEGLDDCASRGMACKNLIGTFMCICPPGMT--RRPDGEGCMDLNECRTKPGLCKNGRCVNTVGSYRCECSEGFEPSATGTECI 2232          

HSP 8 Score: 130.183 bits (326), Expect = 4.120e-30
Identity = 123/433 (28.41%), Postives = 187/433 (43.19%), Query Frame = 3
Query:  939 CLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY---ECRC----------LPGFAPM-GKG----KQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            C  G++ ++   +C        D C+   P +C  G CI    +Y+C+C  G+  S   + C+  +D C      +C  G+C + +  Y+C C  GY SS D  +C         S   +G+C  +    +   +C C          +P   P+ G G    K C    S  S   P+    +       ID C   ++ + C  G CI     YRCEC  G+  D +G+ C +  E  +N                      C NG C+ +  SY C+C+ GYQ +   + C DIDEC +N  +C  G C+N+ GS+QC C  GF +   P G  C D +EC  TT++C NG+C N  GSF+C C  G+  +   + C  +        + +   IC   +  C  S G F C CP GL   ++  +C   
Sbjct:  200 CRRGFIPNIRSGACQD-----VDECQAI-PGLCAGGNCINTVGSYECKCPAGHRQSETNQKCED-IDECALPG--LCDGGECTNTAGSYVCTCPRGYVSSADGSRCIDQRIGTCFSALANGRCAAELTGQFSKMQCCCDLGRCWALGHIPEMCPVRGSGELFAKACDSPQSYASSPSPSPYPPELLLLHSTIDVC--KHFTNLCLNGRCIPTTASYRCECNMGYRQDMRGE-CIDVDECISNP---------------------CVNGDCVNTQGSYHCKCHEGYQGTATKQACIDIDECIVNGVMCRNGRCVNTDGSFQCICNAGFDLS--PDGKNCIDHDECA-TTNMCLNGMCINEDGSFKCICKQGFALAPNGRYCTDID-------ECQTPGICM--NGRCINSEGSFHCECPPGLAIDVDGRVCVDT 587          

HSP 9 Score: 121.709 bits (304), Expect = 1.438e-27
Identity = 161/622 (25.88%), Postives = 249/622 (40.03%), Query Frame = 3
Query:  498 RCQCKPGFTGK--SCSEIVNGECFLSLS---RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGI--CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPG---------------------------YVKSLD----GKSCSKQSANKYDM----CRFYGPY--VCHFGKCI-ADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPR-SLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSD--QSEIGPTSSNEDSKSSQGDIDFCFYSY---YRDQCKGGAC-INMKNHYRCEC---LPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
            RC CK GF G   SCS++   EC  +++    G C+  P G                     RCE   CE GF   +    CQDI+EC +  IC  G C N  G FRC+C   Y+ D    +C           N C   ++C+     N LC  +PG                           ++ +LD    G SCS +           C   G +   C     + +  Y   C   +G+  +       + +D C    G+ C  G CV+    + C+C +GY  + + + C  I +      +C  G C     N Y C C P +  +  G  C  +           T  NE S +    +  C Y+    +   C+  AC     + Y+  C    PGF++D             T +  D+     +          +C NG CI    S++C+C  G+  +    +C DIDEC+   ++C +   CIN PGSY+C C  GF +   P G  C DRNEC E  ++C +G C +  GS++C C++G+ ++  +  C+ V + +     T   ++C+     C  S G F C C  G +   +   CA V++ V
Sbjct: 1320 RCACKEGFNGDGFSCSDM--DECAENVNLCENGQCLNTPGGY--------------------RCE---CEMGFTPTEDTKACQDIDECNFQNICVFGSCQNLPGMFRCVCDDGYELDRSGGNCTDV--------NECADPVNCI-----NGLCVNMPGSYLCNCPADFELNPTGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPPVNSTEYKTLCPGGEGFRPNPI-TVILEDIDECQELPGL-CQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGICGPGTCYNTLGN-YTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNKPCE--ACPTPATSEYQLLCGNQAPGFIID-----------IHTGKPIDIDECREIPG--------ICANGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQRNANCINIPGSYRCECSPGFKLS--PSG-ACVDRNECKEKPNVCSHGDCIDMQGSYRCLCHNGFKATADQTMCMDVDECT-----TLSGQVCRH--GQCINSLGSFQCLCQEGYELTPDNKNCADVNECV 1869          

HSP 10 Score: 109.383 bits (272), Expect = 8.752e-24
Identity = 127/515 (24.66%), Postives = 209/515 (40.58%), Query Frame = 3
Query:  720 CQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKT----------QCDKFGS-----------FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDID----------------ECSINPSI--------CDQGTCINSP---------GSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C+D+NEC+ S  +C++G+C+N  GS++C C + YQ  P +  CV    +C  +   C     C + S  ++ C C  GY    D ++C+       D C    P +C  G+C      Y+C C  G++++ D ++C+  V+ C   N  +C +G C +    +IC C  GY        CT +  C++   +      C+  P + ++CRC  G+  +G G +C  +    +E    + N +  ++ G                  D+D C  +   + C+ G C+N    YRCEC  GF   +  +AC++  E     +    S  +L            + D+ G              C NG C+    SY C C   ++ +  G  C D                   CS    +        C  G    +P           Y+  C  G      P      D +EC E   LC+ G C NT+GSFQC+C +GY  + + + C  + +
Sbjct: 1085 CEDVNECELSDNLCRNGQCVNMVGSYQCSCDTGYQVTPDRQGCVD-IDECTIMNGGCD--THCTN-SEGSYECSCSEGYALMPDLRTCAD-----IDECEDT-PDICDGGQCTNIPGEYRCLCFDGFMSTMDMRTCED-VNECD-LNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGAHNCDMHAACVNVPGS-FKCRCRDGW--VGDGIKCVDLDECSTEEHSCNPNANCVNTPGSYRCACKEGFNGDGFSCSDMDECAENV--NLCENGQCLNTPGGYRCECEMGFTPTEDTKACQDIDECNFQNICVFGSCQNLPGMFRCVCDDGYELDRSGGNCTDVNECADPVNCINGLCVNMPGSYLCNCPADFELNPTGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPPVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDE 1582          

HSP 11 Score: 106.301 bits (264), Expect = 8.954e-23
Identity = 111/414 (26.81%), Postives = 173/414 (41.79%), Query Frame = 3
Query:  684 RCEKGFIEIDGI--CQDINECQW-SQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQC---KGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
             C+ G+    G   C D++EC+  +  C     C+N  GSF+C C   +  D ++  CV   + C    + C P  +CV+ +  ++ C C  G+  + DG SCS       ++       +C  G+C+     Y+CEC  G+  + D K+C+  +D C   N  +C  G C +L   + C CD GY        CT + +      C +G C+  P + Y C C   F     G  C         +      +   S   +I        R  C    GGA  N      CE  P     +    C     ++ N +  +        +C +    LC  G C+ +  S+QC+C  GY  + + ++C DIDEC+ +  IC  GTC N+ G+Y C C   +   N  GG  C D
Sbjct: 1238 HCQLGYFVKKGSTGCTDVDECEIGAHNCDMHAACVNVPGSFKCRCRDGWVGDGIK--CVDLDE-CSTEEHSCNPNANCVN-TPGSYRCACKEGF--NGDGFSCSDMDECAENV------NLCENGQCLNTPGGYRCECEMGFTPTEDTKACQD-IDECNFQN--ICVFGSCQNLPGMFRCVCDDGYELDRSGGNCTDVNECADPVNCINGLCVNMPGS-YLCNCPADFELNPTGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGV---GVTRASCCCSLGGAWGN-----PCELCPPVNSTEYKTLCPGGEGFRPNPITVILEDID---ECQELPG-LCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGICGPGTCYNTLGNYTCVCPPEYMQVN--GGNNCMD 1621          

HSP 12 Score: 101.293 bits (251), Expect = 3.035e-21
Identity = 119/463 (25.70%), Postives = 179/463 (38.66%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLC---------------------GPGMDCVSLSI-----YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQ 2018
            C D+NEC+    +CK+G+C+N  GS+RC CS  ++      +C+  ++     E +  +C                     G G  C    +     Y  +C   PGY  + DG+          + C    P +C  G+CI    +++C CN GY     G SC   +D C++       N  C +    Y+C C  GY    D K C  + +   +       C+     G+ C+C  GF       Q +    D +E     S   S++S                    C+N    + CEC  GF LD  G  C++  E                      G+  C +G C      ++C C  GY        C D +ECS N  +C   +C N+ GSY+C C  GF      GG  C D NEC+  ++ C  G C NT G + C C  G+  + +  
Sbjct: 2189 CMDLNECRTKPGLCKNGRCVNTVGSYRCECSEGFEPSATGTECIDNRQGFCFTEVLQTMCQQGSTNRNSVTKSECCCNGGRGWGPQCELCPLPGTVQYKKMCPLGPGY--TTDGR--------DINECEVL-PNLCKNGQCINSVGSFRCHCNVGYTNDFSGTSCID-LDECSQSPKPC--NFLCKNTEGSYLCSCPRGYILQPDGKTCKDLDECSTKQHNCQFLCV-NTIGGFTCKCPSGFT------QHQTACIDNNECTNQPSVCGSRAS--------------------CLNTPGSFNCECQKGFSLDGTGVECEDVDECT--------------------GNHRCQHG-CQNMLGGFRCGCPQGYVQHYQWNQCVDENECSGN-QVCGSASCYNTLGSYKCVCPSGFDFQAGAGG--CQDINECSMGSNPCSFG-CSNTDGGYLCGCPGGFYRAGQGH 2585          

HSP 13 Score: 91.2781 bits (225), Expect = 3.397e-18
Identity = 120/465 (25.81%), Postives = 177/465 (38.06%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQ-LSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYT----SSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            RC+C  GF    TG  C +   G CF  + + +C +       ++K  CC      WG  C+ C L     G +            Q+ ++C  G      G                    +   +CE +PNLC  G  C++ S+ +  C C  GY     G SC        D C    P  C+F  C     +Y C C +GYI   DGK+CK   +  T+ +        CV+    + C+C SG+T    +  D  +CT+     P        C+  P + + C C  GF+  G G +C                        D+D C  ++   +C+ G C NM   +RC C  G+V   Q   C +  E   NQ                    +C +  C  +  SY+C C +G+        C DI+ECS+  + C  G C N+ G Y C C  GF
Sbjct: 2215 RCECSEGFEPSATGTECIDNRQGFCFTEVLQTMCQQGSTNRNSVTKSECCCNGGRGWGPQCELCPL----PGTV------------QYKKMCPLGPGYTTDG--------------------RDINECEVLPNLCKNGQ-CIN-SVGSFRCHCNVGYTNDFSGTSCID-----LDECS-QSPKPCNF-LCKNTEGSYLCSCPRGYILQPDGKTCKDLDECSTKQHNC---QFLCVNTIGGFTCKCPSGFTQHQTACIDNNECTN----QPSVCGSRASCLNTPGS-FNCECQKGFSLDGTGVECE-----------------------DVDECTGNH---RCQHG-CQNMLGGFRCGCPQGYVQHYQWNQCVDENECSGNQ--------------------VCGSASCYNTLGSYKCVCPSGFDFQAGAGGCQDINECSMGSNPCSFG-CSNTDGGYLCGCPGGF 2578          

HSP 14 Score: 61.6178 bits (148), Expect = 4.492e-9
Identity = 88/320 (27.50%), Postives = 130/320 (40.62%), Query Frame = 3
Query: 1077 CECNQGYIASSDGK-SCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLP--------GFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICK----NTYGSFQCQCNSG 1994
            C C+ G++A S G  SC            V C NG      ND  C C  GYT ++  +  C S C    R + P+            C C+ GF     G QC R        GP  +  +++  QG +     +  +  C   A I     + CE  P        GF+ + +  AC++  E +                       LC  G CI +  SY+C+C  G++ S   + C DIDEC++ P +CD G C N+ GSY C+C  G+   +   G +C D+   T  ++L  NG C       +   QC C+ G
Sbjct:   72 CTCSSGHLAPSCGAASCS-----------VRCMNG---GACNDDSCVCQKGYTGNHCGQPVCESGCQNGGRCIGPN-----------RCACVYGFT----GPQCER----DYRTGPCFTQVNNQMCQGQLSGIVCT--KTLCC--ATIGRAWGHPCEVCPAQPHPCRRGFIPNIRSGACQDVDECQAI-------------------PGLCAGGNCINTVGSYECKCPAGHRQSETNQKCEDIDECAL-PGLCDGGECTNTAGSYVCTCPRGYV--SSADGSRCIDQRIGTCFSAL-ANGRCAAELTGQFSKMQCCCDLG 331          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Cavefish
Match: FBN1 (fibrillin 1 [Source:HGNC Symbol;Acc:HGNC:3603])

HSP 1 Score: 177.563 bits (449), Expect = 5.735e-45
Identity = 189/678 (27.88%), Postives = 274/678 (40.41%), Query Frame = 3
Query:  162 MILSVGLLSIFGLFFAHLQTVHGESHICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFI--EIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDY--ICQCDSGYTSSY----DRKKCTSICDLYPRSLCPDGQCIPQ---------PNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG-DIDFCFYSYYRDQCKGGAC-----INMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNS 2045
            M++  GL     +FF H        ++CG    ++ CC G++  + G+ C +PIC + CG +G C RPN C C +G I+ SC  +                       +  +              N G      RC C  GFTG  C  +   G CF S+S  +C     G+  +K LCC     AWG PC++C  +   C +GFI     G CQD++ECQ    +C+ G CIN  GSF C C + ++F+ V   C +   +C  IP LCG G    S +I ++ C+C  G+  +LDG  C    +                G C  D  N +C        + +   C   V  C  + G   P    +  + +Y  +C   SG    Y       +  SI  L P  + P G   PQ         P NG   R L             R +       PT  +   + + G  +D   +    D+C+   C     +N    Y C+C  GF        CK+  E   N                     +CNNGRC+ +  S+ C CN+G++ S DGK C D+DEC I  ++C  G CIN  GS++C C  G+ +     G  C D +EC             NT GSF+C+C +G       + CV     S
Sbjct:   15 MVICWGLFCSVSVFFLHSCL----PNVCGSRHQTY-CCPGWKTLTGGNQCIVPICRSSCG-DGFCSRPNMCTCPSGQISPSCGSKSAQHCNIRCMNGGTCAEDNCMCQKGYSGTHCGQPVCESGCLNGGRCVAPNRCVCTYGFTGAQCERDYRTGPCFASVSNQMCQGQLTGIVCTKTLCCATVGRAWGHPCEQCPAQPHPCRRGFIPNHRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHRFNEVSQKC-EDIDECSNIPGLCGAGE--CSNTIGSYFCRCPVGFETALDGSRCIDARS----------------GFCYDDIINGRCANLNAQPMTKN--QCCCNVGRC--WAGSTIPEMCPIRGTEEYQTLCVPSSGVPGPYVPGGGISQIPSIIPLQP--IIPQGPLGPQRPDIIPPLPPRNGIP-RILTQNITHTNLCDAVRNLCLNGRCIPTPGSYRCECNMGYQLDIRGHCIDDDECERNPCAHGQCMNTAGSYYCQCPAGFQTTATRTECKDLDECVAN-------------------GRICNNGRCVNTEGSFHCVCNSGFEISPDGKNCQDMDECQIR-NMCLNGMCINDDGSFKCICKSGYLLDGT--GRYCIDVDECV------------NTEGSFRCECVAGLAVGLDGRTCVDTHMRS 626          

HSP 2 Score: 165.622 bits (418), Expect = 3.223e-41
Identity = 171/619 (27.63%), Postives = 261/619 (42.16%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC-------------------QDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCV---QRKK-----------------------KCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGT-CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            CQC  G T    G++C ++   +C+LS     C   P   +   + CC +  VAWG  C  C     EKG  E + +C                   +DINEC+    +C +G+C N  GSFRC C S Y  D  + +C    +RK+                       +CE+ P LC  G DC++    +  C+C PG+  + DG +C     N+ ++       +C  G+C+     Y+C CN GY ++ D  SC   +D CT  NG       C +    Y C C  GY    D++ CT I  C+  P  +C  GQC   P   Y+C C  GF      K C  +  D+ E+ P                       + C  G C N K  + C C  G+ + K    C +  E +    N           CD+  +       C  +  S++C C  G+    +G  C+D+DECS    +C     C+N+ GSY+C C +GF+      G  C D +EC +  +LC+NG C N  G ++C+C+ G+I +   + C  + + +        + IC   +  C+   GLF C C  G +     G C  +++  D
Sbjct:  902 CQCPTGMTVDASGRTCIDLRTEQCYLSHEDERC-GAPISGRHRVDTCCCSVGVAWGPECDECP----EKGTPEYNLLCPRGPGFSQRGDFINGKPFLKDINECKMIHSLCTNGRCRNTIGSFRCRCDSGYALDSDERNCTGESERKQPLHQCKKDKGDDCGLQKGQAYIDECERNPLLC-RGGDCINTE-GSFRCQCPPGHEIAPDGSAC--LDINECEL----SDKLCRNGQCVNMIGRYQCSCNTGYKSTQDLLSCVD-IDECTILNGGC--ETTCTNSEGSYECSCRRGYALMPDQRSCTDIDECEDSP-DICDGGQCTNIPGE-YQCLCFDGFMSSEDLKTCLDV--DECELNP-----------------------NICLSGKCENTKGSFICHCDLGYSVRKGTTGCTDVNECEIGAHN-----------CDRHAT-------CTNTPGSFKCSCTPGWIG--NGIQCTDLDECSNGTHLCSSNADCMNTMGSYRCVCKEGFSGD----GFFCTDSDECADNVNLCENGHCLNVAGGYRCECDMGFIPTPDGKACEDIDECTF-------ADICV--NGRCQNIPGLFRCECSIGFELDRSGGNCTDINECAD 1444          

HSP 3 Score: 164.466 bits (415), Expect = 8.568e-41
Identity = 159/570 (27.89%), Postives = 227/570 (39.82%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDG-ICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE-------------------YKTNQMNDVASSFSLKTQCDKFGSFLCNNG---RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            +G  C E   G C+L +   +C  +  G  L K  CC     AWG PC  CE    C KG   + G IC+D+NEC+ +  +C +GKC+N  GSF C C +    D     C+  R ++C        CG     +S       C C  G     +   C ++   +Y++    GP     G  I                  +GK   K ++ C   + + C NG+C +    + C+CDSGY    D + CT   +              QP +                 QC++   D   +         +  Q  ID C  +     C+GG CIN +  +RC+C PG  +   G AC +  E                   Y+ +      S+  L +  D     + N G    C  S  SY+C C  GY    D + C+DIDEC  +P ICD G C N PG YQC CFDGF   +      C D +EC    ++C +G C+NT GSF C C+ GY        C  V +     ++ +    C         + G F CSC  G 
Sbjct:  808 SGLQCIETSKGTCWLKIVNALCEVNINGATL-KSQCCATLGAAWGSPCSPCERDPVCPKGHSRVRGSICEDVNECEVFPGVCINGKCVNTLGSFICQCPTGMTVDASGRTCIDLRTEQCYLSHEDERCGAP---ISGRHRVDTCCCSVGVAWGPECDECPEKGTPEYNLLCPRGPGFSQRGDFI------------------NGKPFLKDINECKMIHSL-CTNGRCRNTIGSFRCRCDSGYALDSDERNCTGESERK------------QPLH-----------------QCKKDKGDDCGL---------QKGQAYIDECERNPLL--CRGGDCINTEGSFRCQCPPGHEIAPDGSACLDINECELSDKLCRNGQCVNMIGRYQCSCNTGYKSTQDLLSCVDIDECTILNGGCETTCTNSEGSYECSCRRGYALMPDQRSCTDIDECEDSPDICDGGQCTNIPGEYQCLCFDGFM--SSEDLKTCLDVDECELNPNICLSGKCENTKGSFICHCDLGYSVRKGTTGCTDVNECEIGAHNCDRHATCTN-------TPGSFKCSCTPGW 1305          

HSP 4 Score: 149.058 bits (375), Expect = 5.022e-36
Identity = 157/604 (25.99%), Postives = 234/604 (38.74%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCELGRCEKGFIEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMK-NHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQ----CDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD----------------------------------------QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            +C C  GF    +G+ C ++    C+     G C+  P  L  +K  CC +      WGDPC+ C     + G     G   +DI+EC+   ICK+G+CIN  G FRC C + Y  D  + +C     +C+   N CG G    +       C C  G+     G   + +  N+        P +C F +C+    +Y+C+C  GY+   D + CK   +     +        C +L   Y+C C  GYT   + + C  +  C   P  +C +G+C       Y CRC  GF P     +C  I                        FCF    +  C+ G+   +      C C  G       + C         +M      ++   Q    C   G+ LC  GRC+ +  SY+C CN+GY   + G +C D+DEC   P  C+                                        Q  C+N+ G + C C  GFT H+      C D NEC     LC  NG+C+N+ GSF C+C  G+          S+  N     D +      +C H C+   G + C+CP G
Sbjct: 1935 KCICPEGFQLSSSGRRCVDMRVSFCYTKFENGRCVA-PKPLNTTKSHCCCSMMPGQGWGDPCEICP-NMTDVGVPYGTGDTPEDIDECKEPGICKNGQCINTDGGFRCECPTGYSLDSSRVNCTD-TDECKD-GNPCGNGT--CNNVFGGFECTCDEGFEP---GPMMTCEDINECSQ----NPLLCAF-RCVNTYGSYECKCPTGYVLREDRRMCKDQDECADEVDDCQSRGMTCKNLIGTYMCICPQGYTRQPNGEGCMDLNECTAKP-GICENGRC-ENTVGSYRCRCETGFEPSPTQTECYDIRRG---------------------FCFTEVLQTMCQMGSSNRVSVTKSECCCDGGRGWGASCELCPLPGTTHYKRMCPQGPGYTTDGQDINECKVMGN-LCQKGRCVNTEGSYKCVCNSGYTTDISGTICVDVDECVQAPKPCNFICKNVEGGYQCSCPRGYILQEDRKSCRDLDECSTKQHNCQFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECNTDPGLCGPNGMCQNSPGSFNCECQRGF----------SLDQNGQHCEDMDECDGNHRCQHGCQNLVGGYRCNCPQG 2486          

HSP 5 Score: 145.591 bits (366), Expect = 6.368e-35
Identity = 138/470 (29.36%), Postives = 202/470 (42.98%), Query Frame = 3
Query:  714 GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG----KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCI-PQPNNGYECRCLPGFAP-MGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLK----------TQCDKFGS-----FLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
             +C D +EC+  Q C +G C N  GS+ CLC   +Q      DC+    +C     +C  G DC + ++ + +C C  GY  SLDG+ C        + C    P  C  G C     +Y+C CN G+    D       C +  DFC          G C +    + C C  G+  S   ++C  +   +  +   +G+C+ P+P N  +  C     P  G G  C  I  + +++G      D+     DID C        CK G CIN    +RCEC  G+ LD     C +  E K          N+V   F               C+          LC   RC+ +  SY+C+C TGY    D ++C D DEC+     C     TC N  G+Y C C  G+T    P G  C D NECT    +C+NG C+NT GS++C+C +G+  S  + +C  ++
Sbjct: 1785 AMCVDRDECEREQPCGNGTCKNTVGSYSCLCYPGFQLS-HNIDCID-TDECATQRGICRNG-DCFN-TVGSFVCVCRQGYELSLDGRFCV-----DINECAL-SPGTCGPGTCQNLDGSYRCICNTGHYLKDDRCEDIDECAQAPDFCIF--------GTCQNTPGSFKCICPEGFQLSSSGRRCVDMRVSFCYTKFENGRCVAPKPLNTTKSHCCCSMMPGQGWGDPC-EICPNMTDVGVPYGTGDTPE---DIDECKEPGI---CKNGQCINTDGGFRCECPTGYSLDSSRVNCTDTDECKDGNPCGNGTCNNVFGGFECTCDEGFEPGPMMTCEDINECSQNPLLCAF-RCVNTYGSYECKCPTGYVLREDRRMCKDQDECADEVDDCQSRGMTCKNLIGTYMCICPQGYT--RQPNGEGCMDLNECTAKPGICENGRCENTVGSYRCRCETGFEPSPTQTECYDIR 2226          

HSP 6 Score: 132.109 bits (331), Expect = 1.063e-30
Identity = 158/641 (24.65%), Postives = 250/641 (39.00%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC------ELGRCEKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVD----------FC-TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY-RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK-------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSD---------------------------IDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            RC+C  G      G++C +  +   C+    RG C++  +G     E CC   + A+G+PCQ C      E      G I      +DINEC  +  IC++G+C N   +++C C+  ++ D    +C+    +C     LC  GM     +  +  C C  GY+   D   C        D C       C    C     ++ C C+ G    + G  C +T             C    NG    +  C +L   +      C+ D      + R +   C  +  C+++P  +C +G+C+      + C+C  G      G+ C  + ++Q                     C+ S+  ++C  GA I+ ++    C C  G     +   C E+   + N +      FS +              +C    S LC NGRC  +  S++C+C++GY    D + C+                            IDEC  NP +C  G CIN+ GS++C C  G  I   P G  C D NEC  +  LC+NG C N  G +QC CN+GY S+     CV +          E + +   C   C  S G + CSC  G   + +   C  + +  D
Sbjct:  603 RCECVAGLAVGLDGRTCVDTHMRSTCYGGYKRGQCIQPFFGAVTKSECCCAKVEYAFGEPCQPCPPETSAEFAALCPGGIGSTTDSKDINECALNPDICQNGECENLLRTYKCNCNQGFEVDSTGKNCID-IDECSVNRLLCDNGM--CRNTPGSFTCHCPLGYIFQPDTDVCE-----DIDEC---ASNPCVNADCKNTQGSFSCLCSTGSSLDNSGLQCIETSKGTCWLKIVNALCEVNINGATLKSQCCATLGAAWGSPCSPCERDPVCPKGHSRVRGSICEDVNECEVFP-GVCINGKCV-NTLGSFICQCPTGMTVDASGRTCIDLRTEQ---------------------CYLSHEDERC--GAPISGRHRVDTCCCSVGVAWGPECDECPEKGTPEYNLLCPRGPGFSQRGDFINGKPFLKDINECKMIHS-LCTNGRCRNTIGSFRCRCDSGYALDSDERNCTGESERKQPLHQCKKDKGDDCGLQKGQAYIDECERNPLLCRGGDCINTEGSFRCQCPPGHEI--APDGSACLDINECELSDKLCRNGQCVNMIGRYQCSCNTGYKSTQDLLSCVDID---------ECTILNGGCETTCTNSEGSYECSCRRGYALMPDQRSCTDIDECED 1195          

HSP 7 Score: 130.183 bits (326), Expect = 4.193e-30
Identity = 120/447 (26.85%), Postives = 189/447 (42.28%), Query Frame = 3
Query:  753 ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG-DIDFCFYSYYRDQCKGGACINMKNHYRCECL-PGFVLDKQGQACKERVEYKTNQM-----NDVASSFS------LKTQCD-------KFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
            +C +G+CI   GS+RC C+  YQ D ++  C+    +CE+ P                                                    C  G+C+    +Y C+C  G+  ++    CK  +D C   NG +C NG+CV+    + C C+SG+  S D K C  + +   R++C +G CI   +  ++C C  G+   G G+ C  +    +  G       +  + G D   C  ++ R  C GG       + R +C+ P F    + + C  +VEY   +       + ++ F+      + +  D            +C NG C     +Y+C CN G++    GK C DIDECS+N  +CD G C N+PGS+ C C  G+     P    C D +EC   ++ C N  CKNT GSF C C++G    N    C+  
Sbjct:  437 LCLNGRCIPTPGSYRCECNMGYQLD-IRGHCID-DDECERNP----------------------------------------------------CAHGQCMNTAGSYYCQCPAGFQTTATRTECKD-LDECVA-NGRICNNGRCVNTEGSFHCVCNSGFEISPDGKNCQDMDECQIRNMCLNGMCI-NDDGSFKCICKSGYLLDGTGRYCIDVDECVNTEGSFRCECVAGLAVGLDGRTCVDTHMRSTCYGG-------YKRGQCIQPFFGAVTKSECCCAKVEYAFGEPCQPCPPETSAEFAALCPGGIGSTTDSKDINECALNPDICQNGECENLLRTYKCNCNQGFEVDSTGKNCIDIDECSVNRLLCDNGMCRNTPGSFTCHCPLGYIFQ--PDTDVCEDIDEC--ASNPCVNADCKNTQGSFSCLCSTGSSLDNSGLQCIET 815          

HSP 8 Score: 121.324 bits (303), Expect = 2.008e-27
Identity = 149/564 (26.42%), Postives = 213/564 (37.77%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSL-SRGVCMK-----HPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGK---------CINERGSFRC-LCSSSYQFDPVQADCVQRKKKCE-QIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC-------------SKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCE-------------CNQGYIASSDGKSCKKTVDFCTRYNGVVCP-NGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLY---PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQ-CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            C C P F    TG  C +I +G C+L + SRG   +     +  G+ +SK  CC +    WG PC+ C L                +N  ++  +C  G+          +  R    C  CS  Y F              E Q P +CGPG  C + +I N+ C C P Y++   G +C             S  +    ++       +C     I   +N  CE             C    I         + +D     NG VC  N  C++L   Y C C  GY         T    +Y     ++C  GQCI    + Y C C  G+        C  +  D+ E                         R+Q C  G C N    Y C C PGF L      C +  E  T +                    +C NG C  +  S+ C C  GY+ SLDG+ C DI+EC+++P  C  GTC N  GSY+C C  G  + +     +C D +EC +    C  G C+NT GSF+C C  G+  S+  + CV ++
Sbjct: 1462 CNCPPDFQLNPTGVGCVDIRSGNCYLDVRSRGDASESLDCSNEIGVGVSKASCCCSLGQGWGTPCEACPL----------------LNSSEYKSLCPGGEGFRPNPITVILEGRSKALCGFCSVIYIFFIFLYSYASFSDINECQEPGICGPGQ-CYN-TIGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYSDNATCDGELTFNMTKKMCCCSYNIGRAWNKPCEPCPVSGTSEFAILCGSDRIGYYIDIYTGQVIDIDECQNGPVCQQNAVCLNLPGSYRCDCKPGYLILIKYLVSTVNISVYCVENPNVCNPGQCIDMVGS-YRCLCPSGYKTTTAPAMC--VDRDECE-------------------------REQPCGNGTCKNTVGSYSCLCYPGFQL-SHNIDCIDTDECATQRG-------------------ICRNGDCFNTVGSFVCVCRQGYELSLDGRFCVDINECALSPGTCGPGTCQNLDGSYRCICNTGHYLKD----DRCEDIDECAQAPDFCIFGTCQNTPGSFKCICPEGFQLSSSGRRCVDMR 1955          

HSP 9 Score: 113.62 bits (283), Expect = 5.390e-25
Identity = 130/467 (27.84%), Postives = 182/467 (38.97%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLC---------------------GPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVS 2030
            C D+NEC     IC++G+C N  GS+RC C + ++  P Q +C   ++     E +  +C                     G G  C        + Y  +C   PGY  + DG+          + C+  G  +C  G+C+    +YKC CN GY     G  C   VD C +       N  C ++   Y C C  GY    DRK C  + +   +       C+     G+ C+C PGF               Q       +NE       D   C           G C N    + CEC  GF LD+ GQ C++  E                  CD  G+  C +G C      Y+C C  GY        C D +EC  N  IC   +C N+ GS++C C  GF+     GG  C+D NEC+   + C  G C NT G + C C  GY  + +   CVS
Sbjct: 2180 CMDLNECTAKPGICENGRCENTVGSYRCRCETGFEPSPTQTECYDIRRGFCFTEVLQTMCQMGSSNRVSVTKSECCCDGGRGWGASCELCPLPGTTHYKRMCPQGPGY--TTDGQ--------DINECKVMG-NLCQKGRCVNTEGSYKCVCNSGYTTDISGTICVD-VDECVQAPKPC--NFICKNVEGGYQCSCPRGYILQEDRKSCRDLDECSTKQHNCQFLCV-NTIGGFTCKCPPGFT--------------QHHTACIDNNE----CNTDPGLCG--------PNGMCQNSPGSFNCECQRGFSLDQNGQHCEDMDE------------------CD--GNHRCQHG-CQNLVGGYRCNCPQGYLQHYQWNQCVDENECQ-NGQICGGASCHNTLGSFRCLCPTGFSFEQTSGG--CHDVNECSSQQNPCTYG-CSNTDGGYLCGCPPGYFRAGQGH-CVS 2579          

HSP 10 Score: 107.842 bits (268), Expect = 3.011e-23
Identity = 155/611 (25.37%), Postives = 232/611 (37.97%), Query Frame = 3
Query:  501 CQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYG----------LQLSKELCCGAFQV--AWGDPCQRCEL-GRCEKG----------FIEI-DGICQDINECQWSQICK-SGKCINERGSFRCLCSSSYQ-FDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLD-----------------GKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C C P +      ++  G   + + R +C ++ Y             ++K++CC ++ +  AW  PC+ C + G  E            +I+I  G   DI+ECQ   +C+ +  C+N  GS+RC C   Y          V     C + PN+C PG  C+ + + ++ C C  GY  +     C  +     D C    P  C  G C     +Y C C  G+  S +   C  T D C    G+ C NG C +    ++C C  GY  S D + C  I  C L P + C  G C    +  Y C C  G            +  D+ E               DID C  +   D C  G C N    ++C C  GF L   G+ C            D+  SF       KF +  C   + + +  S+ C      Q   D                 G    DIDEC   P IC  G CIN+ G ++C C  G+++ +      C D +EC +    C NG C N +G F+C C+ G+        C  + + S              C+  C  + G + C CP G     +  +C    +  D
Sbjct: 1609 CICPPDYM-----QVNGGNNCMDMRRSLCYRNYYSDNATCDGELTFNMTKKMCCCSYNIGRAWNKPCEPCPVSGTSEFAILCGSDRIGYYIDIYTGQVIDIDECQNGPVCQQNAVCLNLPGSYRCDCKPGYLILIKYLVSTVNISVYCVENPNVCNPGQ-CIDM-VGSYRCLCPSGYKTTTAPAMCVDR-----DECEREQP--CGNGTCKNTVGSYSCLCYPGFQLSHN-IDCIDT-DECATQRGI-CRNGDCFNTVGSFVCVCRQGYELSLDGRFCVDINECALSPGT-CGPGTC-QNLDGSYRCICNTG----------HYLKDDRCE---------------DIDEC--AQAPDFCIFGTCQNTPGSFKCICPEGFQLSSSGRRCV-----------DMRVSFCYT----KFENGRCVAPKPLNTTKSHCCCSMMPGQGWGDPCEICPNMTDVGVPYGTGDTPEDIDECK-EPGICKNGQCINTDGGFRCECPTGYSLDS--SRVNCTDTDECKDGNP-CGNGTCNNVFGGFECTCDEGF-EPGPMMTCEDINECSQNPL---------LCAFRCVNTYGSYECKCPTGYVLREDRRMCKDQDECAD 2144          

HSP 11 Score: 100.908 bits (250), Expect = 4.303e-21
Identity = 137/509 (26.92%), Postives = 205/509 (40.28%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC----PDGQCIPQPNNGY--ECRCLPGFAPMGKGKQCRRIMSDQSE------IGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQM-------NDVASSFSLK--------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDG-------------KLCSDIDECSINPSICDQGTCINSPGSY--QCSCFDGFTI----HNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            RCE   C  G+ ++I G C D +EC+ +  C  G+C+N  GS+ C C + +Q    + +C +   +C     +C  G  CV+     H C C  G+  S DGK+C        D C+     +C  G CI D  ++KC C  GY+    G+ C   VD             +CV+    + C+C +G     D + C    D + RS C      GQCI QP  G   +  C         G+ C+    + S        G   S  DSK    DI+ C  +   D C+ G C N+   Y+C C  GF +D  G+ C +  E   N++        +   SF+                   D+  S  C N  C  +  S+ C C+TG      G             K+ + + E +IN +      C     ++   CS  +   +    H+   G  C D NEC     +C NG C NT GSF CQC +G       + C+ ++
Sbjct:  451 RCE---CNMGYQLDIRGHCIDDDECERNP-CAHGQCMNTAGSYYCQCPAGFQTTATRTEC-KDLDECVANGRICNNGR-CVNTEGSFH-CVCNSGFEISPDGKNCQDM-----DECQIRN--MCLNGMCINDDGSFKCICKSGYLLDGTGRYCID-VD-------------ECVNTEGSFRCECVAGLAVGLDGRTCV---DTHMRSTCYGGYKRGQCI-QPFFGAVTKSECCCAKVEYAFGEPCQPCPPETSAEFAALCPGGIGSTTDSK----DINEC--ALNPDICQNGECENLLRTYKCNCNQGFEVDSTGKNCIDIDECSVNRLLCDNGMCRNTPGSFTCHCPLGYIFQPDTDVCEDIDECASNPCVNADCKNTQGSFSCLCSTGSSLDNSGLQCIETSKGTCWLKIVNALCEVNINGATLKSQCCATLGAAWGSPCSPCERDPVCPKGHSRVRGSICEDVNECEVFPGVCINGKCVNTLGSFICQCPTGMTVDASGRTCIDLR 921          

HSP 12 Score: 99.7525 bits (247), Expect = 8.498e-21
Identity = 113/426 (26.53%), Postives = 175/426 (41.08%), Query Frame = 3
Query:  687 CEKGF-IEIDG-ICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSAN----KYDMCRFYGPYVCHFGK-------CIADGYNYKCEC--NQGYIASSDGKS-CKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN---GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
            C +G+ + +DG  C DINEC  S   C  G C N  GS+RC+C++ +    ++ D  +   +C Q P+ C  G      +  +  C C  G+  S  G+ C     +    K++  R   P   +  K           G+   CE   N   +    G     + +D C      +C NG+C++    + C+C +GY+    R  CT   +    + C +G C    NN   G+EC C  GF P                 GP  + ED      +   C +           C+N    Y C+C  G+VL +  + CK++ E   ++++D  S               C N        +Y C C  GY    +G+ C D++EC+  P IC+ G C N+ GSY+C C  GF     P   +CYD
Sbjct: 1856 CRQGYELSLDGRFCVDINECALSPGTCGPGTCQNLDGSYRCICNTGHY---LKDDRCEDIDECAQAPDFCIFGT--CQNTPGSFKCICPEGFQLSSSGRRCVDMRVSFCYTKFENGRCVAPKPLNTTKSHCCCSMMPGQGWGDPCEICPNMTDVGVPYGTGDTPEDIDECKEPG--ICKNGQCINTDGGFRCECPTGYSLDSSRVNCTDTDECKDGNPCGNGTC----NNVFGGFECTCDEGFEP-----------------GPMMTCEDINECSQNPLLCAFR----------CVNTYGSYECKCPTGYVLREDRRMCKDQDEC-ADEVDDCQSR-----------GMTCKN-----LIGTYMCICPQGYTRQPNGEGCMDLNECTAKPGICENGRCENTVGSYRCRCETGF--EPSPTQTECYD 2224          

HSP 13 Score: 81.2629 bits (199), Expect = 3.667e-15
Identity = 126/549 (22.95%), Postives = 202/549 (36.79%), Query Frame = 3
Query:  720 CQDINECQW-SQIC-KSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC--SKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQACKERVEYKTNQMNDVA------------------------SSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDE--CSIN----PSICDQGTCINSPGSYQCSCFDGFTIHNMPGGP---------------------------KCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCA 2177
            C D+NEC+  +  C +   C N  GSF+C C+  +  + +Q        +C    +LC    DC++ ++ ++ C C  G+  S DG  C  S + A+  ++C          G C+     Y+CEC+ G+I + DGK+C+  +D CT  +  +C NG+C ++   + C+C  G+        CT I +    + C  G C+  P + Y C C P F     G  C  I S    +   S  + S+S       C         K   C ++   +   CE  P     +    C     ++ N +  +                         +SFS   +C + G  +C  G+C  +  +Y C C   Y     G  C D+    C  N     + CD     N      C  ++     N P  P                           +  D +EC       +N +C N  GS++C C  GY+   K      V   +   Y  E   +C      C    G + C CP+G        +C 
Sbjct: 1271 CTDVNECEIGAHNCDRHATCTNTPGSFKCSCTPGWIGNGIQC---TDLDECSNGTHLCSSNADCMN-TMGSYRCVCKEGF--SGDGFFCTDSDECADNVNLC--------ENGHCLNVAGGYRCECDMGFIPTPDGKACED-IDECTFAD--ICVNGRCQNIPGLFRCECSIGFELDRSGGNCTDINECADPTTCISGFCVNTPGS-YFCNCPPDFQLNPTGVGCVDIRSGNCYLDVRSRGDASESLD-----CSNEIGVGVSKASCCCSLGQGWGTPCEACPLLNSSEYKSLCPGGEGFRPNPITVILEGRSKALCGFCSVIYIFFIFLYSYASFSDINECQEPG--ICGPGQCYNTIGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYSDNATCDGELTFNMTKKMCCCSYNIGRAWNKPCEPCPVSGTSEFAILCGSDRIGYYIDIYTGQVIDIDECQNGPVCQQNAVCLNLPGSYRCDCKPGYLILIK----YLVSTVNISVYCVENPNVCNP--GQCIDMVGSYRCLCPSGYKTTTAPAMCV 1788          

HSP 14 Score: 80.1073 bits (196), Expect = 8.634e-15
Identity = 112/454 (24.67%), Postives = 173/454 (38.11%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVC-MKHPYGLQLSKELCCGAFQVAWGDPCQRCELG-------RCEKG-FIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYI----ASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPS 1799
            RC+C+ GF    T   C +I  G CF  + + +C M     + ++K  CC      WG  C+ C L         C +G     DG  QDINEC+    +C+ G+C+N  GS++C+C+S Y  D     CV    +C Q P  C     C ++    + C C  GY+   D KSC    + + K   C+F          C+     + C+C  G+     A  D   C      C        PNG C +    + C+C  G++   + + C  + +      C  G        GY C C  G+    +  QC                ++++   G I           C G +C N    +RC C  GF  ++    C           +DV    S +  C    ++ C+N     +   Y C C  GY  +  G   S +   S +P+
Sbjct: 2206 RCRCETGFEPSPTQTECYDIRRGFCFTEVLQTMCQMGSSNRVSVTKSECCCDGGRGWGASCELCPLPGTTHYKRMCPQGPGYTTDG--QDINECKVMGNLCQKGRCVNTEGSYKCVCNSGYTTDISGTICVD-VDECVQAPKPCN--FICKNVE-GGYQCSCPRGYILQEDRKSCRDLDECSTKQHNCQFL---------CVNTIGGFTCKCPPGFTQHHTACIDNNECNTDPGLCG-------PNGMCQNSPGSFNCECQRGFSLDQNGQHCEDMDECDGNHRCQHG--CQNLVGGYRCNCPQGYLQHYQWNQCV---------------DENECQNGQI-----------CGGASCHNTLGSFRCLCPTGFSFEQTSGGC-----------HDVNECSSQQNPC----TYGCSN-----TDGGYLCGCPPGYFRAGQGHCVSGLGFGSSSPA 2589          

HSP 15 Score: 68.1662 bits (165), Expect = 4.533e-11
Identity = 139/577 (24.09%), Postives = 206/577 (35.70%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSI-YNHLCKCLPGYVKS--LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT------VDFCTRYNG---VVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAP-----MGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE-------RVEYKTNQMNDVASSFSL--KTQCDKFGSFLCNNGRC----IESGSSYQCQCNT---GYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------PGGPK-------CYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C++GF      C D +EC  +  +C++G C+N  G +RC C   +   P         K CE I        +C    I  N  C+ +PG  +     G    +   N  D+     P  C  G C+    +Y C C   +  +  G  C         +D  +R +    + C N   V +S    C C  G       + C  +     +SLCP G+               GF P     + +G+  + +    S I        S +S  DI+ C        C  G C N   +Y C C P ++    G  C +       R  Y  N   D   +F++  K  C  +      N  C    +   S +   C +   GY   +      DIDEC   P       C+N PGSY+C C  G+ I                                      P G K       C DR+EC E    C NG CKNT GS+ C C  G+  S+   DC+   + + Q+       IC+  +  C  + G FVC C  G +  L+   C  +++
Sbjct: 1342 CKEGFSGDGFFCTDSDECADNVNLCENGHCLNVAGGYRCECDMGFIPTP-------DGKACEDID-------ECTFADICVNGRCQNIPGLFRCECSIGFELDRSGGNCTDINECADPTTCISGFCVNTPGSYFCNCPPDFQLNPTGVGCVDIRSGNCYLDVRSRGDASESLDCSNEIGVGVSKASCC-CSLGQGWGTPCEACPLLNSSEYKSLCPGGE---------------GFRPNPITVILEGRS-KALCGFCSVIYIFFIFLYSYASFSDINEC---QEPGICGPGQCYNTIGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYSDNATCDGELTFNMTKKMCCCSYNIGRAWNKPCEPCPVSGTSEFAILCGSDRIGYYIDIYTGQVIDIDECQNGPVCQQNAVCLNLPGSYRCDCKPGYLILIKYLVSTVNISVYCVENPNVCNPGQCIDMVGSYRCLCPSGYKTTTAPAMCVDRDEC-EREQPCGNGTCKNTVGSYSCLCYPGFQLSHNI-DCIDTDECATQR------GICR--NGDCFNTVGSFVCVCRQGYELSLDGRFCVDINE 1874          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Cavefish
Match: LTBP3 (latent transforming growth factor beta binding protein 3 [Source:HGNC Symbol;Acc:HGNC:6716])

HSP 1 Score: 142.124 bits (357), Expect = 4.701e-34
Identity = 138/547 (25.23%), Postives = 229/547 (41.86%), Query Frame = 3
Query:  498 RCQCKPGFT---GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIP-----NLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSG--YTSSYDRKKCTSICDLYPRSLC-PDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI---MSDQS--------EIGPTSSNEDSKSSQGDIDFCF---YSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYD 2060
            RC CKPG+       C   V G C+  L++    +      L ++LCC     AWG  C++C            DG         ++++C +GK ++       L    +Q    Q+  + + ++ + +P     +L         + + +   + +       D    ++  A++ D CR     +C  G+C+     + C C+ GY   +  K+C    +    +       G C++    Y C C  G      + +++C  I + +   +C   G C+  P + Y+C C+PGF    + +QC  I   +  +S         IG           Q     C+       R  C  G C N+   YRC C  GF+ +   + C++  E + N+                    LC NG CI +  S+QCQC  GYQ + +G  C DI+EC    S C +G CIN+ GSY C C  G+ + +   G +C D +EC    SLC+ +G+C+N  G + C CN G+I S  K  C  ++ + N K +
Sbjct:  297 RCTCKPGYVLADRTRCVLEVQGPCYRMLTQAGRCELALPTNLPQKLCCCTVGKAWGRNCEKCPQ----------DGT------ASFNELCPAGKGMSVLHYHGTLAIQPFQTSIEQSPILTKPEQAKPLPLSLTFSLSLSFSLFSLVLVPSPTTRPIIRVPPERDSLEAAQTQASQMDECRL-NRNICGHGECVNTQTGFTCHCDAGYRPHTQRKNCVDENE--CEWEPCGQGRGTCINTVGSYHCNCLPGNKLMVHHGKRRCADINECFKPDICGVGGVCVNLPGS-YKCDCMPGFRSKTR-RQCEDIDECLDPKSCPDGQCENTIGSYECIPCQPGHQAQGGVCYDVNECQKRGVCLNGRCENLPGTYRCLCNEGFLPEADSKGCRDINECQDNR--------------------LCANGHCINTEGSFQCQCYPGYQPTQEGSHCEDINECE-RASNCQRGRCINTMGSYLCECQKGYMLVS---GRRCQDIDECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKE 798          

HSP 2 Score: 126.331 bits (316), Expect = 4.362e-29
Identity = 148/600 (24.67%), Postives = 238/600 (39.67%), Query Frame = 3
Query:  552 GECFLSLS-RGVCMKHPYGLQLSKELCCGAFQVAWGD-PCQRC--------------ELG-RCEKGFIEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKY-DMCRF-YGPYVCHFGKCIA-DGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD--LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDS-----------------------KSSQGDIDFCFYSYYRDQCK-GGACINMKNHYRCECLPGFVLDKQGQ-----ACKERVEYKTNQMNDVASSFSL----------------KTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            G CF   + +  C  +P     ++E CCG+   +WG   C +C              E G  C +G+  ++   CQDINEC    +C++G+C+N +GSFRC C   Y         ++ +  C ++    G     +  ++   LC C  G     + + C +     + ++C    G  V H+   +A   +    E +         K    ++ F    +  +       S +   I +      S    +   S  D     R++C  G+C+     G+ C C  G+ P  + K C  +  ++ E  P      +                       K    DI+ CF     D C  GG C+N+   Y+C+C+PGF    + Q      C +       Q  +   S+                    +C K G  +C NGRC     +Y+C CN G+    D K C DI+EC  N  +C  G CIN+ GS+QC C+ G+       G  C D NEC E  S C+ G C NT GS+ C+C  GY+  + ++ C  + +    +   +P  +C+          G +VC C +G 
Sbjct:  198 GRCFQETTPKQACSSNPLPGLTNQEDCCGSVGNSWGQHKCYKCPKLPYAGKLQTIIEEFGSTCPQGYKRLNRTHCQDINECMMQGVCQNGECLNTQGSFRCTCKPGYVLADRTRCVLEVQGPCYRMLTQAGRCELALPTNLPQKLCCCTVGKAWGRNCEKCPQDGTASFNELCPAGKGMSVLHYHGTLAIQPFQTSIEQSPILTKPEQAKPLPLSLTFSLSLSFSLFSLVLVPSPTTRPIIRVPPERDSLEAAQTQASQMDECRLNRNICGHGECV-NTQTGFTCHCDAGYRPHTQRKNC--VDENECEWEPCGQGRGTCINTVGSYHCNCLPGNKLMVHHGKRRCADINECFKP---DICGVGGVCVNLPGSYKCDCMPGFRSKTRRQCEDIDECLDPKSCPDGQCENTIGSYECIPCQPGHQAQGGVCYDVNECQKRG--VCLNGRCENLPGTYRCLCNEGFLPEADSKGCRDINECQDN-RLCANGHCINTEGSFQCQCYPGY--QPTQEGSHCEDINEC-ERASNCQRGRCINTMGSYLCECQKGYMLVSGRR-CQDIDECEVDRSLCQPHGVCEN-------RQGGYVCVCNDGF 777          

HSP 3 Score: 90.1225 bits (222), Expect = 5.920e-18
Identity = 138/591 (23.35%), Postives = 216/591 (36.55%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGI-CQDINECQWSQ-ICKS-GKCINERGSFRCLCSSSYQF------------------------------DPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNH-----LCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC-----TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCEC---------LPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR--------CIESGSS-YQCQCNTGYQASLDGKL----------------CSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET-TSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
            +CQC PG+     G  C +I   E   +  RG C+       +   LC                   C+KG++ + G  CQDI+EC+  + +C+  G C N +G + C+C+  +                                D V A  V +++ C  +    G   +     +Y+      LC    G+                 D C  +   +C  G+C+     ++C C QG+   S+   C   VD C  ++  +C NG CV+    + C C++ +T     KKC     TSI +    S C +G C+    + Y C C P +        C         + P      S  +  D++ C    Y   C+ G C+N    + C C         L   V D +  A K+    + ++  D+  S         +    C+ GR        C +  S  +   C    +   DG+L                  D DECS     C  G C+ S     C C  GF + +     +C D +EC E   +LCKN  C NT GSF+C C  G+I + +   C
Sbjct:  687 QCQCYPGYQPTQEGSHCEDINECERASNCQRGRCIN-----TMGSYLC------------------ECQKGYMLVSGRRCQDIDECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEICKGGRCMNTQPGFECYCQQGFYYDSNLLECID-VDEC--HDESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINECQDPSNCKNGHCV-DTQDSYYCICTPPWILATDRNSC---------VTPEEQAVMSVVTVSDVNECLDPSY---CRNGRCVNTPGSFHCICAQPLTFSAALKQCVYDDRTAAHKDVCFQEVDE--DLICSIPRNGLTVTYSECCCHYGRGWGPECRTCPQRNSVIFNRLCEMHLETESDGELDFLAAFSNYNPEGDSSEEDSDECS-----CANGRCVRSYLGTMCECNSGFRMDH--SRTRCIDVDECVERRVNLCKNARCVNTMGSFKCSCKHGFIPTRRPNVC 1229          

HSP 4 Score: 56.9954 bits (136), Expect = 8.630e-8
Identity = 82/346 (23.70%), Postives = 130/346 (37.57%), Query Frame = 3
Query:  687 CEKGFIEIDGI--CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRK----KKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKY-------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCD-SGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY---------------ECRCLPGFA---PMG-------------KGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE 1589
            C++GF     +  C D++EC    +C +G C+N RGSF C C++ +  D     CV        +C Q P+ C  G  CV     ++ C C P ++ + D  SC               D+     P  C  G+C+    ++ C C Q    S+  K C    D  T  +  VC       +  D IC    +G T +Y     +  C  Y R   P+ +  PQ N+                 E   L  F+   P G              G+  R  +    E       + S++   D+D C      + CK   C+N    ++C C  GF+  ++   C++
Sbjct:  901 CQQGFYYDSNLLECIDVDECHDESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINEC-QDPSNCKNG-HCVDTQD-SYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECLDPSYCRNGRCVNTPGSFHCICAQPLTFSAALKQC--VYDDRTAAHKDVCFQ----EVDEDLICSIPRNGLTVTY-----SECCCHYGRGWGPECRTCPQRNSVIFNRLCEMHLETESDGELDFLAAFSNYNPEGDSSEEDSDECSCANGRCVRSYLGTMCECNSGFRMDHSRTRCIDVDECVERRV-NLCKNARCVNTMGSFKCSCKHGFIPTRRPNVCRQ 1231          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Cavefish
Match: LTBP3 (latent transforming growth factor beta binding protein 3 [Source:HGNC Symbol;Acc:HGNC:6716])

HSP 1 Score: 141.739 bits (356), Expect = 5.991e-34
Identity = 136/545 (24.95%), Postives = 230/545 (42.20%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSE-IVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIP-----NLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSG--YTSSYDRKKCTSICDLYPRSLC-PDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRI---MSDQS--------EIGPTSSNEDSKSSQGDIDFCF---YSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYD 2060
            RC CKPG+     +  ++ G C+  L++    +      L ++LCC     AWG  C++C            DG         ++++C +GK ++       L    +Q    Q+  + + ++ + +P     +L         + + +   + +       D    ++  A++ D CR     +C  G+C+     + C C+ GY   +  K+C    +    +       G C++    Y C C  G      + +++C  I + +   +C   G C+  P + Y+C C+PGF    + +QC  I   +  +S         IG           Q     C+       R  C  G C N+   YRC C  GF+ +   + C++  E + N+                    LC NG CI +  S+QCQC  GYQ + +G  C DI+EC    S C +G CIN+ GSY C C  G+ + +   G +C D +EC    SLC+ +G+C+N  G + C CN G+I S  K  C  ++ + N K +
Sbjct:  311 RCTCKPGYVLADRTRCVLQGPCYRMLTQAGRCELALPTNLPQKLCCCTVGKAWGRNCEKCPQ----------DGT------ASFNELCPAGKGMSVLHYHGTLAIQPFQTSIEQSPILTKPEQAKPLPLSLTFSLSLSFSLFSLVLVPSPTTRPIIRVPPERDSLEAAQTQASQMDECRL-NRNICGHGECVNTQTGFTCHCDAGYRPHTQRKNCVDENE--CEWEPCGQGRGTCINTVGSYHCNCLPGNKLMVHHGKRRCADINECFKPDICGVGGVCVNLPGS-YKCDCMPGFRSKTR-RQCEDIDECLDPKSCPDGQCENTIGSYECIPCQPGHQAQGGVCYDVNECQKRGVCLNGRCENLPGTYRCLCNEGFLPEADSKGCRDINECQDNR--------------------LCANGHCINTEGSFQCQCYPGYQPTQEGSHCEDINECE-RASNCQRGRCINTMGSYLCECQKGYMLVS---GRRCQDIDECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKE 810          

HSP 2 Score: 90.1225 bits (222), Expect = 6.474e-18
Identity = 138/591 (23.35%), Postives = 216/591 (36.55%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGI-CQDINECQWSQ-ICKS-GKCINERGSFRCLCSSSYQF------------------------------DPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNH-----LCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC-----TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCEC---------LPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR--------CIESGSS-YQCQCNTGYQASLDGKL----------------CSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTET-TSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
            +CQC PG+     G  C +I   E   +  RG C+       +   LC                   C+KG++ + G  CQDI+EC+  + +C+  G C N +G + C+C+  +                                D V A  V +++ C  +    G   +     +Y+      LC    G+                 D C  +   +C  G+C+     ++C C QG+   S+   C   VD C  ++  +C NG CV+    + C C++ +T     KKC     TSI +    S C +G C+    + Y C C P +        C         + P      S  +  D++ C    Y   C+ G C+N    + C C         L   V D +  A K+    + ++  D+  S         +    C+ GR        C +  S  +   C    +   DG+L                  D DECS     C  G C+ S     C C  GF + +     +C D +EC E   +LCKN  C NT GSF+C C  G+I + +   C
Sbjct:  699 QCQCYPGYQPTQEGSHCEDINECERASNCQRGRCIN-----TMGSYLC------------------ECQKGYMLVSGRRCQDIDECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEICKGGRCMNTQPGFECYCQQGFYYDSNLLECID-VDEC--HDESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINECQDPSNCKNGHCV-DTQDSYYCICTPPWILATDRNSC---------VTPEEQAVMSVVTVSDVNECLDPSY---CRNGRCVNTPGSFHCICAQPLTFSAALKQCVYDDRTAAHKDVCFQEVDE--DLICSIPRNGLTVTYSECCCHYGRGWGPECRTCPQRNSVIFNRLCEMHLETESDGELDFLAAFSNYNPEGDSSEEDSDECS-----CANGRCVRSYLGTMCECNSGFRMDH--SRTRCIDVDECVERRVNLCKNARCVNTMGSFKCSCKHGFIPTRRPNVC 1241          

HSP 3 Score: 56.9954 bits (136), Expect = 8.360e-8
Identity = 82/346 (23.70%), Postives = 130/346 (37.57%), Query Frame = 3
Query:  687 CEKGFIEIDGI--CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRK----KKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKY-------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCD-SGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGY---------------ECRCLPGFA---PMG-------------KGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE 1589
            C++GF     +  C D++EC    +C +G C+N RGSF C C++ +  D     CV        +C Q P+ C  G  CV     ++ C C P ++ + D  SC               D+     P  C  G+C+    ++ C C Q    S+  K C    D  T  +  VC       +  D IC    +G T +Y     +  C  Y R   P+ +  PQ N+                 E   L  F+   P G              G+  R  +    E       + S++   D+D C      + CK   C+N    ++C C  GF+  ++   C++
Sbjct:  913 CQQGFYYDSNLLECIDVDECHDESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINEC-QDPSNCKNG-HCVDTQD-SYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECLDPSYCRNGRCVNTPGSFHCICAQPLTFSAALKQC--VYDDRTAAHKDVCFQ----EVDEDLICSIPRNGLTVTY-----SECCCHYGRGWGPECRTCPQRNSVIFNRLCEMHLETESDGELDFLAAFSNYNPEGDSSEEDSDECSCANGRCVRSYLGTMCECNSGFRMDHSRTRCIDVDECVERRV-NLCKNARCVNTMGSFKCSCKHGFIPTRRPNVCRQ 1243          

HSP 4 Score: 52.7582 bits (125), Expect = 2.018e-6
Identity = 35/107 (32.71%), Postives = 53/107 (49.53%), Query Frame = 3
Query:  552 GECFLSLS-RGVCMKHPYGLQLSKELCCGAFQVAWGD-PCQRC--------------ELG-RCEKGFIEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSY 818
            G CF   + +  C  +P     ++E CCG+   +WG   C +C              E G  C +G+  ++   CQDINEC    +C++G+C+N +GSFRC C   Y
Sbjct:  212 GRCFQETTPKQACSSNPLPGLTNQEDCCGSVGNSWGQHKCYKCPKLPYAGKLQTIIEEFGSTCPQGYKRLNRTHCQDINECMMQGVCQNGECLNTQGSFRCTCKPGY 318          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002704.1 (pep scaffold:Pmarinus_7.0:GL476354:513769:588114:-1 gene:ENSPMAG00000002318.1 transcript:ENSPMAT00000002704.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 5.472e-47
Identity = 165/574 (28.75%), Postives = 235/574 (40.94%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDGI-CQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK------------------------CEQIPNLCGP---GMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR-KKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            T   C E   G C+L++    C  +  G  L  E CC     AWG PC+ CEL   C KGF    G  C+D+NEC+ ++ IC + +CIN  GSF+C C   +  +     C+  + +                        C  +    GP   G      S Y  LC   PGY  S  G    +      + C+ + P +C  GKC     ++KC C  G++  ++GK+C   +D C + +  +C  G CV+    + C+C  G+ S +   K C  I  C+  P  LC  G C+      ++C C PG               D +E G    + D  S  G++           C+ G C+NM   Y+C C  G+      Q C            D+     +   CD           C  S  SY+C C  GY    D + CSDIDEC  NP +CD G C N PG Y+C C+DGF   +      C D NEC    ++C +G C+NT GSF C C  G+        C  V +     ++ +    C           G F C+C  G
Sbjct:  782 TKTICIESTKGTCWLNIIDNRCEVNVNGATLKSE-CCSTLGAAWGSPCEPCELDTICPKGFSRAKGTQCEDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGY--SNRGDPVGRHFFKDINECKVF-PQMCSNGKCRNTIGSFKCNCENGFVLDAEGKNCTD-IDEC-KISHDICGMGTCVNTPGSFDCECMEGFESGFMMMKNCMDIDECERNPL-LCRGGTCV-NTEGSFKCLCPPGH--------------DLNEDGTVCLDVDECSLSGNL-----------CRNGRCVNMIGSYQCSCNTGYSATPDRQGCV-----------DIDECTIMNGGCDT---------HCSNSDGSYECSCERGYALLPDTRSCSDIDECEDNPYLCDGGQCTNVPGEYRCLCYDGFI--SSVDMKTCSDVNECELNPNICIHGKCENTRGSFICHCKVGFTVKKGSTGCTDVDECEIGAHNCDMHATCAN-------VQGSFKCTCIEG 1293          

HSP 2 Score: 166.777 bits (421), Expect = 2.877e-42
Identity = 166/624 (26.60%), Postives = 263/624 (42.15%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC-ELGRCEKGFIEIDG-------------ICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGF---------------TIHN---------MPG-------------GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            +C+C PG T    G++C ++    C+LS       + P  ++L  ++CC +   AWG  C+ C E G  E  F+   G               +DINEC+ + Q+C +GKC N  GSF+C C + +  D    +C     +C+   ++CG G  CV+ +  +  C+C+ G+           ++    D C    P +C  G C+    ++KC C  G+  + DG  C   VD C+  +G +C NG+CV++   Y C C++GY+++ DR+ C  I +    +   D  C    +  YEC C  G+A +   + C                        DID C  + Y   C GG C N+   YRC C  GF+     + C +  E + N                     +C +G+C  +  S+ C C  G+        C+D+DEC I    CD   TC N  GS++C+C +G+                 HN         +PG             G  C D +EC E  +LC+ G C N+ G ++C+C  G++ +   + C   +D     +D     IC      C+   G+F C C  G +     G C    +  D
Sbjct:  875 KCECPPGHTLESTGRTCIDLRLENCYLSYEEEE-CEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINECKVFPQMCSNGKCRNTIGSFKCNCENGFVLDAEGKNCTD-IDECKISHDICGMGT-CVN-TPGSFDCECMEGFESGFM----MMKNCMDIDECE-RNPLLCRGGTCVNTEGSFKCLCPPGHDLNEDGTVCLD-VDECS-LSGNLCRNGRCVNMIGSYQCSCNTGYSATPDRQGCVDIDECTIMNGGCDTHC-SNSDGSYECSCERGYALLPDTRSCS-----------------------DIDECEDNPYL--CDGGQCTNVPGEYRCLCYDGFISSVDMKTCSDVNECELNPN-------------------ICIHGKCENTRGSFICHCKVGFTVKKGSTGCTDVDECEIGAHNCDMHATCANVQGSFKCTCIEGYFGDGVKCQDVDECANGTHNCIPEAKCVNIPGTFTCVCRDGFSGDGQTCVDMDECAENVNLCEFGQCLNSAGGYRCECEMGFVPTVDGRSC---KDIDECMFD----NICV--FGKCENVPGMFRCVCDPGYEIDETGGNCTDKDECAD 1433          

HSP 3 Score: 150.214 bits (378), Expect = 4.755e-37
Identity = 151/560 (26.96%), Postives = 234/560 (41.79%), Query Frame = 3
Query:  552 GECFL-SLSRG---VCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDG-----------ICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSAN----KYDM--CRFYGPYVCHFGKC-----IADGYNYKCECNQGYIASSDGKSC---------------KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF--APMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG-----------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN 2042
            G+CFL S  RG   +      G+ +S+  CC +   AWG PC+ C +    +  I   G           I +DI+EC +   +C+ G C N  GSF+C+C   ++F+     C +   +C   P +CGPG  C ++ + N+ C C P Y++   G +C     +     YD   C     +     +C     +   +N  C         +  + C               +  +D C++  G +C NG CV+L   + C+C  G+  +  +  C  I  C    +    + +CI    + Y C C PG+   P G     R   S++ EI      +D++ S                   D+D C     R  C  G C N    + C C PGF +                  ND       K +C    + +C  G CI +  S++C CN G++ + D K C DI+EC     +C  GTC N  GS++C C  G+ +        C D +EC+    LC  G C NT+GSF+C+C SG+I S   + C  V+ N
Sbjct: 1474 GKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRILCPGGEGFRPNPYTVILEDIDECTELPGLCQGGNCQNTFGSFKCVCQPGFRFNEDNRQC-EDIDECANFPTVCGPGT-CYNI-VGNYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQG-ICTNGMCVNLPGSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGS-YRCECSPGYTQTPFGLCID-RDECSEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDEC----ERQPCGNGTCRNTVGSFNCLCFPGFEISAN---------------NDCMD----KDECVSLAAHVCKFGSCINNVGSFKCLCNEGFELTADKKNCRDINECQQFRGMCAPGTCQNLEGSFRCMCPPGYEVKEE----ACTDIDECSSEEDLCMMGSCLNTFGSFECRCPSGFILSETGRKCYDVRVN 2000          

HSP 4 Score: 147.517 bits (371), Expect = 3.052e-36
Identity = 151/561 (26.92%), Postives = 232/561 (41.35%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINM-KNHYRCECLPGFVLDKQGQACKERVEYKTNQM------NDVASSFSLKTQCDK--FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI-NPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            RC+C PG+T                      + P+GL                                     C D +EC +  +IC  G+C +  GS+RC+C + Y+    Q  C+    +CE+ P  CG G    ++  +N  C C PG+  S +     K      D C     +VC FG CI +  ++KC CN+G+  ++D K+C+  ++ C ++ G+  P G C +L   + C C  GY      + CT I +      LC  G C+      +ECRC  GF     G++C  +                      +++CF  + + +C      N  K    C  +PG       + C ++ E +  ++        V      +   D+      +C NGRCI +  S++C C  GY     G  C D +ECSI NP  C  GTC+N PG ++C+C DGF    M     C D NEC+    LC    C N +GS++C C +GY+    ++ C   QD   +  D      C   +  CK   G ++C CP G
Sbjct: 1773 RCECSPGYT----------------------QTPFGL-------------------------------------CIDRDECSEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMD-VDECERQP--CGNGTCRNTVGSFN--CLCFPGFEISANNDCMDK------DECVSLAAHVCKFGSCINNVGSFKCLCNEGFELTADKKNCRD-INECQQFRGMCAP-GTCQNLEGSFRCMCPPGY--EVKEEACTDIDECSSEEDLCMMGSCL-NTFGSFECRCPSGFILSETGRKCYDVR---------------------VNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANGRCINTDGSFRCDCPMGYNLEAAGFKCVDANECSIGNP--CGNGTCLNVPGGFECTCDDGFEPGPM---MTCEDLNECSLNPLLCAF-RCVNNFGSYECMCPTGYVLREDRRMCKD-QDECEEGLDN-----CASRNMICKNLIGTYMCICPPG 2225          

HSP 5 Score: 140.584 bits (353), Expect = 4.502e-34
Identity = 160/636 (25.16%), Postives = 250/636 (39.31%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRCELGRCEKGF-----------IEIDGICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT--SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKG-GACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK----TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD----------------------------------------QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQF 2207
             C+C  GF    TG+ C ++    CF   ++G C   P     SK  CC +      WGDPC+ C     E+ +           +  D   +D++EC  +  IC +G+CIN  GSFRC C   Y  +     CV   +    I N CG G  C+++      C C  G+     G   + +  N+  +     P +C F +C+ +  +Y+C C  GY+   D + CK   +     +     N  C +L   Y+C C  GYT   D + C   + C L P  +C +G+CI    + Y+C C  GF           +  D++E        DS+       FCF    +  C+   +  N+     C C  G    +Q   C      +  ++      ++       +C      +C++G+CI S  SY C CN GY   +    C D+DEC+ +P  C+                                        Q  C+N+ G + C C  GFT H+      C D NEC      C   G+C+N+ GSF C+C  G+   N   +C  + + S             +C H C+   G + C CP+G     +   C   ++  + Q 
Sbjct: 1978 ECRCPSGFILSETGRKCYDVRVNYCFSEFAQGKC-STPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANGRCINTDGSFRCDCPMGYNLEAAGFKCVDANEC--SIGNPCGNGT-CLNVP-GGFECTCDDGFEP---GPMMTCEDLNECSL----NPLLCAF-RCVNNFGSYECMCPTGYVLREDRRMCKDQDECEEGLDNCASRNMICKNLIGTYMCICPPGYTRRPDGEGCIDENECRLKP-GICENGRCINNVGS-YKCVCNEGFT----------LNQDETEC------VDSRRG-----FCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRDIDECTVMPG-MCHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDECAQSPKPCNFICKNTEGSYQCACPRGYIMQEDGRTCRDLDECASKQHNCQFLCVNTIGGFTCKCPPGFTQHHT----ACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCEDMDECSGN----------HRCQHGCQNMLGGYRCGCPSGYLQHFQWNQCVDENECTNPQV 2562          

HSP 6 Score: 135.576 bits (340), Expect = 1.517e-32
Identity = 167/675 (24.74%), Postives = 254/675 (37.63%), Query Frame = 3
Query:  687 CEKGFIEIDG--ICQDINECQWSQICKSGKCINERGSFRCLCS------------------SSYQFDPVQADCVQ-------RKKKCEQIPNLC--GPGMDCVSLSI--YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA---------PMGKGKQCRRIMSDQSEI---GPTSSNE------------------DSKSSQG----------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQG---------------------------------------------QACKER--VEYK---------TNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------PG------GPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQF 2207
            C+ GF  +     C DI+ECQ   IC +G+CIN  GSF+C C                   S+   D +   C+        + + C   PN     P + C +++   Y  LC   PG+     GK  ++ + N         P +C  G+C      Y+C CN GY +   GK C   VD C      +C NG C +    Y C C +GY   ++ + C  + D    + C +G C       + C CLP               KG     I+ ++ E+   G T  +E                  D+   +G          D++ C    +   C    CIN    ++CEC PG  L+  G                                             + C E+   EY          +N+ + V   F       K    +C+NG+C  +  S++C C  G+    +GK C+DIDEC I+  IC  GTC+N+PGS+ C C +GF    M                                   PG      G  C D +EC+ + +LC+NG C N  GS+QC CN+GY ++  +Q CV +          E + +   C  +C  S+G + CSC  G   + +T  C+ + +  D  +
Sbjct:  540 CKPGFYLVPSGRYCLDIDECQTHGICMNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCP-TPGFDNG--GKDINECALN---------PEICTNGQCENQLGTYRCVCNIGYESDITGKKCVD-VDECM-LRAHLCDNGSCRNTPGSYTCACPAGYLFKHETEMCEDV-DECESNPCINGNC-QNTVGSFTCVCLPTSKLDQTKTICIESTKGTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSPCEPCELDTICPKGFSRAKGTQCEDVNEC--EVFAGICVNSRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINECKVFPQMCSNGKCRNTIGSFKCNCENGFVLDAEGKNCTDIDECKISHDICGMGTCVNTPGSFDCECMEGFESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFKCLCPPGHDLNEDGTVCLDVDECSLSGNLCRNGRCVNMIGSYQCSCNTGYSATPDRQGCVDID---------ECTIMNGGCDTHCSNSDGSYECSCERGYALLPDTRSCSDIDECEDNPY 1187          

HSP 7 Score: 115.546 bits (288), Expect = 2.250e-26
Identity = 93/333 (27.93%), Postives = 143/333 (42.94%), Query Frame = 3
Query: 1134 VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE----YKTNQMNDVASSF---SLKTQC---------------------DKFGSF---------------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQC 1985
            +D C  YNG VC NG+CV+    + C C++G+  + D + C    +    ++C +G CI + +  ++C C PGF  +  G+ C                        DID C        C  G CIN +  ++CEC PG ++   G+ C +       Y    M    + F   + K++C                     D +                        +C NG+C     +Y+C CN GY++ + GK C D+DEC +   +CD G+C N+PGSY C+C  G+   +      C D +EC   ++ C NG C+NT GSF C C
Sbjct:  473 IDECV-YNGQVCKNGRCVNTEGSFQCICNAGFELTADGRNCLDHDECSTTNMCLNGMCINE-DGSFKCICKPGFYLVPSGRYCL-----------------------DIDEC---QTHGICMNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGGKDINECALNPEICTNGQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCRNTPGSYTCACPAGYLFKHET--EMCEDVDEC--ESNPCINGNCQNTVGSFTCVC 773          

HSP 8 Score: 114.775 bits (286), Expect = 4.195e-26
Identity = 148/578 (25.61%), Postives = 230/578 (39.79%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQ--WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI---------------------------------------------CDLYP-------RSLCPDGQCI-PQP-----NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSS--NEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE---YKTNQM----NDVASSFSLKTQCDKFGSFLCNNGRCIE----SGSSYQCQCN---TGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C +G+      CQD++EC           KC+N  G+F C+C   +  D     CV   +  E + NLC  G  C++ S   + C+C  G+V ++DG+SC        D C F    +C FGKC      ++C C+ GY     G +C    +     N   C NG C +    ++C C + Y  S   + C                                                C+L P       R LCP G+   P P      +  EC  LPG     +G  C+        +       NED++  + DID C  + +   C  G C N+  +Y C C P ++    G  C +  +   YKT       N+++ + + K  C  +      N  C+     S  ++   C     GY+  ++     DIDECS    IC  G C+N PGS++C C  GF  +++     C D NEC     +C +N  C N+ GS++C+C+ GY  +     C+   + S +     P +        C+ + G + C CPNG  A  +  +C  V +
Sbjct: 1290 CIEGYFGDGVKCQDVDECANGTHNCIPEAKCVNIPGTFTCVCRDGFSGD--GQTCVDMDECAENV-NLCEFGQ-CLN-SAGGYRCECEMGFVPTVDGRSCKD-----IDECMFDN--ICVFGKCENVPGMFRCVCDPGYEIDETGGNCTDKDECADPSN---CFNGICTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRILCPGGEGFRPNPYTVILEDIDECTELPGLC---QGGNCQNTFGSFKCVCQPGFRFNEDNRQCE-DIDEC--ANFPTVCGPGTCYNIVGNYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQGICTNGMCVNLPGSFRCECPMGFLYNDIQ--IICEDINECASAEKMCQRNAECINSVGSYRCECSPGYTQTPFGL-CIDRDECSEKPEICSPGR--------CQDTEGSYRCMCPNGYKATEDQNMCMDVDE 1835          

HSP 9 Score: 113.62 bits (283), Expect = 1.001e-25
Identity = 126/467 (26.98%), Postives = 181/467 (38.76%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLC---------------------GPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVS 2030
            C D NEC+    IC++G+CIN  GS++C+C+  +  +  + +CV  ++     E I +LC                     G G  C        + Y  LC   PGY  + DG+          D C    P +CH G+CI    +Y C CN GY        C   +D C +       N  C +    Y C C  GY    D + C  + +   +       C+     G+ C+C PGF       Q      D +E         SK                    G C N    + CEC  GF LD  G  C++  E                      G+  C +G C      Y+C C +GY        C D +EC+ NP +C   +C N+ GS++C+C +G+      GG  C D NEC+ + + C  G C NT G + C C  GY  + +   CVS
Sbjct: 2235 CIDENECRLKPGICENGRCINNVGSYKCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGY--TTDGRD--------IDECTVM-PGMCHHGQCINSEGSYHCMCNNGYTTDITRTGCVD-LDECAQSPKPC--NFICKNTEGSYQCACPRGYIMQEDGRTCRDLDECASKQHNCQFLCV-NTIGGFTCKCPPGFT------QHHTACIDNNECVSQPGTCGSK--------------------GVCQNSPGSFSCECQKGFSLDNSGSNCEDMDECS--------------------GNHRCQHG-CQNMLGGYRCGCPSGYLQHFQWNQCVDENECT-NPQVCGSASCYNTLGSFKCACPNGYNFDQFSGG--CNDVNECSHSKAPCNFG-CSNTEGGYLCGCPPGYFRAGQGH-CVS 2634          

HSP 10 Score: 112.849 bits (281), Expect = 1.482e-25
Identity = 132/507 (26.04%), Postives = 207/507 (40.83%), Query Frame = 3
Query:  669 RCELGRCEKGFIE-IDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC-------------SKQSANKYDMCRF-YGPYVCHFGKCIADGYNYKCEC--------NQGYIASSDGKSCK--------KTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINM-KNHYRCECLPGFVLDKQGQACKERVEYKTNQM-NDVASSFSLKT---------QCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQ 2051
            RCE   CE GF+  +DG  C+DI+EC +  IC  GKC N  G FRC+C   Y+ D    +C   K +C   P+ C  G+   + +  + LC C   Y  S  G+ C             S +  +    C    G  +     C + G  +   C         +  I    G+  +        + +D CT   G+ C  G C +    + C C  G+  + D ++C  I  C  +P ++C  G C     N Y C C P +  +  G  C  +                        FC+ +Y    C      N+ +    C    G   ++    C        NQ+   V   + +           +C K    +C NG C+    S++C+C  G+  +    +C DI+EC+    +C +   CINS GSY+C C  G+T    P G  C DR+EC+E   +C  G C++T GS++C C +GY ++  +  C+ V +   Q
Sbjct: 1368 RCE---CEMGFVPTVDGRSCKDIDECMFDNICVFGKCENVPGMFRCVCDPGYEIDETGGNCTD-KDECAD-PSNCFNGI--CTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRILCPGGEGFRPNPYTVILEDIDECTELPGL-CQGGNCQNTFGSFKCVCQPGFRFNEDNRQCEDIDECANFP-TVCGPGTCYNIVGN-YTCVCPPDYMQVNGGNNCMDMRKS---------------------FCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQG-ICTNGMCVNLPGSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRCECSPGYT--QTPFG-LCIDRDECSEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECERQ 1839          

HSP 11 Score: 108.612 bits (270), Expect = 2.978e-24
Identity = 124/493 (25.15%), Postives = 187/493 (37.93%), Query Frame = 3
Query:  687 CEKGFIEIDGI--CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPR-SLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDID------------------ECSINPSI--------CDQGTCINSP---------GSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            CE+G+  +     C DI+EC+ +  +C  G+C N  G +RCLC   +    V         +CE  PN+C  G      +  + +C C  G+        C+       D C            C     ++KC C +GY    DG  C+  VD C        P  KCV++   + C C  G+  S D + C  + +     +LC  GQC+     GY C C  GF P   G+ C+                       DID C +    + C  G C N+   +RC C PG+ +D+ G  C ++     ++  D ++ F               NG C  +  S+ C C   YQ S  G+ C   D                   C++   I        C  G    +P           Y+  C  G      P      D +ECTE   LC+ G C+NT+GSF+C C  G+  +   + C  + + +N
Sbjct: 1163 CERGYALLPDTRSCSDIDECEDNPYLCDGGQCTNVPGEYRCLCYDGF-ISSVDMKTCSDVNECELNPNICIHGK--CENTRGSFICHCKVGFTVKKGSTGCTD-----VDECEIGAHNCDMHATCANVQGSFKCTCIEGYFG--DGVKCQD-VDECANGTHNCIPEAKCVNIPGTFTCVCRDGF--SGDGQTCVDMDECAENVNLCEFGQCL-NSAGGYRCECEMGFVPTVDGRSCK-----------------------DIDECMFD---NICVFGKCENVPGMFRCVCDPGYEIDETGGNCTDK-----DECADPSNCF---------------NGICTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRILCPGGEGFRPNPYTVILEDIDECTELPGLCQGGNCQNTFGSFKCVCQPGFRFNEDNRQCEDIDECAN 1595          

HSP 12 Score: 103.605 bits (257), Expect = 1.188e-22
Identity = 88/280 (31.43%), Postives = 127/280 (45.36%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSX----------------------XXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ 989
            ++CG   +S+ CC G++    G+ C +PIC + CG +G C RPN C CS+G I+S+C  +  S                                      N G      RC C  GFTG  C  +   G CF  +S  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++ECQ    +CK G C+N  GS+ C C   ++   +   C +   +CE IP +C  G +C + +I ++ C C  G+    D  SC  Q
Sbjct:    2 NVCGSRFHSY-CCPGWKTLPGGNQCIVPICRHSCG-DGFCSRPNMCTCSSGQISSTCGSKSISQCNIRCMNGGSCADDHCSCGKGYTGTHCGQPVCDTGCQNGGRCIGPNRCACVYGFTGPHCERDYRTGPCFTQVSNQMCQGQVSGIVCTKGLCCATIGRAWGHPCEVCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCKGGTCVNTVGSYECKCPLGHKQSELSQQC-EDIDECETIPGICN-GGECKN-TIGSYFCNCPAGFSTPPDRSSCFDQ 276          

HSP 13 Score: 102.064 bits (253), Expect = 3.716e-22
Identity = 103/378 (27.25%), Postives = 160/378 (42.33%), Query Frame = 3
Query:  726 DINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCF 1856
            DI+EC ++ Q+CK+G+C+N  GSF+C+C++ ++      +C+   +      N+C  GM C++    +  C C PG+     G+ C        D C+ +G  +C  G+CI    ++KCEC  G I S DG+ C  T    T Y   +   GKC++            +  +  + +C                C   PN  +   CLP          C  + SD  ++   +   D+     DI+ C  +   + C  G C N    YRC C  G+  D  G+ C +  E                       + LC+NG C  +  SY C C  GY    + ++C D+DEC  NP I   G C N+ GS+ C C 
Sbjct:  472 DIDECVYNGQVCKNGRCVNTEGSFQCICNAGFELTADGRNCLDHDEC--STTNMCLNGM-CINED-GSFKCICKPGFYLVPSGRYCL-----DIDECQTHG--ICMNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDYM--MGKCLTP-----------FPGANTKSEC----------------CCANPNFAFGEPCLP----------CPAVNSDDYKMLCPTPGFDNGGK--DINEC--ALNPEICTNGQCENQLGTYRCVCNIGYESDITGKKCVDVDEC-------------------MLRAHLCDNGSCRNTPGSYTCACPAGYLFKHETEMCEDVDECESNPCI--NGNCQNTVGSFTCVCL 774          

HSP 14 Score: 93.5893 bits (231), Expect = 1.214e-19
Identity = 115/438 (26.26%), Postives = 174/438 (39.73%), Query Frame = 3
Query:  687 CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIA--DGYNYKCECNQGYIASSDGKSC-----------------------KKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ----CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
            C  GF +  DG  C D +EC  + +C +G CINE GSF+C+C   +   P    C+   +   Q   +C  G  C++    +  C+C PG + S+DG+ C     + +     YG Y+   GKC+    G N K EC       + G+ C                        K ++ C   N  +C NG+C +    Y C C+ GY S    KKC  + +   R+ LC +G C   P + Y C C  G+    + + C  +  D+ E  P                         C  G C N    + C CLP   LD+    C E  +  T  +N + +   +        S  C+            C+    C  G+  +  G  C D++EC +   IC    CIN+ GS++C C  G T+ +   G  C D
Sbjct:  499 CNAGFELTADGRNCLDHDECSTTNMCLNGMCINEDGSFKCICKPGFYLVPSGRYCLDIDEC--QTHGICMNGR-CINTE-GSFKCECPPGMIVSMDGRLC----IDTHMRSTCYGDYM--MGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGGKDINECA-LNPEICTNGQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCRNTPGS-YTCACPAGYLFKHETEMCEDV--DECESNP-------------------------CINGNCQNTVGSFTCVCLPTSKLDQTKTICIESTK-GTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSPCEPCELDTICPKGFSRA-KGTQCEDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLEST--GRTCID 893          

HSP 15 Score: 93.5893 bits (231), Expect = 1.463e-19
Identity = 60/165 (36.36%), Postives = 86/165 (52.12%), Query Frame = 3
Query: 1551 GFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNS 2045
            G V     Q C   +  + +        F+   +C   G  +C NGRC+ +  S+QC CN G++ + DG+ C D DECS   ++C  G CIN  GS++C C  GF +  +P G  C D +EC +T  +C NG C NT GSF+C+C  G I S   + C+     S
Sbjct:  442 GCVAPDSHQVCVFNINVRIHFAAFTMFEFADIDECVYNGQ-VCKNGRCVNTEGSFQCICNAGFELTADGRNCLDHDECSTT-NMCLNGMCINEDGSFKCICKPGFYL--VPSGRYCLDIDEC-QTHGICMNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRS 601          

HSP 16 Score: 72.7886 bits (177), Expect = 3.039e-13
Identity = 47/136 (34.56%), Postives = 70/136 (51.47%), Query Frame = 3
Query: 1767 SDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLC 2174
            +DIDEC  N  +C  G C+N+ GS+QC C  GF +     G  C D +EC+ TT++C NG+C N  GSF+C C  G+      + C+ +        + +   IC   +  C  + G F C CP G+   ++  LC
Sbjct:  471 ADIDECVYNGQVCKNGRCVNTEGSFQCICNAGFEL--TADGRNCLDHDECS-TTNMCLNGMCINEDGSFKCICKPGFYLVPSGRYCLDID-------ECQTHGICM--NGRCINTEGSFKCECPPGMIVSMDGRLC 594          

HSP 17 Score: 62.003 bits (149), Expect = 5.987e-10
Identity = 87/312 (27.88%), Postives = 132/312 (42.31%), Query Frame = 3
Query: 1077 CECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERV--EYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGIC----KNTYGSFQCQCNSG 1994
            C C+ G I+S+ G    K++  C     + C NG   S ++D+ C C  GYT ++  +    +CD   ++    G+CI  PN    C C+ GF     G  C R        GP  +   ++  QG +     +      KG  C  +   +     P  V   Q   C+       +T    DV    ++          +C  G C+ +  SY+C+C  G++ S   + C DIDEC   P IC+ G C N+ GSY C+C  GF+    P    C+D+       SL  NG C    +  +   QC C+SG
Sbjct:   45 CTCSSGQISSTCGS---KSISQCN----IRCMNGG--SCADDH-CSCGKGYTGTHCGQP---VCDTGCQN---GGRCI-GPN---RCACVYGFT----GPHCER----DYRTGPCFTQVSNQMCQGQVSGIVCT------KGLCCATIGRAWG---HPCEVCPAQPHPCRRGFIPNIRTGACQDVDECQAIPG--------MCKGGTCVNTVGSYECKCPLGHKQSELSQQCEDIDECETIPGICNGGECKNTIGSYFCNCPAGFSTP--PDRSSCFDQRTGACYASL-ANGRCSAVMQGQFTRTQCCCDSG 308          

HSP 18 Score: 56.9954 bits (136), Expect = 2.353e-8
Identity = 92/383 (24.02%), Postives = 142/383 (37.08%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQL-SKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC----------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFY-----GPYVC--------HFGKCIADGY-------------------NYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY------DRKKCTS--ICDLYP--------RSLCPDGQCIPQ------------------------PNNGYECRCLPGFAPMGKGK 1376
            +C C  GFT       C +   G CF  + + +C        L +K  CC      WG  C  C L     G  +   +C          +DI+EC     +C  G+CIN  GS+ C+C++ Y  D  +  CV   + C Q P  C     C +    ++ C C  GY+   DG++C    + A+K   C+F      G + C        H   CI +                     ++ CEC +G+   + G +C+  +D C+  +   C +G C ++   Y C C SGY   +      D  +CT+  +C            +  CP+G    Q                           GY C C PG+   G+G 
Sbjct: 2261 KCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPL----PGTAQYKKLCPHGPGYTTDGRDIDECTVMPGMCHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDE-CAQSPKPCN--FICKNTE-GSYQCACPRGYIMQEDGRTCRDLDECASKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCED-MDECSGNH--RCQHG-CQNMLGGYRCGCPSGYLQHFQWNQCVDENECTNPQVCGSASCYNTLGSFKCACPNGYNFDQFSGGCNDVNECSHSKAPCNFGCSNTEGGYLCGCPPGYFRAGQGH 2631          

HSP 19 Score: 52.373 bits (124), Expect = 4.858e-7
Identity = 61/199 (30.65%), Postives = 79/199 (39.70%), Query Frame = 3
Query:  501 CQCKPGFTGKSCSEIVNGECFLSL----SRGVCMKHP----------YGLQLSKELCCGAFQVAWGDPCQR-CE--LGR----CEKGFIEI--DGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGP 1028
            C+C PGFT    + I N EC        S+GVC   P          + L  S   C    + +    CQ  C+  LG     C  G+++      C D NEC   Q+C S  C N  GSF+C C + Y FD     C     +C      C  G    S +   +LC C PGY ++  G   S  SA        YGP
Sbjct: 2455 CKCPPGFTQHHTACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCEDMDECSGNHRCQHGCQNMLGGYRCGCPSGYLQHFQWNQCVDENECTNPQVCGSASCYNTLGSFKCACPNGYNFDQFSGGC-NDVNECSHSKAPCNFG---CSNTEGGYLCGCPPGYFRAGQGHCVSGGSAGGKSA---YGP 2646          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005398.1 (pep scaffold:Pmarinus_7.0:GL477786:13802:46188:-1 gene:ENSPMAG00000004892.1 transcript:ENSPMAT00000005398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 1.750e-36
Identity = 145/467 (31.05%), Postives = 201/467 (43.04%), Query Frame = 3
Query:  864 CEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDR---KKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA-------------PMGKGKQ-CRRIMSDQSEIGPTSSNEDSKSSQ-----GDIDFCFYSYYRDQCKGGACINMKNHYRCECLP-GFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCS--HYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C Q P++CG G +CV L    H C C  GY  +     C        D C    P  C  G+C      ++C C+QGY AS  G  C   VD C R +     NG+CV+ +  Y C CD GY+ S D+   ++   + +     LCP G+C+  P +     C PG+              P  K K+ CR++   Q EI  TS+              DID C        C    C+N+   + C   P GF      +A   + E     +N  A               +C +GRCI+   SY+C CN G+  S +GK C D+DEC+  P  C  G C+N+PGS++CSC  GF + +   G  C D +EC+ T + C+ G C NT GSFQC C  G+ +      C S         D +       CS   YC  S G F C C  G     E   C  +++
Sbjct:    4 CLQTPDICGHG-ECVHLD-RGHTCVCNGGYKLNPSLTHCID-----VDEC-ARSPAPCPGGRCENTRGGFRCVCSQGYAASRGGTECID-VDECERADACG-GNGRCVNTAGGYTCNCDRGYSLSTDKGETRRSEYVNECENTILCPGGRCVNLPGSHRCEFCDPGYQWRGQTGGVDERRRPKTKSKERCRKLA--QREITNTSTTPPLSPPHLNLIAADIDEC---QNPQACINKRCVNIPGAFECVLCPTGF------KAAGTKCEDVNECLNSTA---------------VCRDGRCIDLQGSYRCSCNPGFAPSGNGKRCDDVDECAERP--CQNGECVNTPGSFKCSCPPGFQLSD---GTNCRDIDECS-TGNECEGGTCINTVGSFQCGCQPGFAALPGTDLCCSA--------DVDECDNATACSEHQYCINSMGSFQCHCDQGYQTAKEGLGCVDINE 420          

HSP 2 Score: 95.9005 bits (237), Expect = 1.253e-20
Identity = 115/448 (25.67%), Postives = 179/448 (39.96%), Query Frame = 3
Query:  660 PCQRCELGR------CEKGFIEIDG--ICQDINECQWSQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPN--LCGPGMDCVSLSIYNHLCKCLPGY--------------VKSLDGKSCSKQSANKY-------------------DMCRFYGPYVCHFGKCIADGYNYKCE-CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFV-LDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            P  RCE  R      C +G+    G   C D++EC+ +  C  +G+C+N  G + C C   Y     + +  +R +   +  N  LC PG  CV+L   +    C PGY               K+   + C K +  +                    D+     P  C   +C+     ++C  C  G+ A+  G  C+  V+ C      VC +G+C+ L   Y C C+ G+  S + K+C  + D      C +G+C+  P + ++C C PGF  +  G  CR                       DID C      ++C+GG CIN    ++C C PGF  L      C   V+                 +CD   +    +  CI S  S+QC C+ GYQ + +G  C DI+EC     +C    C N  G++ C C + +
Sbjct:   54 PGGRCENTRGGFRCVCSQGYAASRGGTECIDVDECERADACGGNGRCVNTAGGYTCNCDRGYSLSTDKGE-TRRSEYVNECENTILC-PGGRCVNLPGSHRCEFCDPGYQWRGQTGGVDERRRPKTKSKERCRKLAQREITNTSTTPPLSPPHLNLIAADIDECQNPQACINKRCVNIPGAFECVLCPTGFKAA--GTKCED-VNECLNST-AVCRDGRCIDLQGSYRCSCNPGFAPSGNGKRCDDV-DECAERPCQNGECVNTPGS-FKCSCPPGFQ-LSDGTNCR-----------------------DIDECSTG---NECEGGTCINTVGSFQCGCQPGFAALPGTDLCCSADVD-----------------ECDN-ATACSEHQYCINSMGSFQCHCDQGYQTAKEGLGCVDINECETITEVCGSELCDNEEGTFLCICPNDY 448          

HSP 3 Score: 85.5001 bits (210), Expect = 2.079e-17
Identity = 120/516 (23.26%), Postives = 196/516 (37.98%), Query Frame = 3
Query:  729 INECQWSQICKSGKCINERGSFRC-LCSSSYQF-------DPVQADCVQRKKKCEQI-----------PNLCGPGMDCVSLSI---------YNHLCKCLPGYVKSLDGKSCSKQSANKYDMCR--FYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSN-------------------EDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRC--------------ECLPGFVLDKQGQACKERVE--YKTNQ----MNDVASSFSLKTQCDKFGSFL---CNNGRCIESGS---SYQCQCNTGYQASLDGKLCSDIDECSI-NPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSN 2048
            +NEC+ + +C  G+C+N  GS RC  C   YQ+       D  +    + K++C ++           P L  P ++ ++  I          N  C  +PG  + +   +  K +  K +          VC  G+CI    +Y+C CN G+  S +GK C   VD C       C NG+CV+    + C C  G+  S D   C  I +    + C  G CI      ++C C PGFA +     C     D+ +     S                    + +K   G +D        + C    C N +  + C              +C+P   +  Q     ER E  +  N      N +  + +    C   G+     C    C   G+   +  C    G   S +G+   D DEC++ +  +C    C+N+   Y+C C  G+          C D +EC E +  C +G C N+ GS+ C C +     +  + CV+   +S+
Sbjct:  130 VNECENTILCPGGRCVNLPGSHRCEFCDPGYQWRGQTGGVDERRRPKTKSKERCRKLAQREITNTSTTPPLSPPHLNLIAADIDECQNPQACINKRCVNIPGAFECVLCPTGFKAAGTKCEDVNECLNSTAVCRDGRCIDLQGSYRCSCNPGFAPSGNGKRCDD-VDECAER---PCQNGECVNTPGSFKCSCPPGFQLS-DGTNCRDIDECSTGNECEGGTCI-NTVGSFQCGCQPGFAALPGTDLCCSADVDECDNATACSEHQYCINSMGSFQCHCDQGYQTAKEGLGCVDINECETITEVCGSELCDNEEGTFLCICPNDYQEFDSQLGKCVPEPTVGSQSHVPAERRECYFNVNDENVCRNVLGRNVTRDECCCTVGAGWGTDCEPSPCPLEGTREFNELCPEGKGLVPSPNGRGYRDADECTLFSQELCRDSLCVNTQAGYKCYCRTGYLYDRSR--LHCTDVDEC-ENSQSCVDGQCYNSEGSYSCYCTAPLTLDHTGRRCVNRTASSS 636          

HSP 4 Score: 77.411 bits (189), Expect = 7.143e-15
Identity = 105/437 (24.03%), Postives = 171/437 (39.13%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIA-SSDGKSCKKTVDFCTRYNGVVCPNGK-CVSLSNDYICQCDSGYTSS------YDRKKCTSICDLYPRSLCPD--------------------GQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER-VEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDR 1907
            C  GF      C+D+NEC   + +C+ G+CI+ +GS+RC C+  +        C     +C + P   G   +CV+ +  +  C C PG+  S DG +C        D C       C  G CI    +++C C  G+ A       C   VD C   N   C   + C++    + C CD GY ++       D  +C +I ++    LC +                    G+C+P+P  G +        P  + ++C   ++D+                   + C     R+  +   C  +   +  +C P     +  +   E   E K    +     +    +C  F   LC +  C+ + + Y+C C TGY        C+D+DEC  N   C  G C NS GSY C C    T+ +   G +C +R
Sbjct:  238 CPTGFKAAGTKCEDVNECLNSTAVCRDGRCIDLQGSYRCSCNPGFAPSGNGKRC-DDVDECAERPCQNG---ECVN-TPGSFKCSCPPGFQLS-DGTNC-----RDIDECSTGNE--CEGGTCINTVGSFQCGCQPGFAALPGTDLCCSADVDECD--NATACSEHQYCINSMGSFQCHCDQGYQTAKEGLGCVDINECETITEVCGSELCDNEEGTFLCICPNDYQEFDSQLGKCVPEPTVGSQ-----SHVPAER-RECYFNVNDE-------------------NVCRNVLGRNVTRDECCCTVGAGWGTDCEPSPCPLEGTREFNELCPEGKGLVPSPNGRGYRDADECTLFSQELCRDSLCVNTQAGYKCYCRTGYLYDRSRLHCTDVDECE-NSQSCVDGQCYNSEGSYSCYCTAPLTLDHT--GRRCVNR 631          

HSP 5 Score: 59.3066 bits (142), Expect = 2.896e-9
Identity = 65/253 (25.69%), Postives = 105/253 (41.50%), Query Frame = 3
Query:  684 RCEKGF-IEIDGI-CQDINECQW-SQICKSGKCINERGSFRCLCSSSYQ-FDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADG---YNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPT 1421
             C++G+    +G+ C DINEC+  +++C S  C NE G+F C+C + YQ FD     CV       Q  ++     +C       ++C+ + G   + D   C+  +    D         C    C  +G   +N  C   +G + S +G+   +  D CT ++  +C +  CV+    Y C C +GY     R  CT + +      C DGQC       Y C C         G++C    +  S   P 
Sbjct:  401 HCDQGYQTAKEGLGCVDINECETITEVCGSELCDNEEGTFLCICPNDYQEFDSQLGKCVPEPTVGSQ-SHVPAERRECYFNVNDENVCRNVLGRNVTRDECCCTVGAGWGTD---------CEPSPCPLEGTREFNELCPEGKGLVPSPNGRG-YRDADECTLFSQELCRDSLCVNTQAGYKCYCRTGYLYDRSRLHCTDVDECENSQSCVDGQCY-NSEGSYSCYCTAPLTLDHTGRRCVNRTASSSGDDPA 641          

HSP 6 Score: 56.225 bits (134), Expect = 2.920e-8
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 1773 IDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            ++ C   P IC  G C++    + C C  G+ ++  P    C D +EC  + + C  G C+NT G F+C C+ GY +S    +C+ V +
Sbjct:    1 VNTCLQTPDICGHGECVHLDRGHTCVCNGGYKLN--PSLTHCIDVDECARSPAPCPGGRCENTRGGFRCVCSQGYAASRGGTECIDVDE 87          

HSP 7 Score: 50.0618 bits (118), Expect = 2.116e-6
Identity = 104/428 (24.30%), Postives = 152/428 (35.51%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECF-LSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQ---------RCELGRC-----------EKGFIEIDGI----CQDINECQWSQICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGM--------DCVSLSIY----NHLCKCLPGYVKSLDGKSCSKQ-----SANKYDMCR-FYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSF 1637
            RC C PGF     GK C ++   EC       G C+  P   + S   C   FQ++ G  C+          CE G C           + GF  + G       D++EC  +  C   + CIN  GSF+C C   YQ       CV    +CE I  +CG  +         C+  + Y    + L KC+P           +++     + N  ++CR   G  V     C   G  +  +C                    TR    +CP GK +  S +       GY  + +       C L+ + LC D  C+     GY+C C  G+            + D+S +  T           D+D C  S     C  G C N +  Y C C     LD  G+ C  R    ++  +D A  F
Sbjct:  275 RCSCNPGFAPSGNGKRCDDV--DECAERPCQNGECVNTPGSFKCS---CPPGFQLSDGTNCRDIDECSTGNECEGGTCINTVGSFQCGCQPGFAALPGTDLCCSADVDECDNATACSEHQYCINSMGSFQCHCDQGYQTAKEGLGCVD-INECETITEVCGSELCDNEEGTFLCICPNDYQEFDSQLGKCVPEPTVGSQSHVPAERRECYFNVNDENVCRNVLGRNVTRDECCCTVGAGWGTDCEPSPCPLEG-----------TREFNELCPEGKGLVPSPN-----GRGYRDADE-------CTLFSQELCRDSLCV-NTQAGYKCYCRTGY------------LYDRSRLHCT-----------DVDECENS---QSCVDGQCYNSEGSYSCYCTAPLTLDHTGRRCVNRT--ASSSGDDPAHVF 644          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010139.1 (pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 gene:ENSPMAG00000009155.1 transcript:ENSPMAT00000010139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 1.735e-32
Identity = 136/462 (29.44%), Postives = 203/462 (43.94%), Query Frame = 3
Query:  687 CEKGFIEID--GICQDINECQWSQICKSGKCINERGSFRC-LCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKC-ECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC-PDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQC--QCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVS 2030
            C  GFI  D    CQDINEC     C  G+CIN  GS+RC  C + +  +         + +CE +     PN C P   CV+        +C  G+           ++ +  D+       VC  G C     +Y C  C  G+  +S+GK+C+  +D C   NG+VC  G CV+    + C+C  GY  S    +C  I +    S+C P G C+   +  + C C  G+     G+ C+                       D+D C       QC GG C+N +  + CEC PG  L+     C +  E                  C +F S  C + RC  +  SY+C   C+ GY+ S   + C DIDEC ++ ++C + G C N+ GS++C C  G+  H++  G +C D NEC   +S+C  + +C+N  GSF C C       NK+ D +S
Sbjct:  772 CRPGFIFDDSGAECQDINECLKVNKCIGGRCINLPGSYRCEFCDAGHVMN--------TRGQCEDVNECRNPNTC-PTAKCVNTPGSYECVRCPSGF---------EGRNGHCIDVDECADGNVCSNGICANTEGSYSCTPCGTGFRLTSNGKACED-IDEC--QNGIVCGGGDCVNTRGSFQCECQPGYHLSSGGDQCEDINECLSESVCEPHGDCL-NTDGSFYCVCHHGYKSSANGRFCK-----------------------DVDECSEG---QQCPGGQCVNTEGSFTCECEPGLRLNPGTHTCVDIDE------------------CAEFDSSRCGSWRCENTHGSYRCVQACDRGYRLSSTAE-CQDIDEC-LDDTVCGRNGFCENTEGSFRCLCDQGY--HDLQDGQECIDVNECEMFSSVCGDDALCENVEGSFLCICQ----QHNKEFDTMS 1159          

HSP 2 Score: 124.79 bits (312), Expect = 2.918e-29
Identity = 127/466 (27.25%), Postives = 199/466 (42.70%), Query Frame = 3
Query:  843 CVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQ-CDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYEC-RCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG---------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTE-------------------------------TTSLC-------------KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C +    C   PN+CGPG  C +L +  + C C  GY  +     C     +  D C    P +C  G+C     +++C C  G+I    G  C+  ++ C + N   C  G+C++L   Y C+ CD+G+  +  R +C  + +    + CP  +C+  P + YEC RC  GF   G+   C  I  D+   G   SN    +++G                     DID C        C GG C+N +  ++CEC PG+ L   G  C++        +N+  S    ++ C+  G        C+ +  S+ C C+ GY++S +G+ C D+DECS     C  G C+N+ GS+ C C  G  ++  PG   C D +EC E                               +T+ C             +NG C+NT GSF+C C+ GY      Q+C+ V +
Sbjct:  700 CPRESDICLLRPNICGPGQ-CYNLDV-GYTCTCHFGYQYNEQLGRC-----DDIDECSTV-PRLCANGRCENVIGSFRCICRPGFIFDDSGAECQD-INECLKVNK--CIGGRCINLPGSYRCEFCDAGHVMNT-RGQCEDVNECRNPNTCPTAKCVNTPGS-YECVRCPSGFE--GRNGHC--IDVDECADGNVCSNGICANTEGSYSCTPCGTGFRLTSNGKACEDIDECQNGIV---CGGGDCVNTRGSFQCECQPGYHLSSGGDQCED--------INECLS----ESVCEPHGD-------CLNTDGSFYCVCHHGYKSSANGRFCKDVDECSEGQQ-CPGGQCVNTEGSFTCECEPGLRLN--PGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRCVQACDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECIDVNE 1123          

HSP 3 Score: 82.4185 bits (202), Expect = 3.481e-16
Identity = 123/516 (23.84%), Postives = 198/516 (38.37%), Query Frame = 3
Query:  687 CEKGF-IEIDGICQDINECQWSQIC-KSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKC------------------------LPG------YVKSLDGKSCSKQSA---NKYDMCRFYGPYV---CHFGKCIADG---YNYKCECNQGYIASSDG-----KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKK--CTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRD-QCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDV--ASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNEC---TETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPS 2072
            C++G+ +     CQDI+EC    +C ++G C N  GSFRCLC   Y       +C+    +CE   ++CG    C ++   + LC C                         PG      YV   D   C    A    +++ C   G      C    C   G   +   C   +G+I + D          K  D C  +   +C  G C +  + Y C C SG+   YDR+K  C  + +      C  G C+   +  ++C C P       GK+C     + S +      ED++     +  C+ +   D  C          +  C C  G         C ER      Q+ ++       ++    + G+ + +         + Q   ++G   S +G       EC I  + C+ G C+  P  Y C C+DG+ +        C D NEC    E  SLC+N  C NT GS++C C  G++ S +   CV +Q+    ++  +P+
Sbjct: 1064 CDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECID-VNECEMFSSVCGDDALCENVE-GSFLCICQQHNKEFDTMSGKCVDRHSIVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDTIPQDFKDADECILFGQEICKRGTCHNTEHGYKCFCKSGFY--YDRQKLECLDVDECTDEWSCEGGSCV-NTDGSFDCFCRPPLILDSNGKRC----VNSSGLLERHEEEDAEML---MSMCWRAMGNDFMCSQLILGKETTYTECCCQYGEAWGPDCALCPERNTDDFAQLCNIPRGGDPDMRRVSGQRGTIVSDVSMHFVK-HTEQITFSSGLFDSFEGL---QAQECGIL-NGCENGRCVRVPEGYTCDCYDGYQLDL--SRMVCTDVNECEELNERMSLCRNAKCMNTQGSYRCACLPGFVPSQQPNFCVKIQNERENRHKRKPN 1560          

HSP 4 Score: 80.4925 bits (197), Expect = 1.125e-15
Identity = 141/582 (24.23%), Postives = 226/582 (38.83%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSR---GVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCL-CSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMS----DQSEIGPTSSNEDSKSSQGDIDFCFYSYYR---------DQC-------KGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKF-GSFLC-----------NNGRCIESGS-----SYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGS------YQCSCFDGFTIHNM-PGG--------------PKCY-DRNECTE-TTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            RC C+PGF    +G  C +I   EC L +++   G C+  P           G+++      C+ C+ G      +   G C+D+NEC+    C + KC+N  GS+ C+ C S   F+     C+   +  +   N+C  G+ C +         C  G+  + +GK+C        D C+     VC  G C+    +++CEC  GY  SS G  C+  ++ C     V  P+G C++    + C C  GY SS + + C  + +      CP GQC+      + C C PG         C  I      D S  G +   E++  S   +  C   Y           D+C       + G C N +  +RC C  G+   + GQ C +      N+    +S       C+   GSFLC            +G+C++  S     +   +    Y    D   C ++   ++    C    C    G       Y C         N+ P G              P+ + D +EC      +CK G C NT   ++C C SG+    +K +C+ V +
Sbjct:  769 RCICRPGFIFDDSGAECQDI--NEC-LKVNKCIGGRCINLP-----------GSYR------CEFCDAGH----VMNTRGQCEDVNECRNPNTCPTAKCVNTPGSYECVRCPSG--FEGRNGHCIDVDECADG--NVCSNGI-CANTEGSYSCTPCGTGFRLTSNGKACED-----IDECQ--NGIVCGGGDCVNTRGSFQCECQPGYHLSSGGDQCED-INECLS-ESVCEPHGDCLNTDGSFYCVCHHGYKSSANGRFCKDVDECSEGQQCPGGQCV-NTEGSFTCECEPGLRLNPGTHTCVDIDECAEFDSSRCG-SWRCENTHGSYRCVQACDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECID-----VNECEMFSSVCGDDALCENVEGSFLCICQQHNKEFDTMSGKCVDRHSIVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHEC---CCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDTIPQDFKDADECILFGQEICKRGTCHNTEHGYKCFCKSGFYYDRQKLECLDVDE 1302          

HSP 5 Score: 76.6406 bits (187), Expect = 1.957e-14
Identity = 107/441 (24.26%), Postives = 165/441 (37.41%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSL--SIYNHLCKCLPGYVKSLDGKSCS------------------------------------KQSANKYDMCRFYGPYVCHFGKCIADGYNYKC--ECNQGYIASSDGKSCKKTVDFCTRYNGVVC-PNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPG---FAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDK----------QGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSC 1853
            C+DI+ECQ   +C  G C+N RGSF+C C   Y              +CE I      ++C P  DC++   S Y   C C  GY  S +G+ C                                       +    D C  +    C   +C     +Y+C   C++GY  SS  +   + +D C   +  VC  NG C +    + C CD GY    D ++C  +  C+++  S+C D          + C C      F  M      R  + D     P    ++   +  D +FC      +  +   C  +   +   CE  P  VL            +G    E + Y T     +   F    +C  FG  +C  G C  +   Y+C C +G+        C D+DEC+   S C+ G+C+N+ GS+ C C
Sbjct:  908 CEDIDECQNGIVCGGGDCVNTRGSFQCECQPGYHLS-------SGGDQCEDINECLSESVCEPHGDCLNTDGSFY---CVCHHGYKSSANGRFCKDVDECSEGQQCPGGQCVNTEGSFTCECEPGLRLNPGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRCVQACDRGYRLSSTAEC--QDIDEC--LDDTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECIDVNECEMF-SSVCGDDALCENVEGSFLCICQQHNKEFDTMSGKCVDRHSIVDSR--APGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDT-----IPQDFKDADECILFGQEICKRGTCHNTEHGYKCFCKSGFYYDRQKLECLDVDECTDEWS-CEGGSCVNTDGSFDCFC 1325          

HSP 6 Score: 71.2478 bits (173), Expect = 9.574e-13
Identity = 58/177 (32.77%), Postives = 85/177 (48.02%), Query Frame = 3
Query: 1674 LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQ-CNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVC-SCPNGLDAVLETGLCAKVSQIVD 2198
            +C  G+C      Y C C+ GYQ +     C DIDECS  P +C  G C N  GS++C C  GF   +   G +C D NEC +    C  G C N  GS++C+ C++G++ + + Q C  V +  N   +T P+  C         + G + C  CP+G +     G C  V +  D
Sbjct:  713 ICGPGQCYNLDVGYTCTCHFGYQYNEQLGRCDDIDECSTVPRLCANGRCENVIGSFRCICRPGFIFDD--SGAECQDINECLKVNK-CIGGRCINLPGSYRCEFCDAGHVMNTRGQ-CEDVNECRNP--NTCPTAKCVN-------TPGSYECVRCPSGFEG--RNGHCIDVDECAD 874          

HSP 7 Score: 59.3066 bits (142), Expect = 3.447e-9
Identity = 98/449 (21.83%), Postives = 157/449 (34.97%), Query Frame = 3
Query:  555 ECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE---LGRCE--------KGFIEIDGIC--------QDINECQW--SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRY---NGVVCPNGKCVSLSNDYIC-QCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFA-----PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDF---CFYSYYRDQ---------CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDI 1775
            EC+++L+      +   + L++  CC      WGD C+      LG  E        KGFI  + I         +D +EC     +ICK G C N    ++C C S + +D  + +C                                       LD   C+ +             + C  G C+    ++ C C    I  S+GK C  +     R+   +  +  +    ++ ND++C Q   G  ++Y     T  C  Y  +  PD    P+ N          FA     P G     RR+   +  I    S    K ++  I F    F S+   Q         C+ G C+ +   Y C+C  G+ LD     C +  E +  ++N+  S              LC N +C+ +  SY+C C  G+  S     C  I
Sbjct: 1180 ECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDTIPQDFKDADECILFGQEICKRGTCHNTEHGYKCFCKSGFYYDRQKLEC---------------------------------------LDVDECTDE-------------WSCEGGSCVNTDGSFDCFCRPPLILDSNGKRCVNSSGLLERHEEEDAEMLMSMCWRAMGNDFMCSQLILGKETTY-----TECCCQYGEAWGPDCALCPERNTD-------DFAQLCNIPRGGDPDMRRVSGQRGTIVSDVSMHFVKHTE-QITFSSGLFDSFEGLQAQECGILNGCENGRCVRVPEGYTCDCYDGYQLDLSRMVCTDVNECE--ELNERMS--------------LCRNAKCMNTQGSYRCACLPGFVPSQQPNFCVKI 1547          

HSP 8 Score: 54.299 bits (129), Expect = 1.354e-7
Identity = 37/113 (32.74%), Postives = 53/113 (46.90%), Query Frame = 3
Query:  576 RGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRC------------ELGRCEKGFI-EIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQ 872
            R  C K   GL L +E CCG+   +WG + C +C             +  C +GF  E    C+DINEC     C +  C+N +GS+RC+C S +  D     C+  K   E+
Sbjct:  394 RAQCGKPLPGL-LKQEDCCGSVGSSWGFNKCSKCPATAVQTQPGSSAMVECTQGFKRESATQCRDINECLIQGACPNADCLNTQGSYRCICKSGFTLDSTTNRCISNKALAEE 505          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006555.1 (pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-1 gene:ENSPMAG00000005922.1 transcript:ENSPMAT00000006555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 2.926e-25
Identity = 134/506 (26.48%), Postives = 199/506 (39.33%), Query Frame = 3
Query:  687 CEKGFIEIDG--ICQDINECQWS--QICKSGKCINERGSFRCLCSSSYQFD--PVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-----------LDGKSCSKQSA-----------------------NKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQ-----ASLDGKLCSDIDECSINPS-ICDQGT-CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYIS 2003
            C  G+  +     CQD++ECQ       +   C N  G++ C+C+S Y  +  P+Q  C+   +  +    LCG G  C + ++ ++ C+CL GYV +           L   +CS  S                           D C  +G   C  G  C+    +Y C C  GYI   +G  C   VD C   +     N  C +    + CQCD+G+  + ++    + C     + C  G         Y C CL G+  +G G  C  +          S+N   K++ G                  D++ C  S       G  C+N    Y C CL G++    G  C            DV         C         N  C  +  S+QCQC+ G+Q      S  G+ C D++EC  + S  C  G  C+N+ GSY C C  G+    +  G  C D +EC   ++ C  N  CKNT GSFQCQC++G+ S
Sbjct:   15 CVAGYAAVSDSRTCQDVDECQSGIYNCTQYSTCHNLDGNYTCICNSGYYLNEFPMQRTCIDVDECEKAGSALCGHGAYCAN-TLGSYACRCLVGYVGNGTVCLDVDECLLPSNNCSANSTCTNTPGSYQCQCDAGFQKTGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIG--NGTVCLD-VDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGY--IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYI--GNGTVCL-----------DVDECLLPSNNCSA-------NSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGY----IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQS 490          

HSP 2 Score: 103.219 bits (256), Expect = 1.117e-22
Identity = 117/389 (30.08%), Postives = 160/389 (41.13%), Query Frame = 3
Query: 1041 FGKCIADGYNYKCECNQGYIASSDGKSCKKT------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI----CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR-CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNEC-TETTSLCKNGI-CKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLE 2162
            +G C     ++KC C  GY A SD ++C+        +  CT+Y+        C +L  +Y C C+SGY  +    + T I    C+    +LC  G         Y CRCL G+  +G G  C                        D+D C      + C   + C N    Y+C+C  GF   K G+ C +  E                  C KFGS  C  G  C+ +  SY C C  GY    +G +C D+DEC +  + C    TC N+PGS+QC C  GF       G KC D NEC T  ++ C  G  C NT GS+ C C +GYI +     C+ V +         PS  C   +  CK + G F C C  G     E
Sbjct:    1 YGTCTDTIGSFKCGCVAGYAAVSDSRTCQDVDECQSGIYNCTQYS-------TCHNLDGNYTCICNSGYYLNEFPMQRTCIDVDECEKAGSALCGHGAYCANTLGSYACRCLVGY--VGNGTVCL-----------------------DVDECLLP--SNNCSANSTCTNTPGSYQCQCDAGF--QKTGEMCTDVDE------------------CLKFGSAACGQGAYCVNTVGSYNCPCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGF----QKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTV--CLDVDEC------LLPSNNCSA-NSTCKNTPGSFQCQCDAGFQKTGE 320          

HSP 3 Score: 94.3597 bits (233), Expect = 5.041e-20
Identity = 145/554 (26.17%), Postives = 210/554 (37.91%), Query Frame = 3
Query:  498 RCQCKPGF--TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQW-SQICKS-GKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-----------LDGKSCSKQSANK-----------------------YDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSY-----DRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQG---QACKERVEYKTNQMNDVASSFSLKTQCDK-FGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDEC-SINPSICDQGT-CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGY 1997
            +CQC  GF  TG+ C+++   EC L      C +  Y +       C                  C  G+I    +C D++EC   S  C +   C N  GSF+C C + +Q       CV   +        CGPG  CV+ ++ ++ C CL GY+ +           L   +CS  S  K                        + C+  G   C  G  C+    +Y C C  GYI   +G  C   VD C   +     N  C +    + CQCD+G+ + +       +KC  +  C     + C  G         Y C CL G+  +G G  C                        D+D C      + C   + C N    ++C+C  GF  D  G   + C     YK +         SL   C    G  L    +C   GSS     N     S  G+ C D++EC +   + C  G  C+N+ GSY C C  G+    +  G  C D +EC   ++ C  N  CKNT GSFQCQC++G+
Sbjct:  142 QCQCDAGFQKTGEMCTDV--DEC-LKFGSAACGQGAYCVNTVGSYNC-----------------PCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQ--KTGEKCVDVNECQTSGSAACGPGAYCVN-TVGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLD-VDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGY--IGNGTVCL-----------------------DVDECLLP--SNNCSANSTCKNTPGSFQCQCDAGFQSDFHGFGMRQCNLGSSYKLS-----IHKISLVMNCQSILGMMLYKLSKCCVLGSSAYS--NVFPPPSETGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGY----IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGF 631          

HSP 4 Score: 91.6633 bits (226), Expect = 3.706e-19
Identity = 109/386 (28.24%), Postives = 156/386 (40.41%), Query Frame = 3
Query:  915 SIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVC-HFGKCIADGYNYKCECNQGYIASS--DGKSCKKTVDFCTRYNGVVCPNGK-CVSLSNDYICQCDSGY----TSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPS-ICDQGT-CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            +I +  C C+ GY    D ++C        D C+  G Y C  +  C     NY C CN GY  +     ++C   VD C +    +C +G  C +    Y C+C  GY    T   D  +C     L P + C            Y+C+C  GF     G+ C                        D+D C         +G  C+N    Y C CL G++    G  C            DV         C         N  C  +  S+QCQC+ G+Q +  G+ C D++EC  + S  C  G  C+N+ GSY C C  G+    +  G  C D +EC   ++ C  N  CKNT GSFQCQC++G+  + +K  CV V +
Sbjct:    7 TIGSFKCGCVAGYAAVSDSRTCQ-----DVDECQ-SGIYNCTQYSTCHNLDGNYTCICNSGYYLNEFPMQRTCID-VDECEKAGSALCGHGAYCANTLGSYACRCLVGYVGNGTVCLDVDEC-----LLPSNNCSANSTCTNTPGSYQCQCDAGF--QKTGEMCT-----------------------DVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYI--GNGTVCL-----------DVDECLLPSNNCSA-------NSTCKNTPGSFQCQCDAGFQKT--GEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGY----IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK--CVDVNE 327          

HSP 5 Score: 86.6557 bits (213), Expect = 1.258e-17
Identity = 125/478 (26.15%), Postives = 188/478 (39.33%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQW-SQICKS-GKCINERGSFRCLCSSSYQ-----FDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPG---YVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKK-----CTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQ--------CRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSI-CDQGT-CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            C  G+I    +C D++EC   S  C +   C N  GSF+C C + +Q     F   Q +     K      +L       + + +Y     C+ G   Y       S + +     + C+ +G   C  G  C+    +Y C C  GYI   +G  C   VD C   +     N  C +    + CQCD+G+       K       S+  +Y   +         PN  YE         +GK K         C  ++     +     +E  +    D++ C  S       G  C+N    Y C CL G++    G  C            DV         C         N  C  +  S+QCQC+ G+Q +  G+ C D++EC  + S  C  G  C+N+ GSY C C  G+    +  G  C D +EC   ++ C  N  CKNT GSFQCQC++G+  + +K  CV V +
Sbjct:  443 CLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSDFHGFGMRQCNLGSSYKLSIHKISLVMNCQSILGMMLYKLSKCCVLGSSAYSNVFPPPSETGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLD-VDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQIQSSIHKSILGMMVSVVYIYIEFILQLFLARDYPNYSYE---------LGKNKNTAHQKNPTCPLLIFHFYGLKFIWISETGEKCV-DVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYI--GNGTLCL-----------DVDECLLPSNNCSA-------NSTCKNTPGSFQCQCDAGFQKT--GEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGY----IGNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK--CVDVNE 879          

HSP 6 Score: 80.8777 bits (198), Expect = 7.100e-16
Identity = 126/488 (25.82%), Postives = 176/488 (36.07%), Query Frame = 3
Query:  720 CQDINECQW--SQICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYV---------------KSLDGKSCSK-----QSANKYDMCRFYGPYVCHFGKCIADGYNYKCECN---------QGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGY----TSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSF------SLKTQCDK-----------------FGSFLCNNGR-CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNG-ICKNTYGSFQCQCNSGY 1997
            C D+NECQ   S  C  G  C+N  GS+ CLC + Y         +     C  +     P  +C +    N  CK  PG                 KS+ G   S      +   +  + R Y  Y    GK     +     C          +    S  G+ C    +  T  +    P   CV+    Y C C +GY    T   D  +C     L P + C            ++C+C  GF     G++C                        D++ C  S       G  C+N    Y C CL G++    G  C +  E      N  A+S       S + QCD                  FGS  C  G  C+ +  SY C C  GY    +G +C D+DEC +  + C    TC N+PGS+QC C  GF  +       C D NEC    ++C  G +C+NT GS++C C  GY
Sbjct:  555 CVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGY---------IGNGTVCLDVDECLLPSNNCSA----NSTCKNTPGSFQCQCDAGFQIQSSIHKSILGMMVSVVYIYIEFILQLFLARDYPNYSYELGKNKNTAHQKNPTCPLLIFHFYGLKFIWISETGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTLCLDVDEC-----LLPSNNCSANSTCKNTPGSFQCQCDAGF--QKTGEKCV-----------------------DVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGYI--GNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSN----ATVCEDINECGRVPAVCGLGTVCENTVGSYRCPCAPGY 991          

HSP 7 Score: 73.9442 bits (180), Expect = 1.200e-13
Identity = 107/434 (24.65%), Postives = 164/434 (37.79%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQW-SQICKS-GKCINERGSFRCLCSSSYQFDP---------------VQADCVQRKKKCEQIPNLCGP-GMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDM--CRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQG------------------DIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGT-CINSPGSYQCSCFDGF 1865
            C  G+I    +C D++EC   S  C +   C N  GSF+C C + +Q                  +  + + +       PN     G +  +    N  C  L  +   L     S+      D+  C+  G   C  G  C+    +Y C C  GYI   +G  C   VD C   +     N  C +    + CQCD+G+  + ++    + C     + C  G         Y C CL G+  +G G  C  +          S+N   K++ G                  D++ C  ++    C  GA C+N    Y C CL G++    G  C            DV         C         N  C  +  S+QCQC+ G+Q+  +  +C DI+EC   P++C  GT C N+ GSY+C C  G+
Sbjct:  586 CLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQIQSSIHKSILGMMVSVVYIYIEFILQLFLARDYPNYSYELGKNKNTAHQKNPTCPLLIFHFYGLKFIWISETGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIG--NGTLCLD-VDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGY--IGNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNEC-QTFGSAACGPGAYCVNTVGSYNCLCLAGYI--GNGTVCL-----------DVDECLLPSNNCSA-------NSTCKNTPGSFQCQCDAGFQS--NATVCEDINECGRVPAVCGLGTVCENTVGSYRCPCAPGY 991          

HSP 8 Score: 63.5438 bits (153), Expect = 1.711e-10
Identity = 134/532 (25.19%), Postives = 197/532 (37.03%), Query Frame = 3
Query:  684 RCEKGFIEIDGICQDINECQWS--QICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHL-----CKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTS---SYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQA------SLDGKLCSDI---DECSINPSIC--------DQGTCINSPGSYQCSC------FDGFT-IHNMPGGPKCYDRNEC-TETTSLCKNGI-CKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLE 2162
            +C+ GF +    C D+NECQ S    C  G  C+N  GS+ CLC + Y         +     C  +     P  +C + S   +      C+C  G+       S + +     + C   G   C  G  C+    +Y C C  GYI   +G  C   VD C   +     N  C +    + CQCD+G+ S    +  ++C ++   Y  S       I + +    C+ + G       K C    S  S + P  S    K    D++ C  ++    C  GA C+N    Y C CL G++    G  C            DV         C         N  C  +  S+QCQC+ G+Q       S+ G + S +    E  +   +         + G   N+      +C      F G   I     G KC D NEC T  ++ C  G  C NT GS+ C C +GYI +     C+ V +         PS  C   +  CK + G F C C  G     E
Sbjct:  310 QCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGY---------IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLD-VDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSDFHGFGMRQC-NLGSSYKLS-------IHKISLVMNCQSILGMMLYKLSKCCVLGSSAYSNVFPPPSETGEKCV--DVNEC-QTFGSAACGPGAYCVNTVGSYNCLCLAGYI--GNGTVCL-----------DVDECLLPSNNCSA-------NSTCKNTPGSFQCQCDAGFQIQSSIHKSILGMMVSVVYIYIEFILQLFLARDYPNYSYELGKNKNTAHQKNPTCPLLIFHFYGLKFIWISETGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTL--CLDVDEC------LLPSNNCSA-NSTCKNTPGSFQCQCDAGFQKTGE 789          

HSP 9 Score: 56.6102 bits (135), Expect = 2.511e-8
Identity = 49/136 (36.03%), Postives = 68/136 (50.00%), Query Frame = 3
Query: 1746 SLDGKLCSDIDECSINPSI-CDQGT-CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            S  G+ C D++EC  + S  C  G  C+N+ GSY C C  G+    +  G  C D +EC   ++ C  N  CKNT GSFQCQC++G+  + +K  CV V +       T  S  C     YC  + G + C C  G
Sbjct:  702 SETGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGY----IGNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK--CVDVNE-----CHTSGSAACGP-GAYCVNTVGSYNCPCLAG 825          

HSP 10 Score: 50.8322 bits (120), Expect = 1.289e-6
Identity = 61/230 (26.52%), Postives = 90/230 (39.13%), Query Frame = 3
Query:  684 RCEKGFIEIDGICQDINECQW--SQICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDM--CRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGF 1355
            +C+ GF +    C D+NEC    S  C  G  C+N  GS+ C C + Y         +     C  +     P  +C +    N  CK  PG  +        K      D+  C+ +G   C  G  C+    +Y C C  GYI   +G  C   VD C   +     N  C +    + CQCD+G+ S+    +  + C   P ++C  G         Y C C PG+
Sbjct:  779 QCDAGFQKTGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGY---------IGNGTLCLDVDECLLPSNNCSA----NSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLD-VDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSNATVCEDINECGRVP-AVCGLGTVCENTVGSYRCPCAPGY 991          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000017.1 (pep scaffold:Pmarinus_7.0:GL477746:39241:65692:1 gene:ENSPMAG00000000015.1 transcript:ENSPMAT00000000017.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 8.643e-25
Identity = 140/518 (27.03%), Postives = 211/518 (40.73%), Query Frame = 3
Query:  498 RCQCKPGF--TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQW-SQICKS-GKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC-TSICDLYPRSLCPDGQC---IPQP-NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIG------PTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASL-DGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNG-ICKNTYGSFQCQCNSGY 1997
            +CQC  GF  TG+ C+++   EC L     VC +  Y + +     C                  C  G+I    +C D++ECQ  S  C +   C N  GSF+C C + +Q       CV   +        CGPG  CV+ ++ ++ C+CL GY+   +G  C        D C            C     +++C+C+ G+   S+   C+  +D C R   V      C +    Y C C  GY  + +     TS   LY  +  P  +      +P    +EC  L  +    K ++C  + S+ +E        P S   ++     D+D C         +G  C+N    Y C CL G++    G  C            DV         C         N  C  +  SYQCQC+ G+Q  + +G +C D+DEC +  + C    TC N PGS+QC C  GF          C D +EC    ++C  G +C+NT GS++C C  GY
Sbjct:  595 QCQCDAGFQKTGEMCTDV--DEC-LKFGSAVCGQGAYCVNMVGSYNC-----------------PCLAGYIGNGTVCLDVDECQLPSNNCSANSTCKNTPGSFQCQCDAGFQ--KTAEICVDVNECQTSGSAACGPGAYCVN-TVGSYNCQCLAGYIG--NGTVCLD-----VDECLLPSNNCSANSTCKNTPGSFQCQCDAGF--QSNATVCED-IDECGRVPTVCGLGTVCENTVGSYRCPCAPGYQRNTNHTILETSF--LYTFTNVPYHRASVIFGRPMTEAFECCTLIHYVEYNKVERCN-VCSNTAENAFSYSNLPPSHPPETGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYI--GNGTVCL-----------DVDECLLPSNNCSA-------NSTCTNTPGSYQCQCDAGFQRYIGNGTVCLDVDECLLPSNNCSANSTCKNMPGSFQCQCDAGF----QSNATVCEDIDECGRVPTVCGLGTVCENTVGSYRCPCAPGY 1052          

HSP 2 Score: 103.99 bits (258), Expect = 6.361e-23
Identity = 140/509 (27.50%), Postives = 200/509 (39.29%), Query Frame = 3
Query:  717 ICQDINECQ--WSQICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDI----DFCFYSYYR-----DQCK--------GGACINMKNHYRCECLPGF-------VLDKQ-----------------GQACKER---------VEYKTNQM-----NDVASSFSLKT-----------------QCDKFGSFLCNNGR-CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISS 2006
             C D++ECQ   S +C  G  C N  GS+ C C   Y  +           +C    N C     C +   + + C+C  G+ K+  G+ C+       D C  +G  VC  G  C+    +Y C C  GYI   +G  C   VD C   +     N  C +    + CQCD+G+  + +     + C     + C  G         Y C+CL G+  +G G  C  +          S+N   K++ G      D  F S        D+C         G  C N    YRC C PG+       +L+                   G+   E          VEY   +      N   ++FS                    +C KFGS  C  G  C+ +  SY C C  GY    +G +C D+DEC +  + C    TC N+PGSYQC C  GF  + +  G  C D +EC   ++ C  N  CKN  GSFQCQC++G+ S+
Sbjct:  525 TCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGYVGN---GTVCLDVDECLLPSNNCSANSTCTNTPGF-YQCQCDAGFQKT--GEMCTD-----VDECLKFGSAVCGQGAYCVNMVGSYNCPCLAGYIG--NGTVCLD-VDECQLPSNNCSANSTCKNTPGSFQCQCDAGFQKTAEICVDVNECQTSGSAACGPGAYCVNTVGSYNCQCLAGY--IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSNATVCEDIDECGRVPTVCGLGTVCENTVGSYRCPCAPGYQRNTNHTILETSFLYTFTNVPYHRASVIFGRPMTEAFECCTLIHYVEYNKVERCNVCSNTAENAFSYSNLPPSHPPETGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCTNTPGSYQCQCDAGFQRY-IGNGTVCLDVDECLLPSNNCSANSTCKNMPGSFQCQCDAGFQSN 1014          

HSP 3 Score: 91.6633 bits (226), Expect = 3.531e-19
Identity = 112/399 (28.07%), Postives = 155/399 (38.85%), Query Frame = 3
Query: 1071 YKCECNQGYIASSDGKSCKKT------VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYD-------------------------RKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR-CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNEC-TETTSLCKNGI-CKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDA 2153
            +KC C  GY   SD ++C+        +  CT+Y+        C +L  +Y C C+SGY S++                           + C  +  C     +LC  G         Y CRCL G+  +G G  C                        D+D C      + C   + C N    Y+C+C  GF   K G+ C +  E                  C KFGS +C  G  C+    SY C C  GY    +G +C D+DEC +  + C    TC N+PGS+QC C  GF          C D NEC T  ++ C  G  C NT GS+ CQC +GYI +     C+ V +         PS  C   +  CK + G F C C  G  +
Sbjct:  441 FKCGCVAGYAVVSDSRTCQDVDECQSGIYNCTQYS-------TCRNLEGNYTCICNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGY--VGNGTVCL-----------------------DVDECLLP--SNNCSANSTCTNTPGFYQCQCDAGF--QKTGEMCTDVDE------------------CLKFGSAVCGQGAYCVNMVGSYNCPCLAGYIG--NGTVCLDVDECQLPSNNCSANSTCKNTPGSFQCQCDAGF----QKTAEICVDVNECQTSGSAACGPGAYCVNTVGSYNCQCLAGYIGNGTV--CLDVDEC------LLPSNNCSA-NSTCKNTPGSFQCQCDAGFQS 770          

HSP 4 Score: 91.2781 bits (225), Expect = 4.762e-19
Identity = 137/547 (25.05%), Postives = 210/547 (38.39%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICKS--GKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVD-FCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQP-------NNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDI----DFCFYSYYRDQCKGGA------CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQ-GTCINSPGSYQCSCFDGF-TIHNMP----------------------GGPKCYDRNECTET-TSLCKNGI-CKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C+ G+      C+DI+EC     C S   +C+N  GS+ C C+  +  +           +C   P LC    +C++  I ++ C+CLPGY++  +G  C+       D C+   P   +   C     +Y C C  GY   S  + C  T +   +  N      G C +    + CQC +GYT   D   CT         LC     +PQ        N       L  F P+   K  +++        P ++ +  K   GD+    D        D+C  G       C N++  + C C   F        CK +    T+ ++ VA  ++L    D  GSF              +C C  GY    D + C D+DEC      C Q  TC N  G+Y C C  G+ + H++P                       G  C D +EC +  ++LC +G  C NT GS+ C+C  GY+ +     C+ V +         PS  C   +  C  + G + C C  G     E  +C  V +
Sbjct:  118 CKLGYEGNGWNCKDIDECMTGNHCNSNGSECMNTDGSYYCTCALGFTGNGTYC---ADINECTANPYLCQDTEECMN-GIGSYKCECLPGYIR--NGTICTD-----VDECKKSQPCDANTMVCSNTIGSYTCLCKAGYQFDSTARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTCQCKAGYTG--DGVTCTG-------KLCFHVVGVPQCRGAVILCNLAVGVVLLCDFTPIKLYK--KKVFDVDECNPPENATQPCKGPVGDLYGRDDAHCVCPDVDECIRGLHNCTQNCTNIEGGFTCSCFARF--SSVNGTCKRKFHLSTSFVH-VAYVYTLWPSTDTIGSF--------------KCGCVAGYAVVSDSRTCQDVDECQSGIYNCTQYSTCRNLEGNYTCICNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGYVGNGTV--CLDVDEC------LLPSNNCSA-NSTCTNTPGFYQCQCDAGFQKTGE--MCTDVDE 614          

HSP 5 Score: 89.7373 bits (221), Expect = 1.590e-18
Identity = 155/614 (25.24%), Postives = 234/614 (38.11%), Query Frame = 3
Query:  501 CQCKPGFTGKS--CSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGK--CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ--------------------SANKYDMCRF-----YGPYVCHFGKC-IADGYNYKCECNQGYIASSDGKSCK-KTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKK-----CTSICDL-YPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGF----VLDKQGQACKERVEYKTNQMN------DVASSFSLKTQCDKFGSFLCNNGR-CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTE-TTSLCKNGI-CKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C C  GFTG    C++I             C  +PY  Q ++E          G    +CE   C  G+I    IC D++EC+ SQ C +    C N  GS+ CLC + YQFD     C    +      N C            +  C+C  GY    DG +C+ +                    +     +C F     Y   V    +C   +     C+   G +   D   C    VD C R  G+      C ++   + C C + ++S     K      TS   + Y  +L P    I      ++C C+ G+A +   + C+                       D+D C    Y    +   C N++ +Y C C  G+     +  QG       E+K + ++      +   +     +C K GS LC +G  C  +  SY C+C  GY    +G +C D+DEC +  + C    TC N+PG YQC C  GF       G  C D +EC +  +++C  G  C N  GS+ C C +GYI +     C+ V +         PS  C   +  CK + G F C C  G     E  +C  V++
Sbjct:  157 CTCALGFTGNGTYCADI-----------NECTANPYLCQDTEE-------CMNGIGSYKCE---CLPGYIRNGTICTDVDECKKSQPCDANTMVCSNTIGSYTCLCKAGYQFDSTARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTCQCKAGYTG--DGVTCTGKLCFHVVGVPQCRGAVILCNLAVGVVLLCDFTPIKLYKKKVFDVDECNPPENATQPCKGPVGDLYGRDDAHCVCPDVDECIR--GLHNCTQNCTNIEGGFTCSCFARFSSVNGTCKRKFHLSTSFVHVAYVYTLWPSTDTI----GSFKCGCVAGYAVVSDSRTCQ-----------------------DVDECQSGIYNCT-QYSTCRNLEGNYTCICNSGYESAHSIPTQG---VYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGYVG--NGTVCLDVDECLLPSNNCSANSTCTNTPGFYQCQCDAGF----QKTGEMCTDVDECLKFGSAVCGQGAYCVNMVGSYNCPCLAGYIGNGTV--CLDVDECQ------LPSNNCSA-NSTCKNTPGSFQCQCDAGFQKTAE--ICVDVNE 697          

HSP 6 Score: 88.1965 bits (217), Expect = 4.870e-18
Identity = 115/436 (26.38%), Postives = 170/436 (38.99%), Query Frame = 3
Query:  717 ICQDINECQWS--QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCK---CLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVC-HFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR-CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNG-ICKNTYGSFQCQCNSGY 1997
             CQD++ECQ       +   C N  G++ C+C+S Y+                 IP          +  +Y+   K     P       G++C        D C+  G  +C H   C     +Y C C  GY+   +G  C   VD C   +     N  C +    Y CQCD+G+  + +       C  +  ++C  G         Y C CL G+  +G G  C  +  D+ ++    SN  S +S                    C N    ++C+C  GF   K  + C +  E                  C   GS  C  G  C+ +  SY CQC  GY    +G +C D+DEC +  + C    TC N+PGS+QC C  GF          C D +EC    ++C  G +C+NT GS++C C  GY
Sbjct:  457 TCQDVDECQSGIYNCTQYSTCRNLEGNYTCICNSGYE-------------SAHSIP----------TQGVYSFEFKHSNLSPPPQPPESGETCID-----VDECQKAGSALCGHGAYCANTLGSYACRCLVGYVG--NGTVCLD-VDECLLPSNNCSANSTCTNTPGFYQCQCDAGFQKTGEMCTDVDECLKFGSAVCGQGAYCVNMVGSYNCPCLAGY--IGNGTVCLDV--DECQL---PSNNCSANS-------------------TCKNTPGSFQCQCDAGF--QKTAEICVDVNE------------------CQTSGSAACGPGAYCVNTVGSYNCQCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGF----QSNATVCEDIDECGRVPTVCGLGTVCENTVGSYRCPCAPGY 809          

HSP 7 Score: 67.781 bits (164), Expect = 8.078e-12
Identity = 92/366 (25.14%), Postives = 138/366 (37.70%), Query Frame = 3
Query: 1134 VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN-------GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC-DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNG-ICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL--DAVLETG-LCAKVSQI 2192
            +D C   + +   N  CV+    Y C C++G+  +       S C         +  C+   N+        Y C C  G+     G  C                        DI+ C     ++ C   A C N    Y C C  G+  +  G  CK+  E  T               C+  GS       C+ +  SY C C  G+    +G  C+DI+EC+ NP +C D   C+N  GSY+C C  G+    +  G  C D +EC ++     N  +C NT GS+ C C +GY   +  + C    +      +      C + +  C+  +G F C C  G   D V  TG LC  V  +
Sbjct:    1 IDECALNSSLCVKNAHCVNTPGHYDCSCNAGFRGNGFIDCQESTCLHEDECSVKNNPCLSVNNSFCNNSIGSYSCICTSGY----NGTTCEVT---------------------DINECISG--QNNCPVNANCTNTIGSYTCACKLGY--EGNGWNCKDIDECMTGN------------HCNSNGS------ECMNTDGSYYCTCALGFTG--NGTYCADINECTANPYLCQDTEECMNGIGSYKCECLPGY----IRNGTICTDVDECKKSQPCDANTMVCSNTIGSYTCLCKAGYQFDSTARICTDTDECVVSSLNN-----CSRTTGLCQNFDGSFTCQCKAGYTGDGVTCTGKLCFHVVGV 308          

HSP 8 Score: 57.7658 bits (138), Expect = 9.285e-9
Identity = 90/350 (25.71%), Postives = 130/350 (37.14%), Query Frame = 3
Query: 1005 DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSND--------YICQCDSGYTSSY----DRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGR-CIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGT--CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETT-SLCK--NGICKNTYGSFQCQCNSGYI 2000
            D C            C+    +Y C CN G+  +     C+++   C   +     N  C+S++N         Y C C SGY  +     D  +C S      ++ CP           Y C C  G+   G G  C+                       DID C    + +   G  C+N    Y C C  GF     G  C +  E   N                    +LC +   C+    SY+C+C  GY    +G +C+D+DEC      CD  T  C N+ GSY C C  G+   +      C D +EC  ++ + C    G+C+N  GSF CQC +GY 
Sbjct:    2 DECALNSSLCVKNAHCVNTPGHYDCSCNAGFRGNGF-IDCQEST--CLHEDECSVKNNPCLSVNNSFCNNSIGSYSCICTSGYNGTTCEVTDINECIS-----GQNNCPVNANCTNTIGSYTCACKLGYE--GNGWNCK-----------------------DIDECMTGNHCNS-NGSECMNTDGSYYCTCALGFT--GNGTYCADINECTANP-------------------YLCQDTEECMNGIGSYKCECLPGYIR--NGTICTDVDECK-KSQPCDANTMVCSNTIGSYTCLCKAGYQFDST--ARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTCQCKAGYT 291          

HSP 9 Score: 50.8322 bits (120), Expect = 1.365e-6
Identity = 88/388 (22.68%), Postives = 144/388 (37.11%), Query Frame = 3
Query:  684 RCEKGFIEIDGICQDINECQW-SQICKS-GKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADG-----------YNYKCECN------QGYIASSD---------GKSCKKTVDFCTRYNGVVCPNGK-CVSLSNDYICQCDSGY----TSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAP-MGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQ 1742
            +C  G+I    +C D++EC   S  C +   C N  GSF+C C + +Q +   A   +   +C ++P +CG G  C + ++ ++ C C PGY ++ +           +    ++   V  FG+ + +            YN    CN      +   + S+         G+ C   VD C ++    C  G  CV+    Y C C +GY    T   D  +C     L P + C            Y+C+C  GF   +G G  C                        D+D C      + C   + C NM   ++C+C  GF        C++      ++   V +   L T C+              +  SY+C C  GYQ
Sbjct:  722 QCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSN---ATVCEDIDECGRVPTVCGLGTVCEN-TVGSYRCPCAPGYQRNTNHTILETSFLYTFTNVPYHRASV-IFGRPMTEAFECCTLIHYVEYNKVERCNVCSNTAENAFSYSNLPPSHPPETGEMCTD-VDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDEC-----LLPSNNCSANSTCTNTPGSYQCQCDAGFQRYIGNGTVCL-----------------------DVDECLLP--SNNCSANSTCKNMPGSFQCQCDAGF--QSNATVCED-----IDECGRVPTVCGLGTVCEN-------------TVGSYRCPCAPGYQ 1053          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Nematostella
Match: EDO38786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBY8])

HSP 1 Score: 160.614 bits (405), Expect = 2.869e-42
Identity = 145/517 (28.05%), Postives = 219/517 (42.36%), Query Frame = 3
Query:  552 GECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCEL--GRCEKGFIE--IDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV-QRKKKCEQ--IPNLCGPGMDCVSLSIYNHLCKC----------------LPGYVKSLD---GKSCSKQSANKYDMC--------RFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSG 1994
            G C+  +   +C     G+  ++ LCC     AWG+PC+RC L    C++GF+       CQD++EC+  + IC +G+C+N  G +RC C   +        C+     +C +  +   C  G    SLS     C C                 PG   SL+   G+        K  +C              VC  G+CI +  ++ C C +G+  S D   C   +D C   +  VC NG+C +++  + C C+ GY  S DR +C  I + L    +C +G C       Y C C  G+A   +  +C                        DI+ C  S   D C  G C N    Y C C  G++    G  C +        +++  ++  +K         +C NG+C  +   Y C CN+GY+     KLC DI+EC  NP +C  G C N PG++QC+C  GF   +      C D +EC +    C  G C NT GS++C+C  G
Sbjct:    1 GPCYTVVKNRMCHSQLIGVVCTRNLCCATIGQAWGNPCERCPLKPAPCDRGFLPNYKTKACQDVDECKTITNICANGRCVNTNGGYRCECPRGFALSQDGMYCIGNTPGRCYKRIVNGYCHMGS---SLSTTQAACCCSMMQSKAWGPDCKRCPAPGTGTSLNIACGRVYGVVCIYKRTLCCVDISDVDECTDESVCTNGQCINNIGSFTCTCRRGFTLSLDRTRCDD-MDECREKD--VCKNGRCQNVNGAFRCICNKGYELSSDRTQCVDINECLTQGEMCRNGVC-ENTEGSYRCICNAGYAANAEENKC-----------------------ADINEC--STIPDVCMNGRCANSPGGYSCICNSGYITSADGHHCVD--------IDECENAAGMK-------KGMCVNGKCRNTNGDYTCDCNSGYRNDATQKLCLDINECLENPRLCQGGQCKNLPGTFQCTCSGGFIYDSAT--EMCKDIDECAD-PDRCVYGTCTNTRGSYRCECPRG 467          

HSP 2 Score: 115.546 bits (288), Expect = 3.679e-27
Identity = 113/421 (26.84%), Postives = 165/421 (39.19%), Query Frame = 3
Query: 1083 CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDF---------CFYSYY--------------RDQCKGGACINMKNHYRCECLPGFVLD------KQGQACKERVEYKTNQMNDVASSF-----------SLKTQCDKFGSFL-----CNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSL----CKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            C++G++ +   K+C+  VD C     + C NG+CV+ +  Y C+C  G+  S D   C              G+C  +  NGY   C  G +       C   M      GP      +  +   ++          C Y                    C  G CIN    + C C  GF L            C+E+   K  +  +V  +F           S +TQC      L     C NG C  +  SY+C CN GY A+ +   C+DI+ECS  P +C  G C NSPG Y C C  G+       G  C D +EC     +    C NG C+NT G + C CNSGY +   ++ C+ + +        E  ++C+     CK   G F C+C  G      T +C  + +  D
Sbjct:   48 CDRGFLPNYKTKACQD-VDECKTITNI-CANGRCVNTNGGYRCECPRGFALSQDGMYCIGN---------TPGRCYKRIVNGY---CHMGSSLSTTQAACCCSMMQSKAWGPDCKRCPAPGTGTSLNIACGRVYGVVCIYKRTLCCVDISDVDECTDESVCTNGQCINNIGSFTCTCRRGFTLSLDRTRCDDMDECREKDVCKNGRCQNVNGAFRCICNKGYELSSDRTQCVDINECLTQGEMCRNGVCENTEGSYRCICNAGYAANAEENKCADINECSTIPDVCMNGRCANSPGGYSCICNSGYITS--ADGHHCVDIDECENAAGMKKGMCVNGKCRNTNGDYTCDCNSGYRNDATQKLCLDINEC------LENPRLCQ--GGQCKNLPGTFQCTCSGGFIYDSATEMCKDIDECAD 444          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Nematostella
Match: EDO38789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBZ1])

HSP 1 Score: 145.591 bits (366), Expect = 4.835e-36
Identity = 138/508 (27.17%), Postives = 210/508 (41.34%), Query Frame = 3
Query:  714 GICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ-------------CNTGYQ-ASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            G C+D++EC  +      KC+N  GSF C C   +  D     C    +     P  C  GM C +++  +  C C  GY  + + ++C   +          G  +C  G CI    +Y+CEC+ G+  +  G    + +D C      VC NG C++    + CQC +GYT S DR+ C  +  C   P   C +G+C      G  C C+ G+A   +GK  R +  ++ +  P              +FC          GG C+N    YRC C PGF     G  C +  E     + D  +S +         S  C     +  G    C+             C  G   A  +G    D++EC++ P +C  G CIN+ GS++C C  GF +     G  C D+NEC ET  +CK G C N  GS+ C C  GY  +     C  + +   +            C++ C  + G F C+CPNG +       C  +++
Sbjct:   36 GKCKDVDECLMNPCVSPAKCLNTFGSFLCNCPEGFTPDVTGLKCTDMDEC--GTPGYCDHGM-CKNMN-GSFSCVCNQGYHLTDNKRTCVDMNEC------ILGKGLCGNGTCINTEGSYRCECHPGFKLNRGGFC--QDIDECV-MEADVCRNGMCINTEGSFTCQCIAGYTLSADRRHCIDVNECQDVP-GFCENGRCT-NTIGGARCECVAGYALNTEGKITRCVDVNECDENP--------------NFCR--------PGGRCVNTPGSYRCLCDPGFQSYNGGTVCVDSREDFCFDVFDNENSCTKPRPIKMTKSVCCCT---LGKGWGDPCELCPSPKTPEFSIICPKGVGIARKNGTRFEDVNECTMMPDLCRNGVCINNDGSFRCQCKMGFKLD--ASGHHCEDKNECVETPGICKTGNCTNIEGSYTCTCPVGYAPTRDSPSCSDIDECRERA---------GLCAYRCINTPGSFKCACPNGFELSTNQRHCKDINE 492          

HSP 2 Score: 144.821 bits (364), Expect = 9.173e-36
Identity = 148/526 (28.14%), Postives = 215/526 (40.87%), Query Frame = 3
Query:  678 LGRCEKGFI-EIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRK--KCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC---------------------RRI--------------MSDQSEIGPTSSNED--------------SKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEY-------KTNQMNDVASSFSL-----------KTQCDKFGSFLCNNG----RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
            L  C +GF  ++ G+ C D++EC     C  G C N  GSF C+C+  Y     +  CV   + C     LCG G  C++    ++ C+C PG+  +  G           D C      VC  G CI    ++ C+C  GY  S+D + C   V+ C    G  C NG+C +      C+C +GY  + + K  +C  +  CD  P    P G+C+  P + Y C C PGF     G  C                     R I                D  E+ P+    +              + +   D++ C  +   D C+ G CIN    +RC+C  GF LD  G  C+++ E        KT    ++  S++               C          G    RCI +  S++C C  G++ S + + C DI+EC  NP +C  G C N  G Y+C+C DG+       G  C D NEC E   LC+NG C N  G + C CN GY  S   + C
Sbjct:   63 LCNCPEGFTPDVTGLKCTDMDECGTPGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDMNE-CILGKGLCGNGT-CINTE-GSYRCECHPGFKLNRGG------FCQDIDECVMEAD-VCRNGMCINTEGSFTCQCIAGYTLSADRRHCID-VNECQDVPGF-CENGRCTNTIGGARCECVAGYALNTEGKITRCVDVNECDENPNFCRPGGRCVNTPGS-YRCLCDPGFQSYNGGTVCVDSREDFCFDVFDNENSCTKPRPIKMTKSVCCCTLGKGWGDPCELCPSPKTPEFSIICPKGVGIARKNGTRFEDVNEC--TMMPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHCEDKNECVETPGICKTGNCTNIEGSYTCTCPVGYAPTRDSPSCSDIDECRERAGLCAYRCINTPGSFKCACPNGFELSTNQRHCKDINECKKNPELCPYG-CKNFVGGYRCTCPDGYRGD----GRTCTDINECQERRGLCRNGACVNIDGGYVCNCNPGYKRSKNGKRC 568          

HSP 3 Score: 120.939 bits (302), Expect = 3.602e-28
Identity = 106/362 (29.28%), Postives = 151/362 (41.71%), Query Frame = 3
Query: 1026 PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSN--------KKQDCVSVQDNSNQKYDTEPSKICK 2084
            P +C  GKC     +Y C C +G         CK  VD C   N  V P  KC++    ++C C  G+T      KCT + +      C  G C    N  + C C  G+                          D+K +  D++ C     +  C  G CIN +  YRCEC PGF L++ G  C++  E                       + +C NG CI +  S+ CQC  GY  S D + C D++EC   P  C+ G C N+ G  +C C  G+ ++      +C D NEC E  + C+  G C NT GS++C C+ G+ S N        ++  C  V DN N      P K+ K
Sbjct:    6 PDICREGKCQNTIGSYICTCPKGLRHDPSSGKCKD-VDECL-MNPCVSP-AKCLNTFGSFLCNCPEGFTPDVTGLKCTDMDECGTPGYCDHGMC-KNMNGSFSCVCNQGYHLT-----------------------DNKRTCVDMNECILG--KGLCGNGTCINTEGSYRCECHPGFKLNRGG-FCQDIDECVME-------------------ADVCRNGMCINTEGSFTCQCIAGYTLSADRRHCIDVNECQDVPGFCENGRCTNTIGGARCECVAGYALNTEGKITRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCVDSREDFCFDVFDNENSCTKPRPIKMTK 318          

HSP 4 Score: 118.627 bits (296), Expect = 1.783e-27
Identity = 134/524 (25.57%), Postives = 199/524 (37.98%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKER-------------VEYKTNQMNDVASSFSLKTQCDKFG------------------------SFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK 1940
            RC C PGF     G  C +     CF           P  ++++K +CC      WGDPC+                +C      ++S IC  G  I  +   R        F+ V         +C  +P+LC  G+ C++ +  +  C+C  G+     G  C  ++           P +C  G C     +Y C C  GY  + D  SC   +D C    G+     +C++    + C C +G+  S +++ C  I  C   P  LCP G        GY C C  G+   G G+ C  I   Q                           R  C+ GAC+N+   Y C C PG+   K G+ C+++              E  T QM  V+      T    +G                        S LC NG+CI     ++C CN GY+ S++G+ C DI+EC     +C Q  C N+ GSY+CSC  G+ +       KC D +EC      C+
Sbjct:  274 RCLCDPGFQSYNGGTVCVDSREDFCFDVFDNENSCTKPRPIKMTKSVCCCTLGKGWGDPCE----------------LCPSPKTPEFSIICPKGVGIARKNGTR--------FEDVN--------ECTMMPDLCRNGV-CIN-NDGSFRCQCKMGFKLDASGHHCEDKNEC------VETPGICKTGNCTNIEGSYTCTCPVGYAPTRDSPSCSD-IDECRERAGLC--AYRCINTPGSFKCACPNGFELSTNQRHCKDINECKKNPE-LCPYG--CKNFVGGYRCTCPDGY--RGDGRTCTDINECQER-------------------------RGLCRNGACVNIDGGYVCNCNPGYKRSKNGKRCEDQRKGLCFATVTDGLCEAVTKQMMQVSKRDCCCTAGKAWGISCELCPAKDTMELGNGMNVCEMTSGLCINGKCISIKGGFRCMCNVGYKLSMNGRKCYDINECEGPTKVC-QFDCKNTDGSYECSCPKGYQVD--ADKKKCLDVDECKTGAHNCQ 721          

HSP 5 Score: 98.9821 bits (245), Expect = 2.983e-21
Identity = 128/528 (24.24%), Postives = 200/528 (37.88%), Query Frame = 3
Query:  720 CQDINEC-QWSQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDM-------------CRF-------YGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDE----CSINPSICDQGT-----------CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            C D+NEC +    C+  G+C+N  GS+RCLC   +Q       CV  R+  C  + +          + +   +C C  G       + C      ++ +              RF         P +C  G CI +  +++C+C  G+   + G  C+   + C    G+ C  G C ++   Y C C  GY  + D   C+ I +   R+     +CI  P + ++C C  GF      + C+ I            NE  K+ +     C Y           C N    YRC C  G+  D  G+ C +  E +  +                    LC NG C+     Y C CN GY+ S +GK C D  +     ++   +C+  T           C  +  ++  SC        M  G      N C  T+ LC NG C +  G F+C CN GY  S   + C  + +         P+K+C+     CK ++G + CSCP G     +   C  V +
Sbjct:  247 CVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCVDSREDFCFDVFDNENSCTKPRPIKMTKSVCCCTLGKGWGDPCELCPSPKTPEFSIICPKGVGIARKNGTRFEDVNECTMMPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHCEDKNE-CVETPGI-CKTGNCTNIEGSYTCTCPVGYAPTRDSPSCSDIDECRERAGLCAYRCINTPGS-FKCACPNGFELSTNQRHCKDI------------NECKKNPE----LCPY----------GCKNFVGGYRCTCPDGYRGD--GRTCTDINECQERRG-------------------LCRNGACVNIDGGYVCNCNPGYKRSKNGKRCEDQRKGLCFATVTDGLCEAVTKQMMQVSKRDCCCTAGKAWGISCELCPAKDTMELG---NGMNVCEMTSGLCINGKCISIKGGFRCMCNVGYKLSMNGRKCYDINECEG------PTKVCQ---FDCKNTDGSYECSCPKGYQVDADKKKCLDVDE 712          

HSP 6 Score: 53.1434 bits (126), Expect = 4.243e-7
Identity = 42/140 (30.00%), Postives = 57/140 (40.71%), Query Frame = 3
Query: 1779 ECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSH-YCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIV 2195
            EC   P IC +G C N+ GSY C+C  G  + + P   KC D +EC     +     C NT+GSF C C  G+        C  + +     Y          C H  CK  NG F C C  G         C  +++ +
Sbjct:    1 ECKELPDICREGKCQNTIGSYICTCPKG--LRHDPSSGKCKDVDECLMNPCV-SPAKCLNTFGSFLCNCPEGFTPDVTGLKCTDMDECGTPGY----------CDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDMNECI 127          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Nematostella
Match: EDO38787 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBY9])

HSP 1 Score: 132.494 bits (332), Expect = 8.791e-34
Identity = 113/365 (30.96%), Postives = 162/365 (44.38%), Query Frame = 3
Query: 1005 DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN---GYECRCLPGFAPMGKGKQCRRI---MSDQSEIGPTSS------------------NEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC-DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDC 2024
            D C  Y P +C  G C+    +Y+CEC+ G    S   +C   ++ C  + G+ C NG+CV+    + C C+ GY  + DR  C  I       L  +G+C    NN    Y C C  GFA    G+ CR I   M      GP ++                  + DS+S   D+D C        C  G C N    + C C  G+ + K   AC +  E +T Q                  +    N RC     SY+C+C  G+    DG  C+D+DEC+   + C +QGTC+N+PGS++C C +G+T      G  C D NEC    +LC++G C N  GSF C C  GY+ +   + C
Sbjct:    4 DECTMY-PQLCRNGICVNTPGSYRCECSAGLTLDSIQNACVD-INECNTWQGL-CRNGRCVNKQGTFECICNQGYGLTADRMDCEDI----NECLVDNGRCSEMCNNTLGSYLCDCGAGFALQPDGRTCRDIDECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSVDSRSCI-DVDECQEDPRL--CTNGVCRNTPGSFECLCAKGYAIAKGTTACVDVNECQTGQ------------------AMCHENARCANLVGSYRCECKPGFIG--DGSSCTDVDECTTGIAQCSEQGTCVNTPGSHRCVCHEGYTGD----GITCVDINECLADPNLCEHGQCINKAGSFMCDCEIGYLPTPNGKGC 334          

HSP 2 Score: 124.79 bits (312), Expect = 3.524e-31
Identity = 111/383 (28.98%), Postives = 165/383 (43.08%), Query Frame = 3
Query:  726 DINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF 1865
            D++EC  + Q+C++G C+N  GS+RC CS+    D +Q  CV    +C     LC  G  CV+       C C  GY  + D   C   +    D  R         G        Y C+C  G+    DG++C+  +D C     V  P   C ++   Y C C  GY  S D + C  +  C   PR LC +G C   P + +EC C  G+A       C  +  ++ + G    +E+++                      C N+   YRCEC PGF+ D  G +C            DV    +   QC + G+       C+ +  S++C C+ GY    DG  C DI+EC  +P++C+ G CIN  GS+ C C  G+
Sbjct:    2 DVDECTMYPQLCRNGICVNTPGSYRCECSAGLTLDSIQNACVD-INECNTWQGLCRNGR-CVNKQ-GTFECICNQGYGLTADRMDCEDINECLVDNGRCSEMCNNTLGS-------YLCDCGAGFALQPDGRTCRD-IDECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSVDSRSCIDVDECQEDPR-LCTNGVCRNTPGS-FECLCAKGYAIAKGTTACVDV--NECQTGQAMCHENAR----------------------CANLVGSYRCECKPGFIGD--GSSCT-----------DVDECTTGIAQCSEQGT-------CVNTPGSHRCVCHEGYTG--DGITCVDINECLADPNLCEHGQCINKAGSFMCDCEIGY 325          

HSP 3 Score: 107.071 bits (266), Expect = 4.192e-25
Identity = 75/218 (34.40%), Postives = 96/218 (44.04%), Query Frame = 3
Query: 1455 DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQ------------------MNDVASSFSLKTQCDKFGSFLCNNGRCIE----SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG-TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            D+D C  + Y   C+ G C+N    YRCEC  G  LD    AC +  E  T Q                   N      + +  C+     L +NGRC E    +  SY C C  G+    DG+ C DIDEC   P +C  G TC N  G Y C+C  G+          C D +EC E   LC NG+C+NT GSF+C C  GY  +     CV V +
Sbjct:    2 DVDEC--TMYPQLCRNGICVNTPGSYRCECSAGLTLDSIQNACVDINECNTWQGLCRNGRCVNKQGTFECICNQGYGLTADRMDCEDINECLVDNGRCSEMCNNTLGSYLCDCGAGFALQPDGRTCRDIDECMERPDVCGPGNTCNNIEGGYYCTCGKGY--KQSVDSRSCIDVDECQEDPRLCTNGVCRNTPGSFECLCAKGYAIAKGTTACVDVNE 215          

HSP 4 Score: 105.531 bits (262), Expect = 1.231e-24
Identity = 89/292 (30.48%), Postives = 126/292 (43.15%), Query Frame = 3
Query: 1134 VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYI 2000
            VD CT Y   +C NG CV+    Y C+C +G T    +  C  I  C+ + + LC +G+C+ +    +EC C  G+        C                        DI+ C     R       C N    Y C+C  GF L   G+ C+           D+         C    +  CNN   IE G  Y C C  GY+ S+D + C D+DEC  +P +C  G C N+PGS++C C  G+ I    G   C D NEC    ++C +N  C N  GS++C+C  G+I
Sbjct:    3 VDECTMYP-QLCRNGICVNTPGSYRCECSAGLTLDSIQNACVDINECNTW-QGLCRNGRCVNKQGT-FECICNQGYGLTADRMDCE-----------------------DINECLVDNGR---CSEMCNNTLGSYLCDCGAGFALQPDGRTCR-----------DIDECMERPDVCGPGNT--CNN---IEGG--YYCTCGKGYKQSVDSRSCIDVDECQEDPRLCTNGVCRNTPGSFECLCAKGYAI--AKGTTACVDVNECQTGQAMCHENARCANLVGSYRCECKPGFI 245          

HSP 5 Score: 81.6481 bits (200), Expect = 1.181e-16
Identity = 45/143 (31.47%), Postives = 71/143 (49.65%), Query Frame = 3
Query: 1770 DIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            D+DEC++ P +C  G C+N+PGSY+C C  G T+ ++     C D NEC     LC+NG C N  G+F+C CN GY  +  + DC  + +               +CS  C  + G ++C C  G     +   C  + + ++
Sbjct:    2 DVDECTMYPQLCRNGICVNTPGSYRCECSAGLTLDSIQN--ACVDINECNTWQGLCRNGRCVNKQGTFECICNQGYGLTADRMDCEDINECLVDN---------GRCSEMCNNTLGSYLCDCGAGFALQPDGRTCRDIDECME 133          

HSP 6 Score: 75.0998 bits (183), Expect = 1.625e-14
Identity = 75/291 (25.77%), Postives = 118/291 (40.55%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACK 1586
            C+DINEC       S  C N  GS+ C C + +   P    C +   +C + P++CGPG  C ++    + C C  GY +S+D +SC      + D      P +C  G C     +++C C +GY  +    +C   V+ C     +   N +C +L   Y C+C  G+    D   CT +  C          G C+  P + + C C  G+   G G  C                        DI+ C      + C+ G CIN    + C+C  G++    G+ C+
Sbjct:   84 CEDINECLVDNGRCSEMCNNTLGSYLCDCGAGFALQPDGRTC-RDIDECMERPDVCGPGNTCNNIE-GGYYCTCGKGYKQSVDSRSCIDVDECQED------PRLCTNGVCRNTPGSFECLCAKGYAIAKGTTACVD-VNECQTGQAMCHENARCANLVGSYRCECKPGFIG--DGSSCTDVDECTTGIAQCSEQGTCVNTPGS-HRCVCHEGYT--GDGITCV-----------------------DINECLAD--PNLCEHGQCINKAGSFMCDCEIGYLPTPNGKGCQ 335          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Nematostella
Match: EDO28820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5E3])

HSP 1 Score: 125.561 bits (314), Expect = 7.461e-32
Identity = 102/322 (31.68%), Postives = 138/322 (42.86%), Query Frame = 3
Query: 1026 PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQC 1985
            P  C  G C     ++ C CNQGY  + + ++C   +D C      VC NG C++    + CQC +GYT S DR+ C  +  C   P   C +G+C      G  C C+ G+A   +GK  R +  ++ +  P              +FC          GG C+N    YRC C PGF                         S++  T C      LC NG CI +  S++CQC  G++    G  C D +EC   P IC  G C N  GSY C+C  G+        P C D +EC E   LC    C NT GSF+C C
Sbjct:   13 PGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVD-IDECV-MEADVCRNGMCINTEGSFTCQCIAGYTLSADRRHCIDVNECQDVP-GFCENGRCT-NTIGGARCECVAGYALNTEGKITRCVDVNECDENP--------------NFCR--------PGGRCVNTPGSYRCLCDPGF------------------------QSYNGGTVCCTMMPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHCEDKNECVETPGICKTGNCTNIEGSYTCTCPVGYAPTR--DSPSCSDIDECRERAGLCAY-RCINTPGSFKCAC 281          

HSP 2 Score: 108.997 bits (271), Expect = 3.673e-26
Identity = 80/255 (31.37%), Postives = 118/255 (46.27%), Query Frame = 3
Query: 1434 DSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKL--CSDIDECSINPSICDQG-TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            D+K +  DID C      D C+ G CIN +  + C+C+ G+ L    + C +      N+  DV                 C NGRC  +    +C+C  GY  + +GK+  C D++EC  NP+ C  G  C+N+PGSY+C C  GF  +N  GG  C     CT    LC+NG+C N  GSF+CQC  G+        C       ++    E   ICK  +  C    G + C+CP G     ++  C+ + +
Sbjct:   40 DNKRTCVDIDECVMEA--DVCRNGMCINTEGSFTCQCIAGYTLSADRRHCID-----VNECQDVPG--------------FCENGRCTNTIGGARCECVAGYALNTEGKITRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYN--GGTVC-----CTMMPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHC------EDKNECVETPGICK--TGNCTNIEGSYTCTCPVGYAPTRDSPSCSDIDE 258          

HSP 3 Score: 88.1965 bits (217), Expect = 3.858e-19
Identity = 60/195 (30.77%), Postives = 87/195 (44.62%), Query Frame = 3
Query: 1455 DIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQ 2036
            D+D C    Y   C  G C NM   + C C  G+ L    + C +  E                       + +C NG CI +  S+ CQC  GY  S D + C D++EC   P  C+ G C N+ G  +C C  G+ ++      +C D NEC E  + C+  G C NT GS++C C+ G+ S N    C ++ 
Sbjct:    6 DMDECGTPGY---CDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDIDECVME-------------------ADVCRNGMCINTEGSFTCQCIAGYTLSADRRHCIDVNECQDVPGFCENGRCTNTIGGARCECVAGYALNTEGKITRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCCTMM 178          

HSP 4 Score: 78.1814 bits (191), Expect = 8.381e-16
Identity = 78/290 (26.90%), Postives = 119/290 (41.03%), Query Frame = 3
Query:  723 QDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCK-KTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKE 1589
            +D++EC     C  G C N  GSF C+C+  Y     +  CV    +C    ++C  GM C++    +  C+C+ GY  S D + C   +  + D+     P  C  G+C       +CEC  GY  +++GK  +   V+ C        P G+CV+    Y C CD G+ S      C   C + P  LC +G CI   +  + C+C  GF     G  C     D++E   T                        CK G C N++  Y C C  G+   +   +C +
Sbjct:    5 EDMDECGTPGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVD-IDECVMEADVCRNGM-CINTE-GSFTCQCIAGYTLSADRRHCIDVNECQ-DV-----PGFCENGRCTNTIGGARCECVAGYALNTEGKITRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVC---CTMMP-DLCRNGVCI-NNDGSFRCQCKMGFKLDASGHHCE----DKNECVETPG---------------------ICKTGNCTNIEGSYTCTCPVGYAPTRDSPSCSD 255          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Nematostella
Match: EDO49410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE4])

HSP 1 Score: 125.176 bits (313), Expect = 1.400e-29
Identity = 147/580 (25.34%), Postives = 235/580 (40.52%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQ--WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGY-NYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS----YDRKKCTSICD-LYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDS--------------KSSQGDIDFCFYSYYRDQCKGG--------ACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCN---------------------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGI-CKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINS 2249
            C++GF+       DINEC+   +   ++  C N  GS+ C C + +Q + +     +   +C+     C P   C +    +++C+CL G+    DG  CS       D C+      C       + +  + C C +G++   DGK+C    +  +  +    PN  C +    Y+C+C  GYT       D  +CT+  D     +LC +          + CRCL GF   G GK C  I  ++ E G    + D+              K   GD   C      D+CK G         C N    + C+C  G+  D QG+ C +  E KT + +   ++    T     G+F+C                            N  CI S  SY C C  G+    +GK C+D +EC  +  +CD    C N+PGSY C C  GF       G  C D +EC ++  +C N   C N  GS+ C+C  G+  +++ + C  + + S+  +D   + IC           G F+C C NG   + +  LCA +++  +   +   N      + S
Sbjct:  113 CKQGFVGDGRFPVDINECEVRIADCSQNATCTNTNGSYSCTCKAGFQGNGIVC---RDIDECQAGKYSCDPNALCTNTE-GSYVCRCLKGFTG--DGLVCSD-----IDECKVTELNNCDANALCTNIFGTFVCRCRKGFVG--DGKTCVDVDECASVLHNKCDPNALCTNSVGSYVCRCKKGYTGDGITCKDIDECTNKTDDCDANALCTNVL------GSFVCRCLKGFE--GNGKTC--IHDNECESGANDCSPDAVCTNTPGSFVCRCNKGFTGDGKICIDV---DECKTGQVKCGENEVCANSLGSFTCQCAEGYERDSQGK-CADVNECKTGKHDCSVNALCTNTD----GTFICRCLRGYIGDGKTCIDFDECKLPKNDCDVNAECINSIGSYSCICKPGFTG--NGKTCTDKNECVGSDLLCDPNALCTNTPGSYLCRCKSGF----QGDGKTCADVDECIKSDDICGNNTECLNNVGSYTCKCKEGFEDNDQDKHCKDIDECSDGSHDCHVNAICTNVP-------GTFLCRCINGF--LGDGKLCADINECFEGTANCDINAECTNSVGS 646          

HSP 2 Score: 110.153 bits (274), Expect = 7.913e-25
Identity = 133/495 (26.87%), Postives = 202/495 (40.81%), Query Frame = 3
Query:  684 RCEKGFIEIDGICQDINECQWSQI--CKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSL-CPDGQCIPQPNNGYECRCLPGFAPMGKGK-----QCRRIMSDQSEIGPTSSNEDS-------KSSQGD----IDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLC---------------------------NNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNK 2012
            RC KGF     +C DI+EC+ +++  C +   C N  G+F C C   +  D     CV   +    + N C P   C + S+ +++C+C  GY    DG +C    +  NK D C          G        + C C +G+    +GK+C    + C        P+  C +    ++C+C+ G+T   D K C  + +     + C + +        + C+C  G+    +GK     +C+    D S +    +N D        +   GD    IDF      ++ C   A CIN    Y C C PGF     G+ C ++ E   + +    ++    T     GS+LC                           NN  C+ +  SY C+C  G++ +   K C DIDECS     C     C N PG++ C C +GF    +  G  C D NEC E T+ C  N  C N+ GS+ CQC  GY    K
Sbjct:  194 RCLKGFTGDGLVCSDIDECKVTELNNCDANALCTNIFGTFVCRCRKGFVGDGKT--CVDVDECASVLHNKCDPNALCTN-SVGSYVCRCKKGYTG--DGITCKDIDECTNKTDDCDANALCTNVLGS-------FVCRCLKGF--EGNGKTCIHDNE-CESGANDCSPDAVCTNTPGSFVCRCNKGFTG--DGKICIDVDECKTGQVKCGENEVCANSLGSFTCQCAEGYERDSQGKCADVNECKTGKHDCS-VNALCTNTDGTFICRCLRGYIGDGKTCIDFDECKLPKNDCDVNAECINSIGSYSCICKPGFT--GNGKTCTDKNECVGSDLLCDPNALCTNTP----GSYLCRCKSGFQGDGKTCADVDECIKSDDICGNNTECLNNVGSYTCKCKEGFEDNDQDKHCKDIDECSDGSHDCHVNAICTNVPGTFLCRCINGF----LGDGKLCADINECFEGTANCDINAECTNSVGSYNCQCMEGYTGDGK 660          

HSP 3 Score: 106.301 bits (264), Expect = 1.071e-23
Identity = 135/498 (27.11%), Postives = 194/498 (38.96%), Query Frame = 3
Query:  726 DINECQWSQICKS---GKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASS----DGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            D++EC    +        CIN  GSF+C C   Y+ +    +      +C   P +CG    C++ +  ++ C C  GY  S DG      + + YD C   G   C     C     +YKC C QG++       D   C+  +  C++       N  C + +  Y C C +G+  +    +    C     S  P+  C       Y CRCL GF   G G  C                        DID C  +   +      C N+   + C C  GFV D  G+ C +        +++ AS   L  +CD        N  C  S  SY C+C  GY    DG  C DIDEC+     CD    C N  GS+ C C  GF  +    G  C   NEC    + C  + +C NT GSF C+CN G+    K   C+ V +    +     +++C         S G F C C  G +   + G CA V++
Sbjct:    1 DVDECSTPGVATCSNLATCINTPGSFKCECKPGYKGN---GEICTDADECTATPGICGENSICIN-TPGSYQCSCKEGYQPSSDG------NCDDYDECAG-GIADCDINSVCTNTLGSYKCTCKQGFVGDGRFPVDINECEVRIADCSQ-------NATCTNTNGSYSCTCKAGFQGNGIVCRDIDECQAGKYSCDPNALCT-NTEGSYVCRCLKGF--TGDGLVCS-----------------------DIDECKVTELNNCDANALCTNIFGTFVCRCRKGFVGD--GKTCVD--------VDECAS--VLHNKCDP-------NALCTNSVGSYVCRCKKGYTG--DGITCKDIDECTNKTDDCDANALCTNVLGSFVCRCLKGFEGN----GKTCIHDNECESGANDCSPDAVCTNTPGSFVCRCNKGFTGDGKI--CIDVDECKTGQVKCGENEVCAN-------SLGSFTCQCAEGYERDSQ-GKCADVNE 419          

HSP 4 Score: 77.411 bits (189), Expect = 1.355e-14
Identity = 86/298 (28.86%), Postives = 121/298 (40.60%), Query Frame = 3
Query: 1506 ACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYFELFSATDREDFRSKVTTQFNDTVLDKCESSTEDKIKPGVRC 2393
             CIN    ++CEC PG+     G+ C +  E                  C         N  CI +  SYQC C  GYQ S DG  C D DEC+   + CD    C N+ GSY+C+C  GF    +  G    D NEC    + C +N  C NT GS+ C C +G+  +     C  + +    KY  +P+ +C         + G +VC C  G      TG     S I + +    +N     D N+   N+ F  F    R+ F     T  +   +D+C S   +K  P   C
Sbjct:   18 TCINTPGSFKCECKPGY--KGNGEICTDADE------------------CTATPGICGENSICINTPGSYQCSCKEGYQPSSDGN-CDDYDECAGGIADCDINSVCTNTLGSYKCTCKQGF----VGDGRFPVDINECEVRIADCSQNATCTNTNGSYSCTCKAGFQGNGIV--CRDIDECQAGKYSCDPNALCTN-------TEGSYVCRCLKGF-----TGDGLVCSDIDECKVTELNNC----DANALCTNI-FGTFVCRCRKGFVGDGKTCVD---VDECASVLHNKCDPNALC 268          

HSP 5 Score: 53.1434 bits (126), Expect = 3.975e-7
Identity = 61/237 (25.74%), Postives = 108/237 (45.57%), Query Frame = 3
Query:  684 RCEKGFIEIDGICQDINECQWSQ-ICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPD--GQCIPQPNNGYECRCLPGFAPMGKGKQC 1382
            RC +G+I     C D +EC+  +  C  + +CIN  GS+ C+C   +  +         K +C     LC P   C + +  ++LC+C  G+    DGK+C+       D C        +  +C+ +  +Y C+C +G+  +   K CK  +D C+  +     N  C ++   ++C+C +G+    D K C  I + +  +   D   +C     + Y C+C+ G+   G GK C
Sbjct:  443 RCLRGYIGDGKTCIDFDECKLPKNDCDVNAECINSIGSYSCICKPGFTGNGKTC---TDKNECVGSDLLCDPNALCTN-TPGSYLCRCKSGF--QGDGKTCAD-----VDECIKSDDICGNNTECLNNVGSYTCKCKEGFEDNDQDKHCKD-IDECSDGSHDCHVNAICTNVPGTFLCRCINGFLG--DGKLCADINECFEGTANCDINAECTNSVGS-YNCQCMEGY--TGDGKNC 662          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Medaka
Match: fbn2b (fibrillin-2 [Source:NCBI gene;Acc:101168694])

HSP 1 Score: 187.578 bits (475), Expect = 3.160e-48
Identity = 208/784 (26.53%), Postives = 310/784 (39.54%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDE-------------EDQ----SXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFIE--IDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKY-----------------------------------DMCRFYG-----------PYVCHFGKCIADGYNYKCECNQGYI----------------------------------ASSDGKSCKKT--VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVE----YKTNQMNDVASSFSLKTQCDKFGSFLCNNG------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDIN 2246
            ++CG   NS+ CC G++  + G+  I IC N CG +G C RPN C CSNG ++ +C +             ED        +  +  +       N G      RC C  GFTG  C     G CF  ++  +C     G+  +K LCC     AWG PC++C  +   C +GFI     G CQ ++ECQ    +C  G CIN  GS+ C C + ++    Q++   +  +C  IP +C  G    S +  +++C C  GY+ S DG  C ++    +                                   +MC   G             +C  G+CI    +Y+CECN GY                                       G   K+   +D C   NGV+C NG+CV+    + C C++G+  + D K C    +    ++C +G CI + +  ++C C PGF     G+ C                         ID C        C  G CIN +  +RCEC PG  +D  G+ C +       Y   +M   +          +   F  ++G       C    S +Q  C++G   + DG+    I+EC+++P IC  G C N  GSY+C C  G+   +   G  C+  NEC     LC NG+C+NT GS+ C C  GY+     + C   +  SN   +             C+   G F C C +G        +C  VS        I DN R   +IN
Sbjct:    2 NVCGSRFNSY-CCPGWKTLAGGNQCIVICRNSCG-DGFCSRPNMCTCSNGQLSPNCVQSCNVRCMNGGSCMEDSCLCPKGYSGGHCGQVCENGCQNGGRCIGPNRCACVYGFTGPQCERYRTGPCFTQVNNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEQCPAQPHPCRRGFIPNIRTGACQ-VDECQAVPGLCSGGNCINTVGSYECKCPAGHR----QSETSHKIDECSTIPGVCDGGE--CSNTAGSYVCTCPRGYISSTDGSRCVQRVGTCFSALANGRCAAELNGQYTKMQCCCETGRCWALGQIPEMCPVRGSNETIDVCKHLTNLCLNGRCIPTASSYRCECNMGYKQDIRRECIVDECLNNPCVNGDCVNTPGSYYCRCHKGYQGTPTKQACIIDECI-VNGVMCRNGRCVNTEGSFQCICNAGFELTSDGKNCIHD-ECATTNMCLNGMCINE-DGSFKCICKPGFTLAPNGRYCT------------------------IDEC---QTPGICMNGRCINSEGSFRCECPPGLAVDVDGRVCVDTHMRTTCYGAIKMGTCSRPLPGAVTKSECCCFSPDHGFGQPCQPCPSRNSEFQAVCSSGIGITTDGR----INECALDPDICQNGICENLLGSYRCICNIGY--ESDTSGKNCF-INECLVNRLLCDNGLCRNTPGSYTCTCPKGYVFRPDSETCEINECESNPCVNGA-----------CRNVAGSFHCECAHGSKLDSTNTIC--VSMKSTCWLTIQDN-RCEVNIN 725          

HSP 2 Score: 184.882 bits (468), Expect = 2.356e-47
Identity = 158/558 (28.32%), Postives = 241/558 (43.19%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEI---VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKC--EQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHY-CKYSNGLFVCSCPNG 2144
             C+C  G    S + I   +   C+L++    C  +  G  L  E CC     AWG PC RCE+  C +GF  + G+  +I+EC+ +  +C +G+C+N +GSF C C+     D     CV R + C  +   + CG  +          +C C  G    +D + C K+   ++      GP   + G  +     YK                   V+ C  + G+ C +G C +    + C+C+SG+T + + + CT I  C + P  LC  G C+  P + +EC C  G+         +  M D+ E  P                         C GG C+N    Y CEC  G++L  +              MN+   S SL           C NG+C+    +YQC C+TGYQA+ D + C DIDEC+I    C+   C NS GSY+CSC +G+ +  MP    C   +EC ET  +C  G C N  G ++C C  G+++S   + C+  + + N             C H  C+ + G F+C C  G
Sbjct:  688 HCECAHGSKLDSTNTICVSMKSTCWLTIQDNRCEVNINGATLKSE-CCSTLGAAWGSPCDRCEITACSRGFARMKGLVCEIDECEVFPGVCTNGRCVNTQGSFLCECAEGLTLDSTGRTCVMRSELCYKKWHEDECGEPL---PGKYRLDMCCCTVGAAWGVDCEECPKEDTPEFKAICPRGPGFANRGDILTGRPFYK-------------------VNECKVFRGL-CTHGNCRNTIGSFKCRCNSGFTLTAEERNCTDIDECRISP-DLCGHGTCVNTPGS-FECECFEGY--QSGFMMMKNCMIDECETNPA-----------------------LCLGGTCLNTDGSYECECPSGYLLSSEASV-----------MNECQLSDSL-----------CKNGQCVNMPGTYQCSCDTGYQATPDRQGCVDIDECTIMNGGCET-HCTNSEGSYECSCTEGYAL--MPDLRTC-SIDECEETPDICDGGQCSNIPGEYRCLCFDGFMASMDMRTCIVNECDLNPNI----------CLHGDCENTKGSFICHCQLG 1158          

HSP 3 Score: 145.206 bits (365), Expect = 8.780e-35
Identity = 161/597 (26.97%), Postives = 251/597 (42.04%), Query Frame = 3
Query:  606 LQLSKELCCGAFQV--AWGDPCQRCELGRCE---------KGFI-EIDGICQDINEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQ---------------CKGGACINMKNHYRCECLPGFVLDKQGQACKERVE------YKTNQMNDVASSFSLKTQC---------------------DKFGSF-------------------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSI-NPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
              ++K++CC A+ V  AW  PC+ C     E          GFI +I      I+EC +   IC +G CIN+ GSFRC C   + ++ +    +    +C    NLC    +C+++   ++ C+C PG+ K   G +C +    +        P VC  G+CI    +Y+C C+ G+ A++D   C   +D C R     C NG C +    Y C C  G+  +++   C  I  C      +C +G+CI +  + ++C C  G+     GK C  ++++      T S    ++  G         Y  Q               C+ G C N    ++C C PGFVL    + C +  E      ++  +     +  + K +C                     D F +                          +C NG CI +  S++C+C  GY     G  C   DECSI NP  C  GTC N  G ++CSC +GF     PG     + NEC++   LC    C NT+GS++C C +GY+  + ++ C   QD  ++  D   SK        CK   G F+C CP G+
Sbjct: 1543 FNMTKKMCCCAYNVGKAWNKPCEACPTPATEYQLLCGNQAPGFIIDIHTGKPIIDECREIPGICANGVCINQIGSFRCECPMGFSYNNI----LLIIDECNSGDNLCQRNANCINIP-GSYRCECSPGF-KLSPGGACLRNECQEI-------PNVCSHGECIDTQGSYRCLCHNGFKATADQTMC--MIDECERQ---PCGNGTCKNTVGSYNCLCFPGFELTHN-NDCMDIDECSALQGQVCRNGRCINELGS-FQCLCSEGYENTADGKNC--VINECLNFPGTCSPGTCQNLDGTFRCICPPGYEVQNEQCIINECDVEPNICQFGTCTNTPGSFQCSCQPGFVLSDNKRRCYDTRESFCFTKFEGGKCTVPKAFNTTKAKCCCSKMPGEGWGFPCELCPNQNDAFNTLCPYGHGALPGLDDTREMNECLENPGICQNGICINTDGSFRCECPFGYNLDFTGVNCV-TDECSIGNP--CGNGTCTNVVGGFECSCQEGFE----PGPMMTCEINECSQNPLLCAF-RCVNTFGSYECMCPAGYVLRDDQRMCR--QDECSEGMDDCESK-----GMTCKNLIGTFMCICPPGM 2102          

HSP 4 Score: 133.265 bits (334), Expect = 4.183e-31
Identity = 156/614 (25.41%), Postives = 237/614 (38.60%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGE-CFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE--------------LGRCEKGFIEIDGICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKS-LDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFT---------------------IHNMPGGPKCY------------DRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCA 2177
            C+C  G T    G++C  ++  E C+       C   P   +   ++CC     AWG  C+ C                G   +G I        +NEC+ +  +C  G C N  GSF+C C+S +     + +C     +C   P+LCG G  CV+ +  +  C+C  GY    +  K+C        D C    P +C  G C+    +Y+CEC  GY+ SS+     +      + +  +C NG+CV++   Y C CD+GY ++ DR+ C  I +    +   +  C       YEC C  G+A M   + C     D+ E  P                       D C GG C N+   YRC C  GF+     + C                   +  +CD     +C +G C  +  S+ C C  GY        C+ IDEC I    CD    C+N PGS++C C  G+                        N PG  +C               +EC +  +LC+NG C N  G ++C+C  G+  +   + C        Q  +     IC      C+   G+F C C +G +     G C 
Sbjct:  791 CECAEGLTLDSTGRTC--VMRSELCYKKWHEDEC-GEPLPGKYRLDMCCCTVGAAWGVDCEECPKEDTPEFKAICPRGPGFANRGDILTGRPFYKVNECKVFRGLCTHGNCRNTIGSFKCRCNSGFTLTAEERNCTD-IDECRISPDLCGHGT-CVN-TPGSFECECFEGYQSGFMMMKNC------MIDECE-TNPALCLGGTCLNTDGSYECECPSGYLLSSEASVMNEC-----QLSDSLCKNGQCVNMPGTYQCSCDTGYQATPDRQGCVDIDECTIMNGGCETHCT-NSEGSYECSCTEGYALMPDLRTCS---IDECEETP-----------------------DICDGGQCSNIPGEYRCLCFDGFMASMDMRTC-------------------IVNECD-LNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCT-IDECEIGAHNCDMHAACVNLPGSFKCRCQAGWIGDGIKRDECTLEDNSCHHNADCANTPGSYRCMCKEGFNGDGFTCSMDECADNVNLCENGQCLNAPGGYRCECEMGFTPTEDSKAC--------QIDECNFQNICV--FGTCQNLPGMFRCVCDDGYELDRSGGNCT 1328          

HSP 5 Score: 129.028 bits (323), Expect = 7.340e-30
Identity = 156/643 (24.26%), Postives = 240/643 (37.33%), Query Frame = 3
Query:  687 CEKGF-IEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV--QRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCL-PGYVKSLDGKSCSKQSANKYDMCR--------------FYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC-TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQC--------RRIMSDQSEI---GPTSSNE---------DSKSSQGDIDFCFYSYYRDQ---------------CKGGACINMKNHYRCECLPGFVLDKQGQACKERVE--YKTNQMNDVASSF------------------------------SLKTQCDKFGSF-----------------------LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF-------------------------TIHNMPGGPKCY------------DRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCA 2177
            C+ GF +  +G    I+ECQ   IC +G+CIN  GSFRC C      D     CV    +  C     + G     +  ++    C C  P +      + C  +++    +C                  P +C  G C     +Y+C CN GY + + GK+C   ++ C   N ++C NG C +    Y C C  GY    D + C  + C+  P   C +G C       + C C  G         C          I  ++ E+   G T  +E          S   + +I  C   + R +               C  G C+N +  + CEC  G  LD  G+ C  R E  YK    ++                                     K  C +   F                       LC +G C  +  S++C+CN+G+  + + + C+DIDEC I+P +C  GTC+N+PGS++C CF+G+                         T  N  G  +C               NEC  + SLCKNG C N  G++QC C++GY ++  +Q CV +          E + +   C  +C  S G + CSC  G   + +   C+
Sbjct:  462 CKPGFTLAPNGRYCTIDECQTPGICMNGRCINSEGSFRCECPPGLAVDVDGRVCVDTHMRTTCYGAIKM-GTCSRPLPGAVTKSECCCFSPDHGFGQPCQPCPSRNSEFQAVCSSGIGITTDGRINECALDPDICQNGICENLLGSYRCICNIGYESDTSGKNC--FINECL-VNRLLCDNGLCRNTPGSYTCTCPKGYVFRPDSETCEINECESNP---CVNGACR-NVAGSFHCECAHGSKLDSTNTICVSMKSTCWLTIQDNRCEVNINGATLKSECCSTLGAAWGSPCDRCEITACSRGFARMKGLVCEIDECEVFPGVCTNGRCVNTQGSFLCECAEGLTLDSTGRTCVMRSELCYKKWHEDECGEPLPGKYRLDMCCCTVGAAWGVDCEECPKEDTPEFKAICPRGPGFANRGDILTGRPFYKVNECKVFRGLCTHGNCRNTIGSFKCRCNSGFTLTAEERNCTDIDECRISPDLCGHGTCVNTPGSFECECFEGYQSGFMMMKNCMIDECETNPALCLGGTCLNTDGSYECECPSGYLLSSEASVMNECQLSDSLCKNGQCVNMPGTYQCSCDTGYQATPDRQGCVDID---------ECTIMNGGCETHCTNSEGSYECSCTEGYALMPDLRTCS 1087          

HSP 6 Score: 129.028 bits (323), Expect = 8.863e-30
Identity = 154/584 (26.37%), Postives = 226/584 (38.70%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSL----SRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCE--------KGF--------IEID------GICQD--------------------------INEC-QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKY----------------------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN 2042
            TG  C   V G CFL +      G+      G+ +++  CC A  +AWG+PC+ C     E        +GF        +EID      G+CQ                           I+EC     IC  G C N  G++ C+C   Y       +C+ RK  C +  N      + +S ++   +C C     K+ + K C      A +Y                      D CR   P +C  G CI    +++CEC  G+  ++        +D C   + +   N  C+++   Y C+C  G+  S       + C   P ++C  G+CI      Y C C  GF        C   M D+ E                         R  C  G C N    Y C C PGF L               N   D+    +L+ Q       +C NGRCI    S+QC C+ GY+ + DGK C  I+EC   P  C  GTC N  G+++C C  G+ + N     +C   NEC    ++C+ G C NT GSFQC C  G++ S+ K+ C   +++
Sbjct: 1363 TGVGCVNRV-GNCFLDILPRGDGGIYCTAEVGVGVTRASCCCAKALAWGEPCEICPSPNSEYKTLCPGGEGFRPNPITVILEIDECQELPGLCQGGKCINTFGSFQCECPAGYYLNEDTRIIDECVTHIGICGPGTCYNTFGNYTCVCPPEYMQVNGGNNCMMRKSVCYR--NFNDTCENELSFNMTKKMCCCAYNVGKAWN-KPCEACPTPATEYQLLCGNQAPGFIIDIHTGKPIIDECREI-PGICANGVCINQIGSFRCECPMGFSYNNI----LLIIDECNSGDNLCQRNANCINIPGSYRCECSPGFKLSPGGACLRNECQEIP-NVCSHGECI-DTQGSYRCLCHNGFKATADQTMC---MIDECE-------------------------RQPCGNGTCKNTVGSYNCLCFPGFELTHN------------NDCMDIDECSALQGQ-------VCRNGRCINELGSFQCLCSEGYENTADGKNCV-INECLNFPGTCSPGTCQNLDGTFRCICPPGYEVQN----EQCI-INECDVEPNICQFGTCTNTPGSFQCSCQPGFVLSDNKRRCYDTRES 1882          

HSP 7 Score: 123.635 bits (309), Expect = 4.002e-28
Identity = 168/653 (25.73%), Postives = 250/653 (38.28%), Query Frame = 3
Query:  498 RCQCKPGFTGK--SCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQD-----------------------INECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKC--EQIPNLCGPGMDC---VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYG-------------------PYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT---SICDLYPRSLCPDG------------------------QCIPQPNNGYECRC---LPGF-APMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGD------IDFCFYSYYR--DQCKGG--------ACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI-HNMPGGPKCYDRNECTETTS-LCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLE 2162
            RC CK GF G   +CS     +       G C+  P G +   E+          +  + C++  C    I + G CQ+                       INEC     C +G C+N  GS+ C C   ++ +P    CV R   C  + +P   G G+ C   V + +    C C          + C   ++    +C                       P +C  GKCI    +++CEC  GY  + D     + +D C  + G+  P G C +   +Y C C   Y        C    S+C       C +                         +  P P   Y+  C    PGF   +  GK    I+ +  EI    +N    +  G       + F + +     D+C  G         CIN+   YRCEC PGF L   G AC                   L+ +C +  + +C++G CI++  SY+C C+ G++A+ D  +C  IDEC   P  C  GTC N+ GSY C CF GF + HN      C D +EC+     +C+NG C N  GSFQC C+ GY ++   ++CV + +  N      P          C+  +G F C CP G +   E
Sbjct: 1232 RCMCKEGFNGDGFTCSMDECADNVNLCENGQCLNAPGGYRCECEM-----GFTPTEDSKACQIDECNFQNICVFGTCQNLPGMFRCVCDDGYELDRSGGNCTINECADPVNCINGICVNTPGSYLCNCPGDFELNPTGVGCVNRVGNCFLDILPRGDG-GIYCTAEVGVGVTRASCCCAKALAWGEPCEICPSPNSEYKTLCPGGEGFRPNPITVILEIDECQELPGLCQGGKCINTFGSFQCECPAGYYLNED----TRIIDECVTHIGICGP-GTCYNTFGNYTCVCPPEYMQVNGGNNCMMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNKPCEACPTPATEYQLLCGNQAPGFIIDIHTGKP---IIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLIIDECNSGDNLCQRNANCINIPGSYRCECSPGFKLSP-GGAC-------------------LRNECQEIPN-VCSHGECIDTQGSYRCLCHNGFKATADQTMCM-IDECERQP--CGNGTCKNTVGSYNCLCFPGFELTHNN----DCMDIDECSALQGQVCRNGRCINELGSFQCLCSEGYENTADGKNCV-INECLNFPGTCSPGT--------CQNLDGTFRCICPPGYEVQNE 1833          

HSP 8 Score: 117.472 bits (293), Expect = 2.922e-26
Identity = 141/523 (26.96%), Postives = 211/523 (40.34%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLC-GPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN---GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFC--FYSYYRDQCKGGA------CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN------DVASSFSLK--------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTE----TTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            C++GF     +  +INEC  + +  + +C+N  GS+ C+C + Y     Q  C  R+ +C +  + C   GM C +L I   +C C PG  +  DG+ C        + CR   P +C  G+CI    +Y+CECN G+  S  G  C     FC  Y  V+             +CQ  S   +S  + +C   C    R   P  +  P P        C   PGF   G+  +C+ +M D  + G   +   S     +I +   F +   D+C          C N +  Y C C  G+ L   G+ CK   E  T Q N      +    F+ K               +C    S   +   C+ +  S+ C+C+ G+     G  C ++DECS N   C  G C N  G Y+C C  G+  H        Y  N+C E    + ++C +  C NT GSF+C C SG+        C  V          E S     C + C  ++G + C CP G 
Sbjct: 2016 CQEGFEPGPMMTCEINECSQNPLLCAFRCVNTFGSYECMCPAGYVLRDDQRMC--RQDECSEGMDDCESKGMTCKNL-IGTFMCICPPGMQRRPDGEGC------MLNECRAK-PGICKNGRCINTVGSYRCECNDGFEPSLTGTECINRKGFC--YTEVL-----------RTMCQQSSTNRNSVTKSEC---CCNMGRGWGPQCELCPLPGTVQYKKMCPLGPGFTTDGRINECQ-VMPDLCQNGQCINTIGSFRCHCNIGYKADFTATSMDECSLSPKPCNFLCKNTEGSYLCSCPRGYTLQPDGKTCKLD-ECSTKQHNCQFLCVNTIGGFTCKCPPGFSQHQTACINNECSAPNSVCGSRASCVNTPGSFNCECSKGFSLDNTGMEC-EVDECSSN-HRCQHG-CQNMMGGYRCGCPQGYVQH--------YQWNQCVENECQSGTICGSASCYNTLGSFKCTCPSGFEFEQNAGGCQDVN---------ECSMGANPCIYGCSNTDGGYQCGCPGGF 2490          

HSP 9 Score: 114.39 bits (285), Expect = 3.055e-25
Identity = 156/563 (27.71%), Postives = 223/563 (39.61%), Query Frame = 3
Query:  498 RCQCKPGF--------TGKSCSEIVN----GECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQR--CELGRCEK-----------GF-IEIDGICQDINECQW--SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVD-FC-TRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTN-----QMNDVASSFSLKTQCDKF---------------GSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQG--TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVS 2030
            RC+C PGF            C EI N    GEC  +     C+ H  G + + +       +   D C+R  C  G C+            GF +  +  C DI+EC     Q+C++G+CINE GSF+CLCS  Y+      +CV    +C   P  C PG  C +L      C C PGY   +  + C     N+ D+     P +C FG C     +++C C  G++ S + + C  T + FC T++ G  C   K  + +    C C       +           +P  LCP+       N+ +   C     P G G      + D  E+     N                     C+ G CIN    +RCEC  G+ LD  G  C        N        +V   F    Q + F                  LC   RC+ +  SY+C C  GY    D ++C   DECS     C+    TC N  G++ C C  G  +   P G  C   NEC     +CKNG C NT GS++C+CN G+  S    +C++
Sbjct: 1659 RCECSPGFKLSPGGACLRNECQEIPNVCSHGECIDTQGSYRCLCH-NGFKATADQ-----TMCMIDECERQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDIDECSALQGQVCRNGRCINELGSFQCLCSEGYENTADGKNCV--INECLNFPGTCSPGT-CQNLD-GTFRCICPPGY--EVQNEQCI---INECDV----EPNICQFGTCTNTPGSFQCSCQPGFVLSDNKRRCYDTRESFCFTKFEGGKCTVPKAFNTTKAKCC-CSKMPGEGWG----------FPCELCPN------QNDAFNTLC-----PYGHGA--LPGLDDTREMNECLENPGI------------------CQNGICINTDGSFRCECPFGYNLDFTGVNCVTDECSIGNPCGNGTCTNVVGGFECSCQ-EGFEPGPMMTCEINECSQNPLLCAF-RCVNTFGSYECMCPAGYVLRDDQRMCRQ-DECSEGMDDCESKGMTCKNLIGTFMCICPPG--MQRRPDGEGCM-LNECRAKPGICKNGRCINTVGSYRCECNDGFEPSLTGTECIN 2154          

HSP 10 Score: 88.9669 bits (219), Expect = 1.744e-17
Identity = 122/495 (24.65%), Postives = 180/495 (36.36%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTS-SYDRKKCT---------SICDLYPRS--------------------------LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSD-IDECSINPSICDQG--------------------------------TCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGY 1997
            C DI+EC          C N  GS+ C C+  Y   P    C     +CE+ P++C  G    S     + C C  G++ S+D ++C     N+ D+     P +C  G C     ++ C C  GY        C  T+D C         +  CV+L   + C+C +G+      R +CT         + C   P S                          LC +GQC+  P  GY C C  GF P                       EDSK+ Q  ID C    +++ C  G C N+   +RC C  G+ LD+ G  C          +N+ A   +            C NG C+ +  SY C C   ++ +  G  C + +  C ++  I  +G                                 C +    Y+  C  G      P      + +EC E   LC+ G C NT+GSFQC+C +GY
Sbjct: 1045 CVDIDECTIMNGGCETHCTNSEGSYECSCTEGYALMPDLRTC--SIDECEETPDICDGGQ--CSNIPGEYRCLCFDGFMASMDMRTCI---VNECDL----NPNICLHGDCENTKGSFICHCQLGYFVKKGSTGC--TIDECEIGAHNCDMHAACVNLPGSFKCRCQAGWIGDGIKRDECTLEDNSCHHNADCANTPGSYRCMCKEGFNGDGFTCSMDECADNVNLCENGQCLNAPG-GYRCECEMGFTPT----------------------EDSKACQ--IDEC---NFQNICVFGTCQNLPGMFRCVCDDGYELDRSGGNCT---------INECADPVN------------CINGICVNTPGSYLCNCPGDFELNPTGVGCVNRVGNCFLD--ILPRGDGGIYCTAEVGVGVTRASCCCAKALAWGEPCEICPSPNSEYKTLCPGGEGFRPNPI-TVILEIDECQELPGLCQGGKCINTFGSFQCECPAGY 1474          

HSP 11 Score: 55.8398 bits (133), Expect = 2.314e-7
Identity = 91/380 (23.95%), Postives = 137/380 (36.05%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQ-LSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQ---------DINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQA---DCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCS-KQSANKYDMCRFY-----GPYVCH--------------------------FGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT-------SICDLYP--------RSLCPDG---------------------QCI---PQPNNGYECRCLPGFAPMGK 1370
            RC+C  GF    TG  C     G C+  + R +C +       ++K  CC      WG  C+ C L     G ++   +C           INECQ    +C++G+CIN  GSFRC C+  Y+ D       +C    K C  +             +  ++LC C  GY    DGK+C   + + K   C+F      G + C                              C+    ++ CEC++G+   + G  C+  VD C+  +   C +G C ++   Y C C  GY   Y   +C        +IC            +  CP G                      CI      + GY+C C  GF   G+
Sbjct: 2136 RCECNDGFEPSLTGTECIN-RKGFCYTEVLRTMCQQSSTNRNSVTKSECCCNMGRGWGPQCELCPL----PGTVQYKKMCPLGPGFTTDGRINECQVMPDLCQNGQCINTIGSFRCHCNIGYKADFTATSMDECSLSPKPCNFL----------CKNTEGSYLCSCPRGYTLQPDGKTCKLDECSTKQHNCQFLCVNTIGGFTCKCPPGFSQHQTACINNECSAPNSVCGSRASCVNTPGSFNCECSKGFSLDNTGMECE--VDECSSNH--RCQHG-CQNMMGGYRCGCPQGYVQHYQWNQCVENECQSGTICGSASCYNTLGSFKCTCPSGFEFEQNAGGCQDVNECSMGANPCIYGCSNTDGGYQCGCPGGFYRAGQ 2495          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Medaka
Match: FBN1 (fibrillin 1 [Source:NCBI gene;Acc:101171649])

HSP 1 Score: 182.185 bits (461), Expect = 1.643e-46
Identity = 170/583 (29.16%), Postives = 240/583 (41.17%), Query Frame = 3
Query:  522 TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGR-CEKGFIEIDG-ICQDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ-RKKKC--EQIPNLCG---PGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGF-APMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQC-DKFGSFLCN-----------------------NGRC----IESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGF-TIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGL 2147
            TG  C E V   C+L +    C  +  G  L K  CC     AW  PC +CE    C KGF  + G +C+D++ECQ +  +C +GKC+N +GSF C C      D     C+  R + C        CG   PG   V        C C  G     +   C +    ++      GP   H G  I                  +G+   K ++ C   N  +C NG+C +    + C+CD+G+    D + CT I  C + P  LC  G C+  P + +EC C  GF +     K C  I  D+ E  P                         C+GG C+N +  ++C C PG  +   G AC++  E       D++       QC +  GS+ CN                       NG C      S  SY+C C+ GY    D + C DIDEC  NPS CD G C N PG+YQC CFDGF +  +M     C D +EC   +++C +G C+NT GSF C C+ GY        C  + +     ++ +    C         + G F C+C  G 
Sbjct:  851 TGLECIETVKSTCWLKMVNNRCEVNINGATL-KSHCCATLGEAWNSPCAKCEKDPICGKGFARVKGNVCEDVDECQVFPGVCINGKCVNTQGSFFCQCPPGMTVDVSGRTCIDLRTEHCYLTHDDERCGTPIPGRHRVDA------CCCSVGVAWGPECDECPENGTPEFAQLCPRGPGFSHRGDFI------------------NGRPFLKDINECRMIN-TLCSNGRCRNTIGSFRCRCDNGFALDADERNCTDIDECRISP-DLCGQGTCVNTPGD-FECNCFEGFESGFMMMKNCMDI--DECERNP-----------------------QLCRGGECVNTEGSFQCICPPGHEITPDGSACQDINEC------DLSDRLCRNGQCVNMVGSYYCNCNTGYKSTEDLVNCVDIDECTIENGGCETFCTNSEGSYECSCHNGYALMPDQRSCIDIDECEENPSTCDGGQCTNIPGTYQCLCFDGFMSSEDM---KSCLDVDECELNSNICLSGNCENTKGSFICHCDLGYSVRKGTTGCTDINECEIGAHNCDRQATCTN-------TAGSFKCNCAPGW 1364          

HSP 2 Score: 174.096 bits (440), Expect = 6.364e-44
Identity = 186/696 (26.72%), Postives = 286/696 (41.09%), Query Frame = 3
Query:  237 HICGVNENSFVCCSGYRLDSEGD-CTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEED-----------------------QSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCS-EIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC--ELGRCEKGFI--EIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYI----CQCDSG--YTSSYDRKKCT-----SICDLY-----PRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFY-SYYRDQCKGGACINMKN-HYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKV 2183
            ++CG   N+F CC G++  + G+ C +PIC + CG +G C RPN C C NG IA +C  +                        +                 N G      RC C  GFTG  C  +   G CF S++  +C     G+  +K LCC     AWG PC+ C  +   C +GFI     G CQD++EC                                            IP +C  G +C++ ++ +  CKC  G+  +   + C        D C    P +C  G+C     +Y C+C QGY  S DG  C   +D    Y      NG+C + ++  +    C CDSG  ++     + C       +  L      PR   P+   +P+P+       + G  P+ + ++    + +Q+ I P        ++      C    +YR+ C  G C+ +    YRCEC  GF LD++G+ C +  E + N                      C +G C+ +  SY CQC  G+Q++     C D+DEC  N  IC+ G C+N+ GS+ C C  GF I     G  C D++EC    ++C NG+C N  GSF+C C SG++     + CV +        + E   +C   + +C  + G F C C  G+   L+  +C   
Sbjct:   66 NVCGSRNNAF-CCPGWKTLTGGNQCIVPICRSMCG-DGFCSRPNLCTCPNGQIAPTCGSKSGIQNCNIRCMNGGSCAEDHCLCQKGYVGNHCGQPVCENGCLNGGRCVAPNRCVCTYGFTGAQCERDYRTGPCFASVNNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNHRTGACQDVDECH------------------------------------------AIPGIC-QGGNCIN-TVGSFECKCPAGHKFNEISQKCED-----LDECSNI-PGLCGVGECSNTVGSYFCKCPQGYYTSVDGSRC---IDGRGGYCYASLLNGRCANQNSQLLTKMQCCCDSGRCWSDGSTPEMCPIRGTGGVAHLVFPGRGPRPEVPNIYPVPRPDRPE----IYGPPPIPERERIPDYIPEQTPIQPPPHGIPLPTTS----VCNPCQFYRNLCLNGRCVPLPGGTYRCECNMGFKLDRRGE-CIDDDECERNP---------------------CAHGECVNTPGSYICQCPAGFQSTATRTECRDLDECVANGRICNNGRCVNTEGSFHCVCNAGFEI--TADGKNCQDQDECL-IRNMCLNGLCINEDGSFKCICKSGFLLDTSGRMCVDID-------ECETPGMCM--NGHCVNTEGSFRCECMAGMAVGLDGRVCVDT 664          

HSP 3 Score: 165.236 bits (417), Expect = 3.830e-41
Identity = 173/642 (26.95%), Postives = 255/642 (39.72%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVA--WGDPCQRC-----------------ELGR------------------------------CEKGF-IEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSA--NKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC-------------TSICDLYP--RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQF 2207
            CQC  GF    +G+ C +I    CF     G C+  P    +SKE CC        WGDPC+ C                 E G+                              C  G+ ++  G+ C DINEC     C +G C N  G F C C   ++  P+ +   +   +C Q P LC     CV++ + ++ CKC  GYV   D + C  Q+   +  D C   G        C      Y C C+ GY     G  C    +  T+    +C NG+C +    Y C+CD G+ ++  + +C             T++C +    R+L    +C      G+   C     P+    Q +++      +GP  + +       DID C      + CK G C+N K  Y+C C+PG+  D             + Q  D+         C+    F+C N     +  SY C C  GY    DGK C D+DECS     C Q  CIN+ G + C C  GFT H+      C D NEC+   +LC  NG+C+NT GSF C+C  G+   +  Q C  + +               +C H C+   G + CSCP G     +   C   ++ ++ Q 
Sbjct: 2048 CQCPEGFQLSASGRRCLDIRVNYCFTKFENGRCLV-PKPQNISKEACCCTRMPGQGWGDPCELCPAKDQEAYRVLCPNEGYERGKDDNPTDINECLNNPCVNGQCINTDGSFRCECPIGYNLDTSGVTCIDINECDIGNPCGNGTCTNAIGGFECTCDEGFEPGPMMS--CEDINECSQNPLLCA--FRCVNV-VGSYECKCPTGYVLREDRRMCKDQNECEDGIDDCASRGM------TCKNLIGTYMCICSPGYTRHPSGDGCIDLNECATKPG--ICRNGRCENTVGSYRCKCDQGFVANPTQTECIDNREDFCYTEVLTTLCQMSSSNRNLVTKSECCCDGGRGWGINCE--LCPLPGTSQYKKMCP----LGPGYTTDGR-----DIDEC--RVMGNLCKNGQCVNTKGSYKCICIPGYTTD-----------ITSTQCVDIDECIQAPKPCN----FICKN-----TEGSYLCSCPRGYILQEDGKSCRDLDECSTKQHNC-QFLCINTIGGFTCKCPPGFTQHHS----ACIDNNECSSDPNLCGSNGVCQNTPGSFNCECQRGFSLDSNGQTCEDMDECDGNH----------RCQHGCQNLVGGYRCSCPQGYLQHYQWNQCVDENECLNTQI 2627          

HSP 4 Score: 164.851 bits (416), Expect = 5.337e-41
Identity = 165/580 (28.45%), Postives = 245/580 (42.24%), Query Frame = 3
Query:  501 CQCKPGFT----GKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC------ELGR-CEKG--------FIEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKT--VDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTS----------------------SNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMN--------DVASSFSLKTQCDKFGSFL---------------CNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQD 2039
            CQC PG T    G++C ++    C+L+     C   P   +   + CC +  VAWG  C  C      E  + C +G        FI      +DINEC+  + +C +G+C N  GSFRC C + +  D  + +C     +C   P+LCG G  CV+ +  +  C C  G+           ++    D C    P +C  G+C+    +++C C  G+  + DG +C+     D   R    +C NG+CV++   Y C C++GY S+ D   C  I +    +   +  C       YEC C  G+A M   + C  I  D+ E  P++                      S+ED KS   D+D C      + C  G C N K  + C C  G+ + K    C +  E +    N        + A SF         G+ L                NN  C  +  SY+C C  GY    DG  CSD DEC+ N  +C+ G C+N PG ++C C  GF       G  C D +EC     +C NG C+N  G F+C+CN GY       +C  + +
Sbjct:  945 CQCPPGMTVDVSGRTCIDLRTEHCYLTHDDERC-GTPIPGRHRVDACCCSVGVAWGPECDECPENGTPEFAQLCPRGPGFSHRGDFINGRPFLKDINECRMINTLCSNGRCRNTIGSFRCRCDNGFALDADERNCTD-IDECRISPDLCGQGT-CVN-TPGDFECNCFEGFESGFM----MMKNCMDIDECE-RNPQLCRGGECVNTEGSFQCICPPGHEITPDGSACQDINECDLSDR----LCRNGQCVNMVGSYYCNCNTGYKSTEDLVNCVDIDECTIENGGCETFCT-NSEGSYECSCHNGYALMPDQRSCIDI--DECEENPSTCDGGQCTNIPGTYQCLCFDGFMSSEDMKSCL-DVDEC--ELNSNICLSGNCENTKGSFICHCDLGYSVRKGTTGCTDINECEIGAHNCDRQATCTNTAGSFKCNCAPGWIGNGLKCTDLDECSNGTHSCNNNAECQNTMGSYRCVCKEGYFG--DGFFCSDSDECAENSDLCENGHCLNLPGGFRCECDMGFIT--TADGKACEDIDECI-FADICVNGRCQNLPGLFRCECNIGYERDTSGGNCTDINE 1500          

HSP 5 Score: 155.992 bits (393), Expect = 3.846e-38
Identity = 171/608 (28.12%), Postives = 246/608 (40.46%), Query Frame = 3
Query:  501 CQCKPGF----TGKSCSEIVNGECFLS-LSRG------VCMKHPYGLQLSKELCCGAFQVAWGDPCQR----------------------------------------CELGRC-----------EKGF-IEIDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCV-QRKKKC-------------EQIPNLCGPGMDCVSLSI---YNHLCKCLPGYVKSLDGKSCSKQSANKY-----------DMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCP-NGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQ-GDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN 2042
            C C P F    TG  C +I +G C+L+ L+RG      VC +   G+ +SK  CC +    WG PC+                                         C+ G+C            +GF + +D  +C+DINEC+   IC  G+C N  G++ C+C + Y       +C+  RK  C             E   N+    M C S +I   +N  C+  P          C  +    Y           D CR   P VC  G CI    +++CEC  G+I +     C+  +D C   NG VC  N  C+++   + C+C+ G+  +                  P GQC+ +     EC   PG    G   QC  I+     + P         S   D+D C     R  C  G C N    Y C C PGF     G  C +  E  T +                    LC NG C     S+ C CN GY+ +LDG++C+DI+EC++NP  C  GTC+N  GSY+C C  G+ +H       C D +EC+++  +C  G C NT GSF CQC  G+  S   + C+ ++ N
Sbjct: 1521 CNCPPDFELNPTGVGCVDIRSGSCYLNVLARGDASENYVCSQE-IGVGVSKASCCCSEGAGWGSPCEACPHVNSTGYKTLCPGGEGFRPNPITVILEDINECQELPGLCQGGQCINTFGSFQCECPRGFSLNLDTRVCEDINECEHPGICGPGQCYNTIGNYTCICPADYMPVNGGNNCMDMRKSYCYRNFYLDNGTCDGELTFNM-TKKMCCCSYNIGRAWNKPCEQCPVPSTDEFAILCGSERPGYYIDITTGRVIDIDECREI-PGVCENGVCINMIGSFRCECPIGFIYNDKLLICED-IDECQ--NGPVCQQNANCLNMPGSFRCECEHGFRFT------------------PTGQCLDR----NECNENPGICNPG---QCIDILGSYRCVCPNGYKTTRDQSMCVDVDEC----ERQPCGNGTCKNTLGSYNCLCYPGFQNSHNGD-CIDVDECSTQRG-------------------LCRNGNCRNIVGSFLCVCNDGYELTLDGRVCTDINECAVNPGTCGAGTCVNMDGSYRCICPPGYYLHEE----TCEDIDECSQSPEICTFGTCSNTEGSFTCQCPEGFQLSASGRRCLDIRVN 2069          

HSP 6 Score: 148.288 bits (373), Expect = 7.848e-36
Identity = 148/528 (28.03%), Postives = 225/528 (42.61%), Query Frame = 3
Query:  669 RCELGRCEKGF-IEIDGICQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPN--------------LCGPGM------DCVSLS-----------------IYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQC-IPQPNN-GYECRCLPGFAPMGKGKQCRRIMS-DQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSF--LCNNG------------------------RCIESGSSYQCQCNTGYQASLDGKLCSDIDECS--INPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN 2042
            RCE   CE GF     G C D NEC  +  IC  G+CI+  GS+RC+C + Y+    Q+ CV    +CE+ P               LC PG       DC+ +                  + + LC C  GY  +LDG+ C+  +    +      P  C  G C+    +Y+C C  GY    +  +C+  +D C++ +  +C  G C +    + CQC  G+  S   ++C  I   Y  +   +G+C +P+P N   E  C       G G  C    + DQ        NE  +  + D          + C  G CIN    +RCEC  G+ LD  G  C +  E       D+ +     T  +  G F   C+ G                        RC+    SY+C+C TGY    D ++C D +EC   I+       TC N  G+Y C C  G+T H  P G  C D NEC     +C+NG C+NT GS++C+C+ G++++  + +C+  +++
Sbjct: 1843 RCE---CEHGFRFTPTGQCLDRNECNENPGICNPGQCIDILGSYRCVCPNGYKTTRDQSMCVD-VDECERQPCGNGTCKNTLGSYNCLCYPGFQNSHNGDCIDVDECSTQRGLCRNGNCRNIVGSFLCVCNDGYELTLDGRVCTDINECAVN------PGTCGAGTCVNMDGSYRCICPPGYYLHEE--TCED-IDECSQ-SPEICTFGTCSNTEGSFTCQCPEGFQLSASGRRCLDIRVNYCFTKFENGRCLVPKPQNISKEACCCTRMPGQGWGDPCELCPAKDQEAYRVLCPNEGYERGKDDNPTDINECLNNPCVNGQCINTDGSFRCECPIGYNLDTSGVTCIDINEC------DIGNPCGNGTCTNAIGGFECTCDEGFEPGPMMSCEDINECSQNPLLCAFRCVNVVGSYECKCPTGYVLREDRRMCKDQNECEDGIDDCASRGMTCKNLIGTYMCICSPGYTRH--PSGDGCIDLNECATKPGICRNGRCENTVGSYRCKCDQGFVANPTQTECIDNRED 2348          

HSP 7 Score: 145.976 bits (367), Expect = 5.071e-35
Identity = 154/656 (23.48%), Postives = 260/656 (39.63%), Query Frame = 3
Query:  498 RCQCKPGFT----GKSCSEI-VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCE----------LGRCEKGFIEIDGICQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFC-----------TRYNGVVCPNGKCVSLSNDY-----ICQCDSGYTSSYDRKK---CTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY-RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLK-------------TQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM-----------------------------------------PGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RC+C  G      G+ C +  +   C+   +RG C++  +G+    E CC + + A+G+PCQ C           L  C     ++     DINEC     IC++G C N + +++C C++ ++ D    +CV    +C     LC  G+     +  +  C+C  G+    +   C   +  + +         C  G C+    ++ C C+      S G  C +TV                 NG    +  C +L   +      C+ D      + R K   C  +  C ++P  +C +G+C+      + C+C PG      G+ C  + ++                      C+ ++  ++C  G  I  ++    C C  G     +   C E    +  Q+      FS +              +C    + LC+NGRC  +  S++C+C+ G+    D + C+DIDEC I+P +C QGTC+N+PG ++C+CF+GF    M                                         P G  C D NEC  +  LC+NG C N  GS+ C CN+GY S+    +CV + + + +            C  +C  S G + CSC NG   + +   C  + +
Sbjct:  645 RCECMAGMAVGLDGRVCVDTHMRSTCYGGYNRGQCVRPLFGVVTKSECCCASTEYAYGEPCQPCPRESSGTDPCCLSSCAH---KVPSAFSDINECALDPDICQNGVCENMQRTYKCTCNTGFEVDLSGRNCVD-INECMMNSLLCDNGL--CRNTPGSFTCQCFKGFRFDPETDVCEDINECESN--------PCINGDCVNSQGSFVCTCSAASSLDSTGLECIETVKSTCWLKMVNNRCEVNINGATLKSHCCATLGEAWNSPCAKCEKDPICGKGFARVKGNVCEDVDECQVFP-GVCINGKCV-NTQGSFFCQCPPGMTVDVSGRTCIDLRTEH---------------------CYLTHDDERC--GTPIPGRHRVDACCCSVGVAWGPECDECPENGTPEFAQLCPRGPGFSHRGDFINGRPFLKDINECRMINT-LCSNGRCRNTIGSFRCRCDNGFALDADERNCTDIDECRISPDLCGQGTCVNTPGDFECNCFEGFESGFMMMKNCMDIDECERNPQLCRGGECVNTEGSFQCICPPGHEITPDGSACQDINECDLSDRLCRNGQCVNMVGSYYCNCNTGYKSTEDLVNCVDIDECTIEN---------GGCETFCTNSEGSYECSCHNGYALMPDQRSCIDIDE 1251          

HSP 8 Score: 135.191 bits (339), Expect = 1.146e-31
Identity = 149/586 (25.43%), Postives = 238/586 (40.61%), Query Frame = 3
Query:  690 EKGFIEIDGICQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC------------------------------------SKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQ--------------GDIDFCFYS----YYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQ----------CQCNSGYISSNKKQDCVSVQDNS-------NQKYDTEPSKICKKCSHYCKYSNGL------------FVCSCPNGLDAVLETGLCAKVSQ 2189
            E GF+ +   C DI+EC+ + Q+C+ G+C+N  GSF+C+C   ++  P  + C Q   +C+    LC  G  CV++ + ++ C C  GY  + D  +C                                     ++S    D C    P  C  G+C      Y+C C  G+++S D KSC   VD C   N  +C +G C +    +IC CD GY+       CT I  C++   +      C       ++C C PG+  +G G +C  +  D+   G  S N +++                 GD  FC  S       D C+ G C+N+   +RCEC  GF+    G+AC++  E                       + +C NGRC      ++C+CN GY+    G  C+DI+EC+ +P+ C  G C+N PG+Y C+C   F ++  P G  C D    +   ++   G     Y   Q          C C+ G    +  + C  V            + +   P  +  +  + C+   GL            F C CP G    L+T +C  +++
Sbjct: 1112 ESGFMMMKN-CMDIDECERNPQLCRGGECVNTEGSFQCICPPGHEITPDGSAC-QDINECDLSDRLCRNGQ-CVNM-VGSYYCNCNTGYKSTEDLVNCVDIDECTIENGGCETFCTNSEGSYECSCHNGYALMPDQRSCIDIDECE-ENPSTCDGGQCTNIPGTYQCLCFDGFMSSEDMKSCLD-VDEC-ELNSNICLSGNCENTKGSFICHCDLGYSVRKGTTGCTDINECEIGAHNCDRQATCT-NTAGSFKCNCAPGW--IGNGLKCTDL--DECSNGTHSCNNNAECQNTMGSYRCVCKEGYFGDGFFCSDSDECAENSDLCENGHCLNLPGGFRCECDMGFITTADGKACEDIDEC--------------------IFADICVNGRCQNLPGLFRCECNIGYERDTSGGNCTDINECA-DPTTCINGICVNIPGTYLCNCPPDFELN--PTGVGCVDIRSGSCYLNVLARGDASENYVCSQEIGVGVSKASCCCSEGAGWGSPCEACPHVNSTGYKTLCPGGEGFRPNPITVILEDINECQELPGLCQGGQCINTFGSFQCECPRGFSLNLDTRVCEDINE 1662          

HSP 9 Score: 118.242 bits (295), Expect = 1.648e-26
Identity = 129/463 (27.86%), Postives = 181/463 (39.09%), Query Frame = 3
Query:  720 CQDINECQWSQ-ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKK---CEQIPNLC---------------------GPGMDC-----VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQ 2018
            C D+NEC     IC++G+C N  GS+RC C   +  +P Q +C+  ++     E +  LC                     G G++C        S Y  +C   PGY  + DG+          D CR  G  +C  G+C+    +YKC C  GY        C   +D C +       N  C +    Y+C C  GY    D K C  + +   +       CI     G+ C+C PGF                      S+  D+     D + C  +        G C N    + CEC  GF LD  GQ C++  E                  CD  G+  C +G C      Y+C C  GY        C D +EC +N  IC   +C N+ GS++C C  GF      GG  C D NEC+ T + CK G C NT G + C C  GY+ + +  
Sbjct: 2300 CIDLNECATKPGICRNGRCENTVGSYRCKCDQGFVANPTQTECIDNREDFCYTEVLTTLCQMSSSNRNLVTKSECCCDGGRGWGINCELCPLPGTSQYKKMCPLGPGY--TTDGRD--------IDECRVMG-NLCKNGQCVNTKGSYKCICIPGYTTDITSTQCVD-IDECIQAPKPC--NFICKNTEGSYLCSCPRGYILQEDGKSCRDLDECSTKQHNCQFLCI-NTIGGFTCKCPPGFTQH------------------HSACIDNNECSSDPNLCGSN--------GVCQNTPGSFNCECQRGFSLDSNGQTCEDMDE------------------CD--GNHRCQHG-CQNLVGGYRCSCPQGYLQHYQWNQCVDENEC-LNTQICGGASCHNTLGSFRCLCPSGFDYEQTSGG--CADINECSTTQNPCKFG-CSNTDGGYLCGCPPGYLRAGQGH 2696          

HSP 10 Score: 113.62 bits (283), Expect = 5.222e-25
Identity = 119/452 (26.33%), Postives = 182/452 (40.27%), Query Frame = 3
Query:  687 CEKGFIEIDGI--CQDINECQW-SQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKK---------------------KCEQIPNLCGPGMDCVSL------------------SIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHY--RCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYD 1904
            C  GF+  + +  C D++EC+  S IC SG C N +GSF C C   Y        C    +                     KC   P   G G+ C  L                  ++ ++ C C  GY    DG  CS   + A   D+C          G C+     ++CEC+ G+I ++DGK+C+  +D C   +  +C NG+C +L   + C+C+ GY        CT I +    + C +G C+  P   Y C C P F     G  C  I S    +   +  + S++       C         K   C +    +   CE  P          C     ++ N +  +    +   +C +    LC  G+CI +  S+QC+C  G+  +LD ++C DI+EC  +P IC  G C N+ G+Y C C   +   N  GG  C D
Sbjct: 1275 CFDGFMSSEDMKSCLDVDECELNSNICLSGNCENTKGSFICHCDLGYSVRKGTTGCTDINECEIGAHNCDRQATCTNTAGSFKCNCAPGWIGNGLKCTDLDECSNGTHSCNNNAECQNTMGSYRCVCKEGYFG--DGFFCSDSDECAENSDLC--------ENGHCLNLPGGFRCECDMGFITTADGKACED-IDECIFAD--ICVNGRCQNLPGLFRCECNIGYERDTSGGNCTDINECADPTTCINGICVNIPGT-YLCNCPPDFELNPTGVGCVDIRSGSCYLNVLARGDASENY-----VCSQEIGVGVSKASCCCSEGAGWGSPCEACPHVNSTGYKTLCPGGEGFRPNPITVILEDIN---ECQELPG-LCQGGQCINTFGSFQCECPRGFSLNLDTRVCEDINECE-HPGICGPGQCYNTIGNYTCICPADYMPVN--GGNNCMD 1700          

HSP 11 Score: 99.7525 bits (247), Expect = 9.666e-21
Identity = 103/380 (27.11%), Postives = 160/380 (42.11%), Query Frame = 3
Query:  720 CQDINECQWS-QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCT-SICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSC 1853
            C+D++EC  + +IC +G+C+N  GSF C+C++ ++      +C Q + +C  I N+C  G+ C++    +  C C  G++    G+ C        D+     P +C  G C+    +++CEC  G     DG+ C  T    T Y G                          Y+R +C   +  +  +S C    C       Y   C P          C R  S       +S      S+  DI+ C  +   D C+ G C NM+  Y+C C  GF +D  G+ C +  E   N                   S LC+NG C  +  S+ CQC  G++   +  +C DI+EC  NP I   G C+NS GS+ C+C
Sbjct:  537 CRDLDECVANGRICNNGRCVNTEGSFHCVCNAGFEITADGKNC-QDQDEC-LIRNMCLNGL-CINED-GSFKCICKSGFLLDTSGRMC-------VDIDECETPGMCMNGHCVNTEGSFRCECMAGMAVGLDGRVCVDTHMRSTCYGG--------------------------YNRGQCVRPLFGVVTKSEC----CCASTEYAYGEPCQP----------CPRESSGTDPCCLSSCAHKVPSAFSDINEC--ALDPDICQNGVCENMQRTYKCTCNTGFEVDLSGRNCVDINECMMN-------------------SLLCDNGLCRNTPGSFTCQCFKGFRFDPETDVCEDINECESNPCI--NGDCVNSQGSFVCTC 842          

HSP 12 Score: 94.7449 bits (234), Expect = 3.021e-19
Identity = 130/541 (24.03%), Postives = 204/541 (37.71%), Query Frame = 3
Query:  669 RCELGRCEKGFIEI-DG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--------------QSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDG----------------KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQ--CKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQ 2189
            RCE   C+ GFI   DG  C+DI+EC ++ IC +G+C N  G FRC C+  Y+ D    +C    +  +  P  C  G+ CV++    +LC C P +  +  G  C                 ++  Y   +  G  V     C ++G  +   C      +S G                    + ++ C    G+ C  G+C++    + C+C  G++ + D + C  I +     +C  GQC     N Y C C   + P+  G  C                 D + S     +C+ ++Y D   C G    NM     C              C   +    N+  +     S     D+F + LC + R              GY   +      DIDEC   P +C+ G CIN  GS++C C  GF  ++      C D +EC       +N  C N  GSF+C+C  G+  +   Q C+   + +       P +        C    G + C CPNG     +  +C  V +
Sbjct: 1438 RCE---CDMGFITTADGKACEDIDECIFADICVNGRCQNLPGLFRCECNIGYERDTSGGNCTDINECAD--PTTCINGI-CVNIP-GTYLCNCPPDFELNPTGVGCVDIRSGSCYLNVLARGDASENYVCSQEIGVGVSKASCCCSEGAGWGSPCEACPHVNSTGYKTLCPGGEGFRPNPITVILEDINECQELPGL-CQGGQCINTFGSFQCECPRGFSLNLDTRVCEDINECEHPGICGPGQCYNTIGN-YTCICPADYMPVNGGNNCM----------------DMRKS-----YCYRNFYLDNGTCDGELTFNMTKKMCC--------------CSYNIGRAWNKPCEQCPVPST----DEF-AILCGSER-------------PGYYIDITTGRVIDIDECREIPGVCENGVCINMIGSFRCECPIGFIYNDKL--LICEDIDECQNGPVCQQNANCLNMPGSFRCECEHGFRFTPTGQ-CLDRNECNENPGICNPGQ--------CIDILGSYRCVCPNGYKTTRDQSMCVDVDE 1905          

HSP 13 Score: 73.1738 bits (178), Expect = 1.336e-12
Identity = 105/410 (25.61%), Postives = 156/410 (38.05%), Query Frame = 3
Query:  498 RCQCKPGF----TGKSCSEIVNGECFLSLSRGVCMKHPYGLQL-SKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGIC----------QDINECQ-WSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSK--QSANKYDMCRFY-----GPYVC--------HFGKCIAD----------GYN---------YKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQ 1577
            RC+C  GF    T   C +     C+  +   +C        L +K  CC      WG  C+ C L     G  +   +C          +DI+EC+    +CK+G+C+N +GS++C+C   Y  D     CV    +C Q P  C     C +    ++LC C  GY+   DGKSC    + + K   C+F      G + C        H   CI +          G N         + CEC +G+   S+G++C+  +D C   +   C +G C +L   Y C C  GY   Y   +C    +     +C    C       + C C  GF                         E +     DI+ C  S  ++ CK G C N    Y C C PG++   QG 
Sbjct: 2326 RCKCDQGFVANPTQTECIDNREDFCYTEVLTTLCQMSSSNRNLVTKSECCCDGGRGWGINCELCPL----PGTSQYKKMCPLGPGYTTDGRDIDECRVMGNLCKNGQCVNTKGSYKCICIPGYTTDITSTQCVD-IDECIQAPKPCN--FICKNTE-GSYLCSCPRGYILQEDGKSCRDLDECSTKQHNCQFLCINTIGGFTCKCPPGFTQHHSACIDNNECSSDPNLCGSNGVCQNTPGSFNCECQRGFSLDSNGQTCED-MDECDGNH--RCQHG-CQNLVGGYRCSCPQGYLQHYQWNQCVDENECLNTQICGGASCH-NTLGSFRCLCPSGF-----------------------DYEQTSGGCADINEC--STTQNPCKFG-CSNTDGGYLCGCPPGYLRAGQGH 2696          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Medaka
Match: ENSORLT00000027703.1 (latent transforming growth factor beta binding protein 2 [Source:NCBI gene;Acc:101168829])

HSP 1 Score: 159.073 bits (401), Expect = 3.023e-39
Identity = 165/538 (30.67%), Postives = 229/538 (42.57%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCE-CNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYIC-QCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYEC-RCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCE-CLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ-CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQC-SCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDN---------------------------SNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDV 2201
            C  G   I+  C D+NEC    +C  G+C+N +GS+RC C   Y+  P   +  Q  ++C  +P +C  G+ CV+L    H C C  GY  + D KSC        D+        C  G CI    +Y C+ C  G+  S+DG  C+  +D C R  G +C  G C +    +IC +C +GY  S D++ C  I +    S C +G C+      Y C  C  G+     G+ C+                       DID C        C  G C N +  Y C  C PGF + + GQ C           NDV        +C   GS +C    C+ +  SY C+ C TG+Q S DG  C DI+EC   P +C  G C N+ GS+ C +C  GFT+   P G  C D +EC    ++C  G C NTYGSF C C +G+  S    DC   QD                              + +D   S+I      +C+ +N  F C+C  G      T     V+Q VDV
Sbjct:  984 CSPGLRLINERCVDVNECLNQTVCGRGRCVNTQGSYRCNCFHGYKLSP--DNVCQDVEEC-VLPEVCNHGL-CVNLD-GTHECTCNHGYQVTPDRKSCE-------DVNECATGNACPVGICINTAGSYTCQNCRPGFGPSADGLRCED-IDECAR--GDMCLGGVCANTEGSFICTRCTAGYRVSLDQQSCEDIDECQSISTCANGICL-NSEGSYSCEHCPAGYRVSHDGEFCK-----------------------DIDECALP---TTCPKGTCTNTEGSYMCVVCQPGFRVSEDGQQC-----------NDV-------NEC--LGSSVCPGQMCLNTQGSYTCRSCQTGFQPSEDGHTCQDINECQT-PDVCPTGVCTNTEGSFSCMTCAPGFTV--APNGLSCEDVDECN-NDNVCVRGQCINTYGSFLCLCEAGFKFSVDTADCDD-QDECKEFGSSVCGAWRCQNTIGSYSCQSGILEEDWDKCDSEINCGEHGFCENTNSSFHCNCDKGY-----TNPAGDVTQCVDV 1449          

HSP 2 Score: 149.828 bits (377), Expect = 2.447e-36
Identity = 145/484 (29.96%), Postives = 210/484 (43.39%), Query Frame = 3
Query:  684 RCEKGFIEI----DGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSLSIYNHLCKCLPGY----VKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECR-CLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRC-ECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQ-CNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQC-SCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQ-CNSGYISSNKKQDCVSVQDNSNQKYDTEPSKIC 2081
            +C  G+ ++       CQDINEC     C++G C+N  GS+ C C+S +            + +CE +     P+ C  G+ C++         C PG      + +D   C  Q+             VC  G+C+    +Y+C C  GY  S D     + V+ C      VC +G CV+L   + C C+ GY  + DRK C  + +    + CP G CI      Y C+ C PGF P   G +C                        DID C      D C GG C N +  + C  C  G+ +    Q+C+           D+    S+ T         C NG C+ S  SY C+ C  GY+ S DG+ C DIDEC++ P+ C +GTC N+ GSY C  C  GF +     G +C D NEC   +S+C   +C NT GS+ C+ C +G+  S     C  +  N  Q  D  P+ +C
Sbjct:  899 QCHSGYSQVITQNRKFCQDINECSMPNKCQNGNCVNTEGSYTCECNSGFA--------KSWRDQCEDLDECKDPSSCPSGI-CINTLGSFQCQACSPGLRLINERCVDVNECLNQT-------------VCGRGRCVNTQGSYRCNCFHGYKLSPDNVC--QDVEECVLPE--VCNHGLCVNLDGTHECTCNHGYQVTPDRKSCEDVNECATGNACPVGICI-NTAGSYTCQNCRPGFGPSADGLRCE-----------------------DIDECARG---DMCLGGVCANTEGSFICTRCTAGYRVSLDQQSCE-----------DIDECQSIST---------CANGICLNSEGSYSCEHCPAGYRVSHDGEFCKDIDECAL-PTTCPKGTCTNTEGSYMCVVCQPGFRVSE--DGQQCNDVNECL-GSSVCPGQMCLNTQGSYTCRSCQTGFQPSEDGHTCQDI--NECQTPDVCPTGVC 1303          

HSP 3 Score: 126.716 bits (317), Expect = 3.527e-29
Identity = 152/533 (28.52%), Postives = 212/533 (39.77%), Query Frame = 3
Query:  537 SEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWG-DPCQRCELG-----------RCEKGFIEIDGI-CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPN-LCGPGMDCVSLSIYNHLCK--CLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP----RSLCPDGQCIPQPNNGYECRCLPGFA-----PMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASL--DGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQ-CNSGYISSNKKQDCVSVQDNSNQ 2051
            +EIV G CF     G C K   GL   ++ CCG+   +WG + CQ+C              +C KGF  ++   CQDINEC    ICK+  C+N +GS+RC C   Y  D  ++ CV  K   E+  +          SL + NHL K  C    V    G  C        D C   G          +D +   C    GY  S      +  V    R             L +D +          Y +   +    L+P        P    +PQ  + +    +P        P     +       +  + P++   DS      I+ C  S     C  G CI+++  Y C C PGF L      C +  E                  CD+        G CI S  SY CQC++GY   +  + K C DI+ECS+ P+ C  G C+N+ GSY C C  GF         +C D +EC + +S C +GIC NT GSFQCQ C+ G    N++  CV V +  NQ
Sbjct:  539 NEIV-GRCFQETVDGQCGKPLPGL-TKQDDCCGSIGASWGLNKCQKCPTKPAYAVIANGQVQCPKGFKRMNATHCQDINECLLPGICKNADCVNTKGSYRCTCKPGYMLDAARSHCVSDKAVSEERASCYRSVSSGFCSLPLANHLTKQICCCSRVGKAWGHGC--------DRCPLPG----------SDHFKEICPAGHGYTYS------RSDVQISVR------------QLEDDELQSTGVSLEEQYPQFPSSQPSLLFPSEPQHPSYPQTPQVPQYPDYHNMPQIPHHPLSPQHPSYSENEEAERTEGEEFLLPSAVVTDSPLKHPGINKC--SSIPSICGRGKCISVQTGYTCLCDPGFKLSALQTNCIDVNE------------------CDE--DPCEGKGHCINSYGSYTCQCHSGYSQVITQNRKFCQDINECSM-PNKCQNGNCVNTEGSYTCECNSGFA---KSWRDQCEDLDECKDPSS-CPSGICINTLGSFQCQACSPGLRLINER--CVDVNECLNQ 1004          

HSP 4 Score: 89.7373 bits (221), Expect = 1.073e-17
Identity = 118/425 (27.76%), Postives = 173/425 (40.71%), Query Frame = 3
Query:  687 CEKGF--IEIDGICQDINECQWSQICKSGKCINERGSFRCL-CSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS-------YDRKKCTSICDLYPRSLCP--DGQ--CIPQPNNGYECRCLPGFAPMGKGKQCRRI-MSDQSEIGPTSSNEDSKS----SQGDIDFCFYSYYRDQCKGGACINMKNHYRCEC------LPGFVLDKQGQACKE-----RVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTI 1871
            C+ GF   E    CQDINECQ   +C +G C N  GSF C+ C+  +   P    C +   +C    N+C  G  C++ +  + LC C  G+  S+D   C  Q     D C+ +G  VC   +C     +Y C   Q  I   D   C   ++ C  +       G C + ++ + C CD GYT+         D  +C +   L   +LC   DG   CI  PN+  E      F P+    +CR + M D   I P     D +     +  D ++C     R+  K   C      +   C      LPG   D   Q C        +     Q +     +    +C+ FGS +C NG+C    S+Y C C +GY        C D DEC    + C+ G C+N+ GS+ C C     +
Sbjct: 1273 CQTGFQPSEDGHTCQDINECQTPDVCPTGVCTNTEGSFSCMTCAPGFTVAPNGLSC-EDVDECNND-NVCVRGQ-CIN-TYGSFLCLCEAGFKFSVDTADCDDQ-----DECKEFGSSVCGAWRCQNTIGSYSC---QSGILEEDWDKCDSEIN-CGEH-------GFCENTNSSFHCNCDKGYTNPAGDVTQCVDVNECETSSALCGEALCENYDGSFLCI-CPNDNEE------FDPITN--RCRSMAMIDPEHIYPVIPFTDERKECYYNLNDANYCNNVLSRNTTKQECCCTAGAGWGDNCEIHTCPLPG--KDDYNQLCPHGSGILPLSDSLRQSHGDGLPYIDADECEMFGSEICKNGQCSNIFSTYTCFCRSGYYYDNIRFECVDFDECQFG-NTCENGACVNTAGSFNCFCSPPLVL 1665          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Medaka
Match: LTBP3 (latent transforming growth factor beta binding protein 3 [Source:NCBI gene;Acc:101156033])

HSP 1 Score: 154.836 bits (390), Expect = 5.598e-38
Identity = 159/564 (28.19%), Postives = 238/564 (42.20%), Query Frame = 3
Query:  498 RCQCKPGFTGKSC----SEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC---------ELGRCEKGFI----------------------EIDGICQDINECQWSQICKSGKCINE-RGSFRCLCSSSYQFDPVQADC-VQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCK-KTVDFCTRYN--GVVCPNGKCVSLSNDYICQCDSGYTSSYDRKK-CTSICDLYPRSLCPDGQCIPQPNNGYECR-CLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYD 2060
            +C C  GF  +      S     +CFL  S     +HP   Q+++E+CC     AWG  C+RC         ++    KG++                      E + +  +    Q      SG  +   + +   +   +   DP++ +  V +  +C    N+CG G +C + S   H+C C PGY  S     C  ++  + + C          G+C+     YKC C+ G+    +    + K +D C + +  GV    G CV+L   Y C+C SG+ S   R   C  I +      CP+ QC       YEC  C+PG+                         E       DI+ C        C  G C N+   YRC CL GF+    G++C           ND+     ++         LC NGRCI +  S+QCQC  GYQ + +G  C DIDEC  + S C +G CIN+ GSY C C  G+    + GG +C D +EC    +LC+ +G C+N  GS+ C CN GYI S  KQ C  V+  +++K +
Sbjct:  313 KCSCNSGFILERNRCVDSPAEQAQCFLLASESKGCEHPLSTQITQEMCCCTVGKAWGRNCERCPHVGTVAFSKICPAGKGYLLQSITETVALPPFFLPPKPPKEEQERVPANTTPVQQISTSTSGPRVPVVKPTPPTIIRLNPGNDPLETEIKVSQSDECRLSRNICGHG-ECEN-SPNGHICHCYPGYHLSPQRNICEDENECELEPCSQ------GRGRCVNTEGTYKCICSLGFKHKVEHGGLRCKDIDECLKPDICGV---GGLCVNLPGSYKCECHSGFRSKSPRYPFCEDINECLNPDTCPNEQC-ENTLGSYECTPCMPGY-------------------------EAHAGKCYDINEC---QNLGICPNGLCENLPGTYRCLCLDGFLHSADGKSC-----------NDIDECADVR---------LCANGRCINTDGSFQCQCYAGYQRTQEGSHCEDIDECKRS-SNCLRGRCINNMGSYHCECQRGYM---LVGGKECQDIDECASDRNLCQPHGYCENRLGSYVCICNHGYIPSEDKQSCEVVRVATDEKKE 812          

HSP 2 Score: 123.25 bits (308), Expect = 3.370e-28
Identity = 156/544 (28.68%), Postives = 219/544 (40.26%), Query Frame = 3
Query:  687 CEKGF---IEIDGI-CQDINECQWSQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN--GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCK-GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC------------------IESGSSYQCQCNTG----YQASLDGKLCS--DIDECSI-NPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV-SVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDV 2201
            C  GF   +E  G+ C+DI+EC    IC   G C+N  GS++C C S ++          R   CE I     P+ C P   C +         C+PGY            +   YD+       +C  G C      Y+C C  G++ S+DGKSC   +D C      +C NG+C++    + CQC +GY  + +   C  I +    S C  G+CI   NN   Y C C  G+  +G GK+C+                       DID C     R+ C+  G C N    Y C C  G++  +  Q+C E V   T++  +   +      CD   +       C                  +   + +   C  G    Y   L   L +  DIDECS+    IC +G C N+   Y+C C  GF   +      C D NEC +  SLC NG C NT GSF C CNS +I    K+ CV +     NQ  D E   ICK  +  C  +     CSC   L   ++   C    +  DV
Sbjct:  537 CSLGFKHKVEHGGLRCKDIDECLKPDICGVGGLCVNLPGSYKCECHSGFRSK------SPRYPFCEDINECLNPDTC-PNEQCENTLGSYECTPCMPGY---------EAHAGKCYDINECQNLGICPNGLCENLPGTYRCLCLDGFLHSADGKSCND-IDECADVR--LCANGRCINTDGSFQCQCYAGYQRTQEGSHCEDIDECKRSSNCLRGRCI---NNMGSYHCECQRGYMLVG-GKECQ-----------------------DIDECASD--RNLCQPHGYCENRLGSYVCICNHGYIPSEDKQSC-EVVRVATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAEFHMLCPNGQGLYYDEDLHYSLPAYLDIDECSLFAEEICKKGRCHNTQPGYECYCQQGFYYDS--NLLVCIDVNECHDE-SLCANGHCVNTEGSFYCDCNSPWIPDTNKKKCVMATVSGMNQCDDPE---ICK--NGLCVKTQSSHYCSCTLPLILAIDRNSCVTPEEQADV 1023          

HSP 3 Score: 97.4413 bits (241), Expect = 3.341e-20
Identity = 127/488 (26.02%), Postives = 192/488 (39.34%), Query Frame = 3
Query:  687 CEKGFIE-IDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHL----CKCLPGYVKSLDGKSCS--KQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--------TSICDLYP---------RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLC-----SDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECT-----------ETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            C  GF+   DG  C DI+EC   ++C +G+CIN  GSF+C C + YQ         Q    CE I + C    +C+     N++    C+C  GY+  + GK C    + A+  ++C+ +G      G       +Y C CN GYI S D +SC+           V     K   ++ +    CDS   ++  +++C           C++YP           LCP+GQ +    + +    LP +                                 DID C   +  + CK G C N +  Y C C  GF  D     C +      N+ +D +               LC NG C+ +  S+ C CN+ +    + K C     S +++C  +P IC  G C+ +  S+ CSC     +          DRN C            +  S CKNG C+NT GSF C C+     S   + CV
Sbjct:  663 CLDGFLHSADGKSCNDIDECADVRLCANGRCINTDGSFQCQCYAGYQR-------TQEGSHCEDI-DECKRSSNCLRGRCINNMGSYHCECQRGYML-VGGKECQDIDECASDRNLCQPHGYCENRLG-------SYVCICNHGYIPSEDKQSCEVVR--------VATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAEFHMLCPNGQGLYYDEDLH--YSLPAYL--------------------------------DIDECSL-FAEEICKKGRCHNTQPGYECYCQQGFYYDSNLLVCID-----VNECHDES---------------LCANGHCVNTEGSFYCDCNSPWIPDTNKKKCVMATVSGMNQCD-DPEICKNGLCVKTQSSHYCSCTLPLIL--------AIDRNSCVTPEEQADVDECQDPSYCKNGRCENTPGSFYCFCDPPLTFSALLKQCV 1062          

HSP 4 Score: 67.0106 bits (162), Expect = 8.734e-11
Identity = 129/552 (23.37%), Postives = 204/552 (36.96%), Query Frame = 3
Query:  684 RCEKGFIEIDGI-CQDINECQWSQ-ICKS-GKCINERGSFRCLCSSSYQFDPVQADC----VQRKKKCEQIPNL--------------------CGPGMDC----------VSLSIYNH-LCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI-------CDLYPRSLCPDGQCIPQPNNGYECRC-LPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQAC---KERVEYKT---NQMN-DVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAK 2180
             C++G++ + G  CQDI+EC   + +C+  G C N  GS+ C+C+  Y     +  C    V   +K E   NL                    C  GM            VS S   H LC    G     D    S  +    D C  +   +C  G+C      Y+C C QG+   S+   C   +D    ++  +C NG CV+    + C C+S +    ++KKC          CD     +C +G C+   ++ Y C C LP    + +           S + P          Q D+D C    Y   CK G C N    + C C P        + C        YK     Q++ D+  S  L++    +    C+ GR       +  +CNT          C   +    N  +C+      S G      F    ++  PG     D +EC+     C+NG C  +Y S  C+CN GY   + +  C+ + + + +     P K  +     C  ++G + C C +G        +C +
Sbjct:  744 ECQRGYMLVGGKECQDIDECASDRNLCQPHGYCENRLGSYVCICNHGYIPSEDKQSCEVVRVATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAEFHMLCPNGQGLYYDEDLHY-SLPAYLDIDECSLFAEEICKKGRCHNTQPGYECYCQQGFYYDSNLLVC---IDVNECHDESLCANGHCVNTEGSFYCDCNSPWIPDTNKKKCVMATVSGMNQCD--DPEICKNGLCVKTQSSHY-CSCTLPLILAIDR----------NSCVTP--------EEQADVDECQDPSY---CKNGRCENTPGSFYCFCDPPLTFSALLKQCVYDDRTAAYKDVCFEQVDEDLICSRPLQSLVVTYPECCCHFGR------GWGPECNT----------CPPRNSEMFN-RLCEIHLDTESDGEQD---FLAAFVNYKPGDSSEEDSDECS-----CENGHCVRSYLSTMCKCNPGYRLDHSRARCIDIDECAERAPRVSPCKNAR-----CVNTSGSYKCYCNHGFGPTRRPNICVR 1237          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Ensembl Medaka
Match: LTBP3 (latent transforming growth factor beta binding protein 3 [Source:NCBI gene;Acc:101156033])

HSP 1 Score: 154.451 bits (389), Expect = 6.396e-38
Identity = 157/562 (27.94%), Postives = 237/562 (42.17%), Query Frame = 3
Query:  498 RCQCKPGFTGKSC----SEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRC---------ELGRCEKGFI----------------------EIDGICQDINECQWSQICKSGKCINE-RGSFRCLCSSSYQFDPVQADC-VQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCK-KTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKK-CTSICDLYPRSLCPDGQCIPQPNNGYECR-CLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK-NGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYD 2060
            +C C  GF  +      S     +CFL  S     +HP   Q+++E+CC     AWG  C+RC         ++    KG++                      E + +  +    Q      SG  +   + +   +   +   DP++ +  V +  +C    N+CG G +C + S   H+C C PGY  S     C  ++  + + C          G+C+     YKC C+ G+    +    + K +D C + + +    G CV+L   Y C+C SG+ S   R   C  I +      CP+ QC       YEC  C+PG+                         E       DI+ C        C  G C N+   YRC CL GF+    G++C           ND+     ++         LC NGRCI +  S+QCQC  GYQ + +G  C DIDEC  + S C +G CIN+ GSY C C  G+    + GG +C D +EC    +LC+ +G C+N  GS+ C CN GYI S  KQ C  V+  +++K +
Sbjct:  313 KCSCNSGFILERNRCVDSPAEQAQCFLLASESKGCEHPLSTQITQEMCCCTVGKAWGRNCERCPHVGTVAFSKICPAGKGYLLQSITETVALPPFFLPPKPPKEEQERVPANTTPVQQISTSTSGPRVPVVKPTPPTIIRLNPGNDPLETEIKVSQSDECRLSRNICGHG-ECEN-SPNGHICHCYPGYHLSPQRNICEDENECELEPCSQ------GRGRCVNTEGTYKCICSLGFKHKVEHGGLRCKDIDECLKPD-ICGVGGLCVNLPGSYKCECHSGFRSKSPRYPFCEDINECLNPDTCPNEQC-ENTLGSYECTPCMPGY-------------------------EAHAGKCYDINEC---QNLGICPNGLCENLPGTYRCLCLDGFLHSADGKSC-----------NDIDECADVR---------LCANGRCINTDGSFQCQCYAGYQRTQEGSHCEDIDECKRS-SNCLRGRCINNMGSYHCECQRGYM---LVGGKECQDIDECASDRNLCQPHGYCENRLGSYVCICNHGYIPSEDKQSCEVVRVATDEKKE 812          

HSP 2 Score: 119.013 bits (297), Expect = 8.017e-27
Identity = 141/485 (29.07%), Postives = 198/485 (40.82%), Query Frame = 3
Query:  687 CEKGF---IEIDGI-CQDINECQWSQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQI-----PNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNN--GYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCK-GGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRC------------------IESGSSYQCQCNTG----YQASLDGKLCS--DIDECSI-NPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCV 2027
            C  GF   +E  G+ C+DI+EC    IC   G C+N  GS++C C S ++          R   CE I     P+ C P   C +         C+PGY            +   YD+       +C  G C      Y+C C  G++ S+DGKSC   +D C      +C NG+C++    + CQC +GY  + +   C  I +    S C  G+CI   NN   Y C C  G+  +G GK+C+                       DID C     R+ C+  G C N    Y C C  G++  +  Q+C E V   T++  +   +      CD   +       C                  +   + +   C  G    Y   L   L +  DIDECS+    IC +G C N+   Y+C C  GF   +      C D NEC +  SLC NG C NT GSF C CNS +I    K+ CV
Sbjct:  537 CSLGFKHKVEHGGLRCKDIDECLKPDICGVGGLCVNLPGSYKCECHSGFRSK------SPRYPFCEDINECLNPDTC-PNEQCENTLGSYECTPCMPGY---------EAHAGKCYDINECQNLGICPNGLCENLPGTYRCLCLDGFLHSADGKSCND-IDECADVR--LCANGRCINTDGSFQCQCYAGYQRTQEGSHCEDIDECKRSSNCLRGRCI---NNMGSYHCECQRGYMLVG-GKECQ-----------------------DIDECASD--RNLCQPHGYCENRLGSYVCICNHGYIPSEDKQSC-EVVRVATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAEFHMLCPNGQGLYYDEDLHYSLPAYLDIDECSLFAEEICKKGRCHNTQPGYECYCQQGFYYDS--NLLVCIDVNECHDE-SLCANGHCVNTEGSFYCDCNSPWIPDTNKKKCV 969          

HSP 3 Score: 90.5077 bits (223), Expect = 4.641e-18
Identity = 113/428 (26.40%), Postives = 171/428 (39.95%), Query Frame = 3
Query:  687 CEKGFIE-IDG-ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHL----CKCLPGYVKSLDGKSCS--KQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC--------TSICDLYP---------RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLC-----SDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNM 1880
            C  GF+   DG  C DI+EC   ++C +G+CIN  GSF+C C + YQ         Q    CE I + C    +C+     N++    C+C  GY+  + GK C    + A+  ++C+ +G      G       +Y C CN GYI S D +SC+           V     K   ++ +    CDS   ++  +++C           C++YP           LCP+GQ +    + +    LP +                                 DID C   +  + CK G C N +  Y C C  GF  D     C +      N+ +D +               LC NG C+ +  S+ C CN+ +    + K C     SD+DEC  +PS C  G C N+PGS+ C C    T   +
Sbjct:  663 CLDGFLHSADGKSCNDIDECADVRLCANGRCINTDGSFQCQCYAGYQR-------TQEGSHCEDI-DECKRSSNCLRGRCINNMGSYHCECQRGYML-VGGKECQDIDECASDRNLCQPHGYCENRLG-------SYVCICNHGYIPSEDKQSCEVVR--------VATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAEFHMLCPNGQGLYYDEDLH--YSLPAYL--------------------------------DIDECSL-FAEEICKKGRCHNTQPGYECYCQQGFYYDSNLLVCID-----VNECHDES---------------LCANGHCVNTEGSFYCDCNSPWIPDTNKKKCVMATVSDVDECQ-DPSYCKNGRCENTPGSFYCFCDPPLTFSAL 1010          

HSP 4 Score: 77.7962 bits (190), Expect = 3.870e-14
Identity = 122/534 (22.85%), Postives = 193/534 (36.14%), Query Frame = 3
Query:  720 CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSC-------------------------------SKQS------ANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSD---GKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQAC---KERVEYKT---NQMN-DVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAK 2180
            C+DI+EC+ S  C  G+CIN  GS+ C C   Y    V     Q   +C    NLC P   C +  + +++C C  GY+ S D +SC                               +KQ           D C  Y   V H  +     ++  C   QG     D          +D C+ +   +C  G+C +    Y C C  G+    +   C  + + +  SLC +G C+    + Y C C   + P    K+C  +M+  S                D+D C    Y   CK G C N    + C C P        + C        YK     Q++ D+  S  L++    +    C+ GR       +  +CNT          C   +    N  +C+      S G      F    ++  PG     D +EC+     C+NG C  +Y S  C+CN GY   + +  C+ + + + +     P K  +     C  ++G + C C +G        +C +
Sbjct:  717 CEDIDECKRSSNCLRGRCINNMGSYHCECQRGYML--VGGKECQDIDECASDRNLCQPHGYCEN-RLGSYVCICNHGYIPSEDKQSCEVVRVATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAE-----FHMLCPNGQGLYYDEDLHYSLPAYLDIDECSLFAEEICKKGRCHNTQPGYECYCQQGFYYDSNLLVCIDVNECHDESLCANGHCVNTEGSFY-CDCNSPWIPDTNKKKC--VMATVS----------------DVDECQDPSY---CKNGRCENTPGSFYCFCDPPLTFSALLKQCVYDDRTAAYKDVCFEQVDEDLICSRPLQSLVVTYPECCCHFGR------GWGPECNT----------CPPRNSEMFN-RLCEIHLDTESDGEQD---FLAAFVNYKPGDSSEEDSDECS-----CENGHCVRSYLSTMCKCNPGYRLDHSRARCIDIDECAERAPRVSPCKNAR-----CVNTSGSYKCYCNHGFGPTRRPNICVR 1190          

HSP 5 Score: 55.4546 bits (132), Expect = 2.590e-7
Identity = 71/289 (24.57%), Postives = 113/289 (39.10%), Query Frame = 3
Query:  687 CEKGFIEIDG--ICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ---------------RKKKCEQIPN----LCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQ-------SANKYDMCRFYGPYVCHFGKCI-----------ADGYNYKCECN--------QGYIAS----SDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI---CDLYPR-SLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRR 1388
            C++GF       +C D+NEC    +C +G C+N  GSF C C+S +  D  +  CV                +  +CE  P      C P +   +L     L +C+     +     C +Q       S     +   Y    CHFG+             ++ +N  CE +        Q ++A+      G S ++  D C+      C NG CV      +C+C+ GY   + R +C  I    +  PR S C + +C+   +  Y+C C  GF P  +   C R
Sbjct:  914 CQQGFYYDSNLLVCIDVNECHDESLCANGHCVNTEGSFYCDCNSPWIPDTNKKKCVMATVSDVDECQDPSYCKNGRCENTPGSFYCFCDPPLTFSAL-----LKQCVYDDRTAAYKDVCFEQVDEDLICSRPLQSLVVTYPECCCHFGRGWGPECNTCPPRNSEMFNRLCEIHLDTESDGEQDFLAAFVNYKPGDSSEEDSDECS------CENGHCVRSYLSTMCKCNPGYRLDHSRARCIDIDECAERAPRVSPCKNARCV-NTSGSYKCYCNHGFGPTRRPNICVR 1190          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Planmine SMEST
Match: SMESG000008188.1 (SMESG000008188.1)

HSP 1 Score: 1446.41 bits (3743), Expect = 0.000e+0
Identity = 747/750 (99.60%), Postives = 747/750 (99.60%), Query Frame = 3
Query:  162 MILSVGLLSIFGLFFAHLQTVHGESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSXXXXXXXXXXXXXXXXXXXXXXXXXRCQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYFELFSATDREDFRSKVTTQFNDTVLDKCESSTEDKIKPGVRCFYHKIS 2411
            MILSVGLLSIFGLFFAHLQTVHGESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSNNAPSNNNENECRNNCNNGGTCVNGRCQCKPGFTGK CSEIVNGECFLSLSRGVCMKHPYG QLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQW QICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYFELFSATDREDFRSKVTTQFNDTVLDKCESSTEDKIKPGVRCFYHKIS
Sbjct:    1 MILSVGLLSIFGLFFAHLQTVHGESHICGVNENSFVCCSGYRLDSEGDCTIPICVNRCGRNGACVRPNTCQCSNGMIASSCDEEDQSNNAPSNNNENECRNNCNNGGTCVNGRCQCKPGFTGKLCSEIVNGECFLSLSRGVCMKHPYGFQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWPQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDNVRVRRDINSGLNNVYFELFSATDREDFRSKVTTQFNDTVLDKCESSTEDKIKPGVRCFYHKIS 750          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Planmine SMEST
Match: SMESG000081561.1 (SMESG000081561.1)

HSP 1 Score: 154.451 bits (389), Expect = 4.496e-41
Identity = 81/209 (38.76%), Postives = 118/209 (56.46%), Query Frame = 3
Query:  498 RCQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSC 1124
            +C C+ G+ G+ C+  +   C++ + RG+C   P  LQLSKE CC  FQVAWG+PC  C+   C KGF + +  C DI+ECQ+  IC +G+CINE+GSFRC C   +  D     C  R+ +C+   + CG    CV  S   + C C+  Y  S +GKSC K++   Y++C ++      +G+C   G +Y C C   +  S D KSC
Sbjct:   29 KCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKT--NYNVCNYFKKLCLPYGECQPHGLSYYCSCPSEFHQSEDKKSC 235          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Planmine SMEST
Match: SMESG000081557.1 (SMESG000081557.1)

HSP 1 Score: 107.071 bits (266), Expect = 4.379e-24
Identity = 121/433 (27.94%), Postives = 182/433 (42.03%), Query Frame = 3
Query:  699 FIEIDGICQDINECQWSQI---CKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCG--------PGMDCVSLSIYNHLCKCLPGYVKSLDGKSC----SKQSANKYDMCRF-YGPYVCHFGKCIADG-YNYKCECNQGYIASSDGKSCKKTVDFCTR--YNGVVCPNGKCVSL-SNDYICQCDSGYTSSYDRKKC---------TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSF-LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDID-ECSINP-----------SICDQGTCI-NSPGSYQCSCFDGFT 1868
             + I  I  + + CQ  +I   C+ G C++E   +RCLC+  YQ      +CV+       +   C          G  CV L+  ++ C+C  G+  + + + C    ++ S  +   C        C  G CI D  Y +KC C  GY  + DG++C K     ++   N   C  G C  L +N+Y CQC  G+  S + + C         TSIC+LY    C  G C P   N Y C CL G++     K C +             NE  K      D+C       +C+GG C++  N YRC C   ++    GQ C   V YK  +   V         C K+  + LC  G C+++ ++Y C+C  GY     G+ CS I+ + +  P           S C  G CI +    ++C C  GFT
Sbjct:    1 MVRIFKINSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNN-DYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKMAEDGRACYKIETITSQCALNQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHR-CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-------------NEQYK------DYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC---VRYKQTEPPAV-------RLCSKWEYYSLCQGGECVDTNNNYYCKCGNGYY----GRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFT 398          

HSP 2 Score: 97.0561 bits (240), Expect = 7.443e-21
Identity = 100/361 (27.70%), Postives = 156/361 (43.21%), Query Frame = 3
Query: 1035 CHFGKCIADGYNYKCECNQGYIASSDGKSCKK---TVDFCTRY-----NGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI-----------CDLYP-RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINM-KNHYRCECLPGFVLDKQGQAC--KERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE-SGSSYQCQCNTGYQASLDGKLCSDIDECS---INPSI---CDQGTCINSPGSYQCSCFDGFTIHNMPGGPKC--YDRNE------CT--ETTSLCKNGICKNTYGSFQCQCNSGY 1997
            C  G C+++G  Y+C CN  Y   ++ + C +   +    +RY        +C  G CV L+NDY CQC  G+ ++ +R++C  I           CD+   R  C +G CI  P  G++C C  G+     G+ C +I +  S+                         + QC+GG C  +  N+Y C+CL GF+  + G++C   ER    T             + C+ +G   C  G C     + Y C C  GY  S D K C   ++      N  I   C  G C+++  SY+C C   +   N   G +C  Y + E      C+  E  SLC+ G C +T  ++ C+C +GY
Sbjct:   23 CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKMAEDGRACYKIETITSQCALN---------------------QFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNST-------------SICELYG-HRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSN--NGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTNNNYYCKCGNGY 346          

HSP 3 Score: 86.6557 bits (213), Expect = 1.789e-17
Identity = 100/370 (27.03%), Postives = 153/370 (41.35%), Query Frame = 3
Query:  741 QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ--------RKKKCEQIPN--LCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIA-DGYNYKCECNQGYIASSDGKSCKK------TVDFCTRYNGVVCPNGKCVSL-SNDYICQCDSGYTSSYDRKKCTS------ICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFL--CNNGRCI-ESGSSYQCQCNTGYQASLDGKLC 1766
            ++  +C+ G C++    + C CS  +     +  C++        R   C+   N   C  G DC+    Y   C C  GY  + DG++C K        C     + C  G C   D  NY+C+C +G+I S +G+SC K      +   C  Y G  C  G C  +  N+YIC C  GY+ S DRK C         C     S  C  GQC+    N Y C C   +     G++C R    +                  +  C    Y   C+GG C++  N+Y C+C  G+     G+ C  R+E +  +  D  +S+ L         +L  C  GRCI +    ++C C  G+ ++ DG+ C
Sbjct:   70 EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANG-DCIDDPYYGFKCLCRSGYKMAEDGRACYKIETIT-SQCAL-NQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELY-GHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSN-GNSYRCVCHGKYISSNNGQECVRYKQTEPPA---------------VRLCSKWEYYSLCQGGECVDTNNNYYCKCGNGYY----GRKCS-RIEKQVTEEPD--NSYCL------LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC 406          

HSP 4 Score: 82.4185 bits (202), Expect = 4.336e-16
Identity = 101/390 (25.90%), Postives = 157/390 (40.26%), Query Frame = 3
Query: 1167 CPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP-----------RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNH-YRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE-SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-------QGTCIN-SPGSYQCSCFDGFT--------IHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPS--KICKKCSHY-------CKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDN 2222
            C  G CVS    Y C C+  Y    + ++C       P            SLC  G C+   NN Y C+C  GF      ++C +I              ++++S     +C     R +C  G CI+   + ++C C  G+ + + G+AC     YK           ++ +QC     F C  G C E   ++Y+CQC  G+  S +G+ C   +    + SIC+        G C    P  Y C+C +G++        I N      C ++    E +  C+ G C +   S++C C+  YISSN  Q+CV  +        TEP   ++C K  +Y       C  +N  + C C NG           K S+I     + PDN
Sbjct:   23 CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCV-DLNNDYYCQCSEGFYATENRRRCIKI--------------ETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKMAEDGRAC-----YKIE---------TITSQC-ALNQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQ----EISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK-------QTEPPAVRLCSKWEYYSLCQGGECVDTNNNYYCKCGNGYYG-------RKCSRIEKQVTEEPDN 364          

HSP 5 Score: 61.6178 bits (148), Expect = 1.502e-9
Identity = 69/270 (25.56%), Postives = 113/270 (41.85%), Query Frame = 3
Query: 1461 DFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDE---------CSI--NPSICDQGTCINSP-GSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSL----CKNGICKNT-YGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCK-------YSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            D C      ++C+GG+C++    YRC C   +      Q C   V Y T++   + S +  K++       LC  G C++  + Y CQC+ G+ A+ + + C  I+          C I  N   C  G CI+ P   ++C C  G+ +     G  CY     T   +L    C+ G C+     +++CQC  G+I S   + C+  +   N       + IC+   H C+       Y N  ++C+C  G     +   C K  Q  D
Sbjct:   12 DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQEC---VRYGTSE--PLVSRYCSKSEYYS----LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKM--AEDGRACYKIETITSQCALNQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNS------TSICELYGHRCQTGVCYPIYPN-EYICACLEGYSQSEDRKYCIKNEQYKD 263          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Planmine SMEST
Match: SMESG000081557.1 (SMESG000081557.1)

HSP 1 Score: 106.686 bits (265), Expect = 6.569e-24
Identity = 116/416 (27.88%), Postives = 176/416 (42.31%), Query Frame = 3
Query:  741 QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCG--------PGMDCVSLSIYNHLCKCLPGYVKSLDGKSC----SKQSANKYDMCRF-YGPYVCHFGKCIADG-YNYKCECNQGYIASSDGKSCKKTVDFCTR--YNGVVCPNGKCVSL-SNDYICQCDSGYTSSYDRKKC---------TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSF-LCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDID-ECSINP-----------SICDQGTCI-NSPGSYQCSCFDGFT 1868
            + ++ C+ G C++E   +RCLC+  YQ      +CV+       +   C          G  CV L+  ++ C+C  G+  + + + C    ++ S  +   C        C  G CI D  Y +KC C  GY  + DG++C K     ++   N   C  G C  L +N+Y CQC  G+  S + + C         TSIC+LY    C  G C P   N Y C CL G++     K C +             NE  K      D+C       +C+GG C++  N YRC C   ++    GQ C   V YK  +   V         C K+  + LC  G C+++ ++Y C+C  GY     G+ CS I+ + +  P           S C  G CI +    ++C C  GFT
Sbjct:   31 EIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNN-DYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKMAEDGRACYKIETITSQCALNQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHR-CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-------------NEQYK------DYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC---VRYKQTEPPAVR-------LCSKWEYYSLCQGGECVDTNNNYYCKCGNGYY----GRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFT 411          

HSP 2 Score: 97.4413 bits (241), Expect = 6.817e-21
Identity = 100/361 (27.70%), Postives = 156/361 (43.21%), Query Frame = 3
Query: 1035 CHFGKCIADGYNYKCECNQGYIASSDGKSCKK---TVDFCTRY-----NGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI-----------CDLYP-RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINM-KNHYRCECLPGFVLDKQGQAC--KERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE-SGSSYQCQCNTGYQASLDGKLCSDIDECS---INPSI---CDQGTCINSPGSYQCSCFDGFTIHNMPGGPKC--YDRNE------CT--ETTSLCKNGICKNTYGSFQCQCNSGY 1997
            C  G C+++G  Y+C CN  Y   ++ + C +   +    +RY        +C  G CV L+NDY CQC  G+ ++ +R++C  I           CD+   R  C +G CI  P  G++C C  G+     G+ C +I +  S+                         + QC+GG C  +  N+Y C+CL GF+  + G++C   ER    T             + C+ +G   C  G C     + Y C C  GY  S D K C   ++      N  I   C  G C+++  SY+C C   +   N   G +C  Y + E      C+  E  SLC+ G C +T  ++ C+C +GY
Sbjct:   36 CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKMAEDGRACYKIETITSQCALN---------------------QFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNST-------------SICELYG-HRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSN--NGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTNNNYYCKCGNGY 359          

HSP 3 Score: 86.6557 bits (213), Expect = 1.813e-17
Identity = 100/370 (27.03%), Postives = 153/370 (41.35%), Query Frame = 3
Query:  741 QWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQ--------RKKKCEQIPN--LCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIA-DGYNYKCECNQGYIASSDGKSCKK------TVDFCTRYNGVVCPNGKCVSL-SNDYICQCDSGYTSSYDRKKCTS------ICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFL--CNNGRCI-ESGSSYQCQCNTGYQASLDGKLC 1766
            ++  +C+ G C++    + C CS  +     +  C++        R   C+   N   C  G DC+    Y   C C  GY  + DG++C K        C     + C  G C   D  NY+C+C +G+I S +G+SC K      +   C  Y G  C  G C  +  N+YIC C  GY+ S DRK C         C     S  C  GQC+    N Y C C   +     G++C R    +                  +  C    Y   C+GG C++  N+Y C+C  G+     G+ C  R+E +  +  D  +S+ L         +L  C  GRCI +    ++C C  G+ ++ DG+ C
Sbjct:   83 EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANG-DCIDDPYYGFKCLCRSGYKMAEDGRACYKIETIT-SQCAL-NQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELY-GHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSN-GNSYRCVCHGKYISSNNGQECVRYKQTEPPA---------------VRLCSKWEYYSLCQGGECVDTNNNYYCKCGNGYY----GRKC-SRIEKQVTEEPD--NSYCL------LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC 419          

HSP 4 Score: 82.4185 bits (202), Expect = 4.165e-16
Identity = 101/390 (25.90%), Postives = 157/390 (40.26%), Query Frame = 3
Query: 1167 CPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYP-----------RSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNH-YRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIE-SGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-------QGTCIN-SPGSYQCSCFDGFT--------IHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPS--KICKKCSHY-------CKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDVQFDIPDN 2222
            C  G CVS    Y C C+  Y    + ++C       P            SLC  G C+   NN Y C+C  GF      ++C +I              ++++S     +C     R +C  G CI+   + ++C C  G+ + + G+AC     YK           ++ +QC     F C  G C E   ++Y+CQC  G+  S +G+ C   +    + SIC+        G C    P  Y C+C +G++        I N      C ++    E +  C+ G C +   S++C C+  YISSN  Q+CV  +        TEP   ++C K  +Y       C  +N  + C C NG           K S+I     + PDN
Sbjct:   36 CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCV-DLNNDYYCQCSEGFYATENRRRCIKI--------------ETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKMAEDGRAC-----YKIE---------TITSQC-ALNQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQ----EISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK-------QTEPPAVRLCSKWEYYSLCQGGECVDTNNNYYCKCGNGYYG-------RKCSRIEKQVTEEPDN 377          

HSP 5 Score: 61.6178 bits (148), Expect = 1.420e-9
Identity = 69/270 (25.56%), Postives = 113/270 (41.85%), Query Frame = 3
Query: 1461 DFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDE---------CSI--NPSICDQGTCINSP-GSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSL----CKNGICKNT-YGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKCSHYCK-------YSNGLFVCSCPNGLDAVLETGLCAKVSQIVD 2198
            D C      ++C+GG+C++    YRC C   +      Q C   V Y T++   + S +  K++       LC  G C++  + Y CQC+ G+ A+ + + C  I+          C I  N   C  G CI+ P   ++C C  G+ +     G  CY     T   +L    C+ G C+     +++CQC  G+I S   + C+  +   N       + IC+   H C+       Y N  ++C+C  G     +   C K  Q  D
Sbjct:   25 DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQEC---VRYGTSE--PLVSRYCSKSEYYS----LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETRTSLPRNSYCDIPSNRQRCANGDCIDDPYYGFKCLCRSGYKM--AEDGRACYKIETITSQCALNQFQCQGGGCQELDNNNYECQCLRGFIRSENGRSCIKAERTRN------STSICELYGHRCQTGVCYPIYPNE-YICACLEGYSQSEDRKYCIKNEQYKD 276          
BLAST of Latent transforming growth factor beta binding protein 3 vs. Planmine SMEST
Match: SMESG000076582.1 (SMESG000076582.1)

HSP 1 Score: 103.605 bits (257), Expect = 5.251e-22
Identity = 127/465 (27.31%), Postives = 191/465 (41.08%), Query Frame = 3
Query:  684 RCEKGFIEIDGICQDINEC-QWSQICKSGK-CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLS------IYNHLCKCLPGYVKSLDGKSCSKQS--ANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLC--PDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIM-SDQSEI--------GPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSIC--DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNG--ICKNTYGSFQCQCNSGYIS 2003
             C+ GF+    +C+DI+EC   + +C S   C N  GSF C C   ++ + V          C  I N C P   C + +      +  + C+C  G++K+    +C  ++  A+  ++C            C     +Y+C+C  G+  S         V+ C   +       KC +    Y C CDSGY    D + CT I +     +C  PD  C+  P + YECRCL G         C  +  +  +EI             N  + +   DID C  +      +   C N+   Y CECL G+ +    + C+   E   N             QC +       N  CI++   Y CQC TG+    D   C DIDEC+ + + C  D+ TC NS GS+ C C +G++      G  C + +EC      C      C N  G F+C+C SGY S
Sbjct: 3193 HCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGV---------TCTNI-NECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVST------NCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQG--DGRNCTDIDECSSNKVCQRPDATCVNLPGS-YECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSINKICENINECIDNLH-----------QCGE-------NAECIDTDGGYYCQCKTGFTGHCDE--CRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYS----GDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKS 3614          

HSP 2 Score: 102.064 bits (253), Expect = 1.493e-21
Identity = 126/460 (27.39%), Postives = 191/460 (41.52%), Query Frame = 3
Query:  684 RCEKGFIEI-DGICQDINECQW-SQICK-SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYN-YKCECNQGYIASSDG-----KSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKC---TSICDLYPRS-LCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLC---KNGICKNTYGSFQCQCNSGYISSNKK 2015
            RC+ GF ++  G C++INEC+  S  C  +  C ++   F C C   +++        +    CE I     P   C S+   + +C   PG  + +     S Q     D+     P  C      A+  + + C C  G     +G       C + +D C   NG    +  C  L   Y C C  G+ +     +     + C++   S    + +C+      ++C C PGF+    G     +  D+ EI          S Q ++ FC           G CIN    + C+C  GF+ +     C +  E   +Q++      SL   CD+       NG CI +   +QC CN G+    +   C DIDEC   P+ C  G C N PGS++C C  G+ + N     KC D NEC+  + +C     GIC N  GSFQC+CN GY +S  K
Sbjct: 4963 RCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSD------ETNLNCEDIDECTNP-TSCSSMP--HSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGA---DSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECV-DTYGSFKCVCKPGFSKNSDGD---CVDYDECEI----------SEQSNMKFC---------NNGKCINTAGGFTCDCPEGFIYNNYD--CIDVDECSLDQVS------SLADNCDQV------NGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF-PNSCLDGLCNNLPGSFECLCNIGYDLVNG----KCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGK 5368          

HSP 3 Score: 85.8853 bits (211), Expect = 1.324e-16
Identity = 127/538 (23.61%), Postives = 198/538 (36.80%), Query Frame = 3
Query:  687 CEKGFIEIDGICQDINECQWSQICK---SGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIP-------------------QPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLD-----KQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGS-------------------SYQCQCNTGYQASLDGKLCSDIDECSINPSIC-DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKN-GICKNTYGSFQCQCNSGYISSNKKQDCVSVQDNSNQKYDTEPSKICKKC--SHYCKYSNGLFVCSCPNGLD 2150
            C  G + +D IC DI+EC  +Q  K   +  C N+ G++ C C+  +  D +    +    +C+     C     C++       C+C  G +   +G +C  +   K        P       C      Y CEC  GY         K T  FC +      PN             C +  T +   +   +IC+  P     +  CIP                   Q + G++C C PGF  +G   Q      D++E  PTS +              ++  +    GG C+N K  + C C    + +     K   +C   ++    ++ D  SS      C     F   NG C++                      SY C+C    +  L  K C+D +EC  NP IC D   C+N+ GSY+C C  G+  +    G  C D +EC   T  C +   C N  GS +C+C  G+ + +    C+          D+ P++   KC    YC        C+C NG +
Sbjct: 4348 CGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGFYGDGLLCHDID---ECKFGVANCSENALCIN-KPGTFACECQAGTLG--NGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGY---------KGTGWFCIKQTPCDVPNA------------CKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNTCQ------DKNECDPTSPD--------------FAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWN----GTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGF-TGDGIYSCIET--------DSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYE 4825          

HSP 4 Score: 85.5001 bits (210), Expect = 1.503e-16
Identity = 132/529 (24.95%), Postives = 207/529 (39.13%), Query Frame = 3
Query:  501 CQCKPGF-----TGKSCSEI---VNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWSQIC-KSGKCINERGSFRCLCSSSYQFDP-----VQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVK-SLDGKSCSKQSANKYDMCRFYGPYVCHFG--KCIADGYNYKCECNQGYIASSDGKSCK-KTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPD------GQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGK---LCSDIDEC-SINPSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGY 1997
            CQCKPGF     T  +C +I    N     S+   +CM +P           G+F+              C  GF    G C DINEC     C ++  C N    F C C++  +  P     +  +C++   +C+    L G    C  L I  + C C  G+V   +  + C  Q+  + ++      + C     +C+    ++KC C  G+  +SDG        +   + N   C NGKC++ +  + C C  G+   Y+   C  +  C L   S   D      G CI     G++C C  GF  +    +C                        DID C    + + C  G C N+   + C C  G+ L          V  K   +N+ +++  +   C    +     G CI +  S+QC+CN GY+ S  GK    C  ++EC  +N +      C++    Y+C C DG+    +     C + NEC    S      C +T GS++C C  GY
Sbjct: 5004 CQCKPGFKWSDETNLNCEDIDECTNPTSCSSMPHSICMNNP-----------GSFECV------------CPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQV---LNGADSVCYDLPI-GYACVCPDGFVNDEVFPQVCENQNECEINI------HSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFI--YNNYDCIDVDECSLDQVSSLADNCDQVNGHCI-NTVGGFQCYCNRGFVMIENSTKCV-----------------------DIDEC---QFPNSCLDGLCNNLPGSFECLCNIGYDL----------VNGKCTDINECSNNSQI---CGPQAA-----GICINAAGSFQCKCNVGYENS-GGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIG---ICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGY 5448          

HSP 5 Score: 84.7297 bits (208), Expect = 2.697e-16
Identity = 143/546 (26.19%), Postives = 208/546 (38.10%), Query Frame = 3
Query:  501 CQCKPGFTGKSCSEIVNGECFLSLSRGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGF----IEIDGICQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIP-----NLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGK---SCSKQSANKYDMCRFYGPYVCHF-GKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTS--ICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQ--MNDVASSFSLKTQCDKFG---------------SFLCNNGRC-------IESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGT-CINSPGSYQCSCFDGFT-IHNMPGGPKCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYISSNK 2012
            C C  GF  KS       +CF      VC K+         +C     ++ G P   C +G          I+ID   +++++CQ + IC      N  GS+ C C  +Y       D  +  K C  +P       C  G  C      N  C CL G     D     +CSK SA+         P +C     C    + Y C+C  GY      KSC+  +D C         N  C +    + C C  GY+ +     C +  +C+     +C        PN  Y C+C  G+                 EI P+   +D    Q           +  C   A CIN    Y+C+C   F  D Q +  +++ + K  Q    +V       + C+K                 + +C N  C       IE+G +  C C++GY    DG+LC D+DECS     C   + C N  GS+ C+C  GF  + N      C D +EC  + S   NG C+NT GSF+C+C  G+I   K
Sbjct: 3765 CHCPSGFVFKS------NKCFDERCENVCPKN--------AIC----SISSGSPVCSCSVGTSLSSDSSQCIDIDECNENVDDCQENSIC-----FNRFGSYDCKCPPNY------LDVFKDGKVCMAVPLSQCNQSCPTGQYC-----NNGSCSCLMGLNSQTDDDGNLNCSKNSASCL-------PGICPLNANCEERLFGYICKCKPGYEGVGI-KSCRD-IDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSGLCETNNVCNCGSHGIC-------GPN--YICQCKSGY-----------------EINPSGMCQDVNECQ----------TQSPCHILAQCINTPGSYKCQCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRA-DCFCDSGYYG--DGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGK 4228          

HSP 6 Score: 81.2629 bits (199), Expect = 2.865e-15
Identity = 122/475 (25.68%), Postives = 190/475 (40.00%), Query Frame = 3
Query:  657 DPCQRCELGRCEKGFIEIDGICQDINECQWSQ--------ICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPN-GKCVSLSNDYICQCDSGY----TSSYDRKKC---TSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINM-KNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKL-CSDIDECSINPSICDQGT--------CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTS--LCKNGICKNTYGSFQCQCNSGY 1997
            DP  +CE   C+ GF  +   CQD NEC  +         +   G C+N +GSF C C+   Q +   + C         + N      DC+S    ++ C+C+ G+ +         + A+K D C+       +   C     +Y C+C          K+C    +   + N ++C +  KC++    Y CQC +GY    T+  D  +C   T  C    R     G C        +C+C PGF   G       I S            DS  ++ D+          +C  G+  NM  N   C C  G+  D     C   V YK  + +D+    + K+ C KF         C  +  +Y C C +      DGK  C D +EC++    C+  T         +N    +QC CF+G+    +PG   C ++NEC         +N IC +T GS++C+C SG+
Sbjct: 4554 DPGFKCE---CKPGFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-QMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCK-------NNATCNNMIGSYVCKCPDNLKLDLSKKACTDRNE--CQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSC--------KCKCQPGFTGDG-------IYS--------CIETDSCPARDDV----------KCPTGSYCNMIGNFIYCNCTNGYE-DSNQMECIGDVCYK--KCSDIDECVTRKSACHKFA-------ECTNNDGAYVCTCPSYLTG--DGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYV--KIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGF 4968          

HSP 7 Score: 78.9518 bits (193), Expect = 1.625e-14
Identity = 137/564 (24.29%), Postives = 196/564 (34.75%), Query Frame = 3
Query:  717 ICQDINECQWSQICKS--GKCINERGSFRCLCSSSYQFDP---VQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICDQGT-CINSPGSYQCSCFDGFTIHNMPGGP----------------------------------KCYDRNECTETTSLCKNGICKNTYGSFQCQCNSGYI-------SSNKKQDCVSVQD--------------------NSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCAKVSQIVDV 2201
            +C D+NEC     C     KC N  GS+ C C S YQ D       D     K C++      P   CV+L   ++ C+CL G         C+     K +        +C+ G+C          C  G+  +     C+   +  T  N       KC +L   Y C+C  GY  S   K C +I  C         + +CI   + GY C+C  GF   G   +CR                       DID C +S          C N    + C C  G+  D  G  C E  E      N           C +   F      C      ++C+C +GY++  +G  C D +EC    + CD    CIN+ GS+ C C  G+        P                                  +C + +EC   TS   N  C +T+GSF C CN GYI         +   D   +++                     SN+ +D     +C K +  C  S+G  VCSC  G      T L +  SQ +D+
Sbjct: 3333 VCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSNKVCQR------PDATCVNLP-GSYECRCLDGTPGCDGDNPCNTVQCTKPNE-------ICYLGQCF---------CKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSINKICENINECIDNLHQCGENAECI-DTDGGYYCQCKTGFT--GHCDECR-----------------------DIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGD--GSVCSEIDECLLGLHN-----------CSRSHQF------CFNVNGGFECRCLSGYKSDTNGS-CVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNALCVNSTCLCKSGYENSTNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPK-NAICSISSGSPVCSCSVG------TSLSSDSSQCIDI 3820          

HSP 8 Score: 70.8626 bits (172), Expect = 5.211e-12
Identity = 153/555 (27.57%), Postives = 220/555 (39.64%), Query Frame = 3
Query:  501 CQCKPGFTGK--SCSEIVNGECFLSLS-----RGVCMKHPYGLQLSKELCCGAFQVAWGDPCQRCELGRCEKGFIEIDGICQDINECQWS-QICKSGK--CINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPNGKCVSLSNDYICQCDSGYTSS----YDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGK---GKQCRRI--------MSDQSEIGPTS--SNEDSKSSQ-GDIDFCFYSYYRDQCKGGA-CINMKNHYRCECLPGFV-LDKQGQACKERVEYKTNQM-------NDVASS--FSLKTQCDKFGSFLCN-------------NGRCIESGSSYQCQCNTGYQASLDGKLCSDIDECSINPSICD-QGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCK---NGICKNTYGSFQCQCNSGY 1997
            CQCK GFTG    C +I   EC  SL+     R  C           E   G+F              RC +G+     +C +I+EC      C      C N  G F C C S Y+ D     CV  + +C    N C    DC++    + LC C  GY+ S  G++C  Q     + C   G  +C      A   N  C C  GY  S++   C  T +  ++ +  V  N  C+     +IC C+ GY       + +   T  C +   + C DG C     +G  C C  GF         ++C  +        +S  S +   S  ++  S SSQ  DID C  +   D C+  + C N    Y C+C P ++ + K G+ C      + NQ        N+ + S    L +Q D  G+  C+             N  C E    Y C+C  GY+  +  K C DIDEC    + C     C N+ GS+ CSC  G++ ++  G           ET ++C    +GIC   Y    CQC SGY
Sbjct: 3522 CQCKTGFTGHCDECRDI--DECAFSLNNCDSDRATC-----------ENSIGSFTC------------RCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFECRCLSGYKSD-TNGSCVD-ENECRFFDNGCDDNADCINTD-GSFLCICRAGYIGS--GRNCDPQEG--LEEC---GKLLCPLN---ALCVNSTCLCKSGYENSTN--QCINTDECESQTSCDV--NANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQI--ENYCTDGDCY----DGI-CHCPSGFVFKSNKCFDERCENVCPKNAICSISSGSPVCSCSVGTSLSSDSSQCIDIDECNENV--DDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEG-VGIKSCRDIDECGGKINNCTINEDCSNTEGSFTCSCKRGYSRNSSSG---------LCETNNVCNCGSHGICGPNY---ICQCKSGY 4012          

HSP 9 Score: 66.2402 bits (160), Expect = 1.263e-10
Identity = 53/161 (32.92%), Postives = 78/161 (48.45%), Query Frame = 3
Query: 1686 GRCIESGSS--YQCQCNTGYQASLDGKLCSDIDECSINPSIC-DQGTCINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTSLCKN-GICKNTYGSFQCQCNSGYISSNKKQDCVSV----QDNSNQKYDTEPSKICKKCSHYCKYSNGLFVCSCPNG 2144
            G C  S +S   +C+C  GY+   D   C+DIDECS    +C D G C+N  G+Y C C  GF    +  G  C D NEC   T+ C     C NT+GS++C C +GY  +      + +     D +N  +  + S  C + +    +++G F C C  G
Sbjct:  503 GECFNSTASGESECRCKKGYEGRADN--CTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGF----VGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQIPIIAVNPDQTNCSFHQDAS--CDQLATCVDHADGSFTCDCTEG 655          

HSP 10 Score: 60.8474 bits (146), Expect = 4.904e-9
Identity = 150/595 (25.21%), Postives = 209/595 (35.13%), Query Frame = 3
Query:  687 CEKGFIEIDGI-----CQDINECQWSQICKS-GKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDC---VSLSIYNHLCKCLPGYVKSLDGKSCSKQSANKYDMCRFYGPYVCHFGK-CIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPN-GKCVSLSNDYICQCDSGYTSSYDRKKCTSI--CDLYPRSLCPDGQCIPQPNNGYECRCLPGFAPMGKGKQCRRIMSDQSEIGPTSSNEDSKSSQGDIDFCFYSYYRDQCKGGACINMKNHYRCECLPGFVLDKQGQACKERVEYKTNQMNDVASSFSLKTQCDKFGSFLCNNGRCIESGSSYQCQCNTGYQAS----------------------------------------LDGKLCSDIDECSINPSICDQGT--CINSPGSYQCSCFDGFTIHNMPGGPKCYDRNECTETTS-------LCKNGICKNTYGSFQCQCNSGYISSN-------------------KKQDCVSVQDNSNQ---------------KYDTEPSKI--CKKCSHYCKYSNGLFVCSCPNGLDAVLETGLCA 2177
            C  GF  ++       C DI+EC  S+ C + G+C N  GSF+C C   +  D  + DC +   KCE+    C     C   V  SIY   C+C   +  S DG +    S  K ++C   G   CH    C      Y+C C  G+    DG +    +D C   N   C +  KCV+ +  Y C C  G  + Y    C  I  C     + C            Y C+C  GF   G G  C  I  D+ + G  + +E++                       CIN    + CEC  G +    G  C +  E K  + +  A       +CD+       N  C      Y C+C +GY+ +                                        L+   C    EC      CD+ T  C+     ++C C  GF   NM G   C D+NEC  T+        L   G C NT GSF C CN   ++ N                   K +DC+S +D+S                   D    KI  CK  +  C    G +VC CP+ L   L    C 
Sbjct: 4174 CNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDG-KYDC-RIDSKCEKYGG-CHEDASCIVNVESSIYE--CQCHTEF--SGDGIT----SCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGF--QGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCVCGDG--AVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSCQCAEGF--YGDGLLCHDI--DECKFGVANCSENA----------------------LCINKPGTFACECQAGTL--GNGTTCGDEDECKKPKGSPGAP------ECDE-------NAVCKNKDPGYTCECQSGYKGTGWFCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGF---NMVGN-TCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQEQMNENNSSCKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKN-NATCNNMIGSYVCKCPDNLKLDLSKKACT 4707          

HSP 11 Score: 60.8474 bits (146), Expect = 5.473e-9
Identity = 46/127 (36.22%), Postives = 64/127 (50.39%), Query Frame = 3
Query: 1683 NGRCIESGSSYQCQCNTGYQA------SLDGKLCSDIDECSIN--PSICDQGTCINSPGSYQCSCFDGFTIHNMPGGPK-CYDRNECTETTSLC-KNGICKNTYGSFQCQCNSGYISSNKKQDCVSV 2033
            +  C    S ++C C  G+Q         +G+ C D DEC++   PS  D   C N+PGS+ C+C  GF    +   P  C D NEC+  +S+C  N  C NTYGS+ C C  G+  S    DC +V
Sbjct: 2665 HANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLKCPSTSD---CTNTPGSFICNCHVGF----VKAAPTVCNDINECSLNSSICDANADCINTYGSYICNCKPGFRGSGNPGDCEAV 2784          

HSP 12 Score: 51.6026 bits (122), Expect = 3.714e-6
Identity = 66/229 (28.82%), Postives = 89/229 (38.86%), Query Frame = 3
Query:  687 CEKGFIEIDGI--CQDINECQWSQICKSGKCINERGSFRCLCSSSYQFDPVQADCVQRKKKCEQIPNLCGPGMDCVSLSIYNHL-CKCLPGYVKSLDGKSCSK-QSANKYDMCRFYGPYVCHFGKCIADGYNYKCECNQGYIASSDGKSCKKTVDFCTRYNGVVCPN-----GKCVSLSNDYICQCDSGYTSSYDRKKCTSICDLYPRSLCPDGQCIPQPNNGYECRCL 1346
            C +GF+ I+    C DI+ECQ+   C  G C N  GSF CLC+  Y  D V   C     +C     +CGP    + ++      CKC  GY  S  GKS +  QS N+        P      +C+     Y+C C  GY         +  +  C   N     +       C+     Y C C  GY        C +IC   P S  P   C     N Y+C C+
Sbjct: 5274 CNRGFVMIENSTKCVDIDECQFPNSCLDGLCNNLPGSFECLCNIGY--DLVNGKCTDI-NECSNNSQICGPQAAGICINAAGSFQCKCNVGYENS-GGKSYNPCQSVNECVKLNITCP---SNAQCVDRSNGYECICKDGYQ--------EDQIGICRNINECQIEDSCHYLADCLDTDGSYKCTCKYGYKGD-GIVSCKAICG--PNSCLPGQLCQIVNGNQYDCGCV 5484