SMED30030167

Overview
NameSMED30030167
Smed IDSMED30030167
Length (bp)1095
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030167 (SMED30030167) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030167 (SMED30030167) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030167

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30030167SMESG000039913.1 dd_Smed_v4_21901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030167SMESG000039913.1 dd_Smed_v4_21901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030167SMESG000039913.1 dd_Smed_v4_21901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030167 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001210:2809..11200 +5385
Homology
BLAST of SMED30030167 vs. Ensembl Fly
Match: Tsp47F (gene:FBgn0033629 transcript:FBtr0088151)

HSP 1 Score: 48.9062 bits (115), Expect = 2.280e-6
Identity = 40/168 (23.81%), Postives = 75/168 (44.64%), Query Frame = 2
Query:  233 NQLVSVPLFTSILVVMCVGLVV--SGSYGFFHSVRENSYVINMQTILLSIFWIV-LLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVI 727
            N  V   +    +V++  GL++    S G F +++E+  ++    +LL++ +IV L + I  S++   +      +   ++    S  +   + I++ L CCG   P D+  R L  + T+P SCC   + + T    L          +  +  FQ GC+ K  D I
Sbjct:   42 NHFVEGRVLAPPIVLIVTGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSEDTMAWDNIQQKLMCCGVDSPADW--RTLSANKTLPGSCCQPQYIDSTVGHCL------ESPALGKDKYFQVGCVGKLKDRI 201          
BLAST of SMED30030167 vs. Ensembl Fly
Match: Tsp26A (gene:FBgn0031760 transcript:FBtr0332600)

HSP 1 Score: 48.9062 bits (115), Expect = 3.017e-6
Identity = 40/160 (25.00%), Postives = 70/160 (43.75%), Query Frame = 2
Query:  302 GSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHI--------YIDYGLTFAVNMYNPKSPSSQYMEVI-EKHLQCCGNLGPKDYNNRDLFDSNT----------VPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAF-QTGCLEKFHD 721
            G  G   ++REN+ ++    I LS+   +L+  IG     + +            GL   +  Y   +     ++ I E  LQCCG  GPKD+++ + F+ ++          VPFSCC    + +  +KN    ++V  +  P++    + GCL    D
Sbjct:   79 GFMGSVGALRENTCLLGAYAIFLSV---LLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCC--RRRPQEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGED 233          
BLAST of SMED30030167 vs. Ensembl Fly
Match: Tsp26A (gene:FBgn0031760 transcript:FBtr0113024)

HSP 1 Score: 48.521 bits (114), Expect = 4.032e-6
Identity = 40/160 (25.00%), Postives = 70/160 (43.75%), Query Frame = 2
Query:  302 GSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHI--------YIDYGLTFAVNMYNPKSPSSQYMEVI-EKHLQCCGNLGPKDYNNRDLFDSNT----------VPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAF-QTGCLEKFHD 721
            G  G   ++REN+ ++    I LS+   +L+  IG     + +            GL   +  Y   +     ++ I E  LQCCG  GPKD+++ + F+ ++          VPFSCC    + +  +KN    ++V  +  P++    + GCL    D
Sbjct:   79 GFMGSVGALRENTCLLGAYAIFLSV---LLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCC--RRRPQEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGED 233          
BLAST of SMED30030167 vs. Ensembl Fly
Match: Tsp26A (gene:FBgn0031760 transcript:FBtr0307300)

HSP 1 Score: 47.3654 bits (111), Expect = 8.418e-6
Identity = 39/158 (24.68%), Postives = 72/158 (45.57%), Query Frame = 2
Query:  302 GSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHI--------YIDYGLTFAVNMYNPKSPSSQYMEVI-EKHLQCCGNLGPKDYNNRDLFDSNT----------VPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELA---FQTGCLE 709
            G  G   ++REN+ ++    I LS+   +L+  IG     + +            GL   +  Y   +     ++ I E  LQCCG  GPKD+++ + F+ ++          VPFSCC    + +  +KN    ++V  +   +EL+   ++ GC++
Sbjct:   79 GFMGSVGALRENTCLLGAYAIFLSV---LLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCC--RRRPQEVIKNKQCGYDVRKEGYGMELSKIIYEKGCVQ 231          
BLAST of SMED30030167 vs. Ensembl Xenopus
Match: sertad4 (SERTA domain containing 4 [Source:Xenbase;Acc:XB-GENE-943347])

HSP 1 Score: 51.6026 bits (122), Expect = 6.908e-7
Identity = 29/109 (26.61%), Postives = 61/109 (55.96%), Query Frame = 2
Query:  290 LVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLI--LIGTSIYGYHI--YIDYGLTFAVNMYNPKS-PSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCC 601
            +++ G++G F + R +++++ +  + LSI ++V LI  ++G  ++ + I    + G   A+  YN    P SQ ++ I++ LQCCG     ++     + ++ +P SCC
Sbjct:   71 IILLGTFGCFATCRASTWMLKLYAMFLSIIFLVELIAAIVGL-VFRHEIKNSFEQGYLQALKQYNATGDPRSQAVDTIQRTLQCCGVNSYNEWGQTQYYKTHGIPQSCC 178          
BLAST of SMED30030167 vs. TrEMBL
Match: A0A5J4P1M0 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006680 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.551e-10
Identity = 47/195 (24.10%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  194 YFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDL-FDSNTVPFSCCDY--------------YHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFP 733
            Y +      + +++QL+S      +L+ + V L+  G+ G     R+N+ +I +Q I L    + ++ ++ T +  +   +  G+TF+V  +NP       M  I++ L+CCG    KDY   ++   +  VP+SCCD                H+ +   +       V+   IP E A+ +GC  +   V+ P
Sbjct:   49 YIHPTGLGLLHSVDQLISTHAKMGLLIAVNVLLIALGAIGIILLRRQNNLLIGLQIIALLFVTLFVVAVLYTYLMHWFTNVKVGVTFSVQQFNPGDHDRMTMAGIQRGLRCCGRESYKDYYIANMAVPAGYVPYSCCDLNQYDDEQCYNSSRSAHRGKLGNRPDSDNRAVDMLVIPKEFAYSSGCEVRIQYVLLP 243          
BLAST of SMED30030167 vs. TrEMBL
Match: A0A4E0S1Q5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_004329 PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.225e-8
Identity = 60/227 (26.43%), Postives = 104/227 (45.81%), Query Frame = 2
Query:  116 LKLLTSLVNXXXXXXXXXXXXXXXXXYFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSI-YGYHIY----IDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDY---NNRDLFDSNTVPFSCCDY--------YHKNRTTVKNLCKFFEVNYK-----RIPIELAFQTGCLEKFHDVIFP 733
            ++L +S+ N ++      +IL    VY +QP      A++ ++S  +   +L+V+    ++ GS G + ++R  S +I    + L IF ++LL ++   + YG+  +    +  G+T+AV  + P SP    +  I+  L CCG    KDY   N    F    VPFSCC+          + + TT+K        +Y       +P  +AF  GC     + I P
Sbjct:   41 IQLWSSITNGVLIASAITVILATSVVYIHQPWLKLTNAVHSIISANVTLGLLLVLSTISLLLGSVGLY-TIRNRSTLI----LGLQIFALILLAMLEVGVLYGFLSHWLTNLTVGVTYAVQTFRPGSPGQDDIAAIQTGLHCCGRESYKDYYIANEEIPF--GYVPFSCCNTQIHDTEACQNASLTTLKGRIGKAPNSYMVPDQLVVPKHMAFGGGCYSSLQEKILP 260          
BLAST of SMED30030167 vs. TrEMBL
Match: A0A183A674 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2459 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.091e-7
Identity = 51/199 (25.63%), Postives = 86/199 (43.22%), Query Frame = 2
Query:  194 YFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIY----IDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDY--NNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKF-------------FEVNYKRIPIELAFQTGCLEKFHDVIFP 733
            Y ++P    + A+++++S  +   +L+V+ V  V  G  G +   + +S ++ +Q   L    I L +L   ++YG+  +    +  G+T+AV  + P       +  I+  L CCG    +DY   N D+   N VPFSCCD Y     T  N                  + N   IP  +AF  GC    +  + P
Sbjct:   50 YIHRPWLGLMNALHEMISAHMTLGLLLVLGVISVALGGVGLYTIRKRSSLILGLQIFAL----IFLAVLEVGALYGFLTHWLTNLTLGVTYAVQSFRPGQMDPASIAAIQSILHCCGRSSYEDYFIANEDI-PMNYVPFSCCDIYKHGSETCHNASLTTMKGRVGKAPEYGVDTNQLIIPKHMAFDRGCQSSLYTTVLP 243          
BLAST of SMED30030167 vs. TrEMBL
Match: A0A504Z003 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_03544 PE=3 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 6.174e-7
Identity = 47/179 (26.26%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  116 LKLLTSLVNXXXXXXXXXXXXXXXXXYFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSI-YGYHIY----IDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDY---NNRDLFDSNTVPFSCCD---YYHKN 619
            ++L +S+ N ++      +IL    VY +QP      A++ ++S  +   +L+ +    V+ GS G +     ++ ++ +Q     IF ++LL ++   + YG+  +    +  G+T+AV  + P SP    +  I+  L CCG    KDY   N    F    VPFSCC+   ++H++
Sbjct:   24 MQLWSSITNGVLIASAITVILATSVVYIHQPWLKLTNAMHSIISANVTLGLLLALSTISVLLGSVGLYTICNRSTLILGLQ-----IFALILLAMLEVGVLYGFLSHWLANLTVGVTYAVQTFRPGSPGQVDIAAIQTGLHCCGRESYKDYYIANEEIPF--GYVPFSCCNTRLHWHRS 195          
BLAST of SMED30030167 vs. TrEMBL
Match: A0A4Z2D3Q2 (Tetraspanin family isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_004912 PE=3 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.567e-6
Identity = 39/169 (23.08%), Postives = 73/169 (43.20%), Query Frame = 2
Query:  269 LVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYN-NRDLFDSNTVPFSCCDYY-----HKNRTTVKNLCKFFEVNYKR--------IPIELAFQTGCLEKFHDVIFP 733
            +V+ C+  +  G  G F   R+ + ++ +Q   L    ++   ++ T +  +  +++ G+TFAV M+ P    +  M  I++ L CCG     DY    +    + VP+SCCD       H N  ++ +  K                IP  +A+  GC+ +   +  P
Sbjct:   76 IVLFCIASISLGIIGIFAIHRKATLILGIQIFALVFLAVLEGGILYTILVQWLRHLEVGVTFAVQMFQPGLEDNTVMANIQEALHCCGRGSYDDYGVANEAIPKHYVPYSCCDLQTYTIEHCNNASILSKSKLISTIQSTEENNLLYVIPYHMAYTVGCVNRLKHLFLP 244          
BLAST of SMED30030167 vs. Ensembl Cavefish
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:103032697])

HSP 1 Score: 49.2914 bits (116), Expect = 2.191e-6
Identity = 39/120 (32.50%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  269 LVVMCVGLVV--SGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGY------HIYIDYGLTFAVNMYNPKSPSSQY-MEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCC 601
            LV++ VG+V+     +G   + +EN  ++ M  ILLS   +++++ IGT+I  Y         +D GL   +  YN  S   Q  ++ I+K L+CCG     D+ N    D  +VP SCC
Sbjct:   55 LVLIIVGVVIFFIAFFGCCGAWKENYCMVTMFAILLS---LIIIVEIGTAIAAYVFRDKLTGLVDDGLRDMIKQYNNGSKEYQEGLDRIQKDLKCCGAANSSDWVNFKP-DHTSVPDSCC 170          
BLAST of SMED30030167 vs. Ensembl Cavefish
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:103032697])

HSP 1 Score: 48.9062 bits (115), Expect = 2.858e-6
Identity = 39/120 (32.50%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  269 LVVMCVGLVV--SGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHI------YIDYGLTFAVNMYNPKSPSSQY-MEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCC 601
            LV++ VG+V+     +G   + +EN  ++ M  ILLS   +++++ IGT+I  Y         +D GL   +  YN  S   Q  ++ I+K L+CCG     D+ N    D  +VP SCC
Sbjct:   76 LVLIIVGVVIFFIAFFGCCGAWKENYCMVTMFAILLS---LIIIVEIGTAIAAYVFRDKLTGLVDDGLRDMIKQYNNGSKEYQEGLDRIQKDLKCCGAANSSDWVNFKP-DHTSVPDSCC 191          
BLAST of SMED30030167 vs. Ensembl Cavefish
Match: tspan5b (tetraspanin 5b [Source:ZFIN;Acc:ZDB-GENE-041212-12])

HSP 1 Score: 48.1358 bits (113), Expect = 5.018e-6
Identity = 37/139 (26.62%), Postives = 64/139 (46.04%), Query Frame = 2
Query:  230 INQLVSVPLFTSILVVMCVGLV--VSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVN----MYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLF---DSN------TVPFSCC 601
            I+ +  +  F  + + + VG V  V G  G   ++RENS+++   ++ L I    L +  G   + +  +I   L F +N     Y         ++  +++ +CCG  GP+D+N    F   D+N       VPFSCC
Sbjct:   50 ISSITDLGGFDPVWLFLVVGGVMFVLGFAGCIGALRENSFLLKFFSVFLGII-FFLELTTGVLAFVFKDWIKDQLKFFINNNIRAYRDDIDLQNLIDFTQEYWECCGAFGPEDWNLNIYFNCTDTNLSREKCGVPFSCC 187          
BLAST of SMED30030167 vs. Ensembl Cavefish
Match: tspan5b (tetraspanin 5b [Source:ZFIN;Acc:ZDB-GENE-041212-12])

HSP 1 Score: 47.7506 bits (112), Expect = 5.904e-6
Identity = 37/139 (26.62%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  230 INQLVSVPLFTSILVVMCVGLV--VSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVN----MYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLF---DSN------TVPFSCC 601
            I+ +  +  F  + + + VG V  V G  G   ++RENS+++   ++ L I +  L +  G   + +  +I   L F +N     Y         ++  +++ +CCG  GP+D+N    F   D+N       VPFSCC
Sbjct:   32 ISSITDLGGFDPVWLFLVVGGVMFVLGFAGCIGALRENSFLLKFFSVFLGIIFF-LELTTGVLAFVFKDWIKDQLKFFINNNIRAYRDDIDLQNLIDFTQEYWECCGAFGPEDWNLNIYFNCTDTNLSREKCGVPFSCC 169          
BLAST of SMED30030167 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009492.1 (pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-1 gene:ENSPMAG00000008573.1 transcript:ENSPMAT00000009492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 1.350e-6
Identity = 31/90 (34.44%), Postives = 43/90 (47.78%), Query Frame = 2
Query:  467 YNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDS---NTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVI 727
            Y+P+S +  YM+   K LQCCG     D+N  +       N+VP SCC    KN T + +L           P +L +Q GCL K  D +
Sbjct:  131 YDPESRAVDYMQ---KELQCCGFANYSDWNTTEWARRHKYNSVPLSCCKRSAKNCTGLLSL-----------PAKL-YQQGCLLKLGDEV 205          
BLAST of SMED30030167 vs. Ensembl Medaka
Match: zgc:113223 (tetraspanin-33-like [Source:NCBI gene;Acc:101175144])

HSP 1 Score: 50.8322 bits (120), Expect = 7.225e-7
Identity = 40/151 (26.49%), Postives = 71/151 (47.02%), Query Frame = 2
Query:  311 GFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTF-------AVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNR---DLFDSN------TVPFSCCDYYHKNRTTVKNLCKF-FEVNYKRIPIELAFQTGCLEK 712
            G F ++R ++  + M  ++L++   V L+ I T + GY ++ D  +         A+  Y         ++ ++K  QCCG    KD++     D  D+N       VPFSCC  + KN+T    +C +  ++  + +  +  F  GCLEK
Sbjct:   66 GCFGALRNSTCPLKMFLVILAV---VFLLQIATGVVGY-LFTDKVMERTEKLMMKAIVRYREDRDLENAIDFVQKKFQCCGVENYKDWSQNPYFDCLDTNPSLEACGVPFSCC-IHLKNQTVHNTMCGYGMQMQKEDLASKNIFTVGCLEK 211          
BLAST of SMED30030167 vs. Ensembl Medaka
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:101163337])

HSP 1 Score: 47.7506 bits (112), Expect = 7.788e-6
Identity = 28/108 (25.93%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  290 LVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLIL-IGTSIYGYHIYIDYGLTF--AVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCD 604
            +V+ G +G F + R + +++ +  + L++ ++  L+  I   I+ + I    G  +  AV  YN  +  S  ++ I++ L+CCG     D+     F S  +P SCC 
Sbjct:   71 IVIFGLFGCFATCRGSPWMLKLYAMFLTLVFLSELVAGISGFIFRHEIKAVMGTAYENAVRSYNGTNSLSVALDTIQRTLRCCGVKNYTDWKEAPYFISKGIPLSCCK 178          
BLAST of SMED30030167 vs. Ensembl Medaka
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:101163337])

HSP 1 Score: 47.3654 bits (111), Expect = 9.230e-6
Identity = 28/108 (25.93%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  290 LVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLIL-IGTSIYGYHIYIDYGLTF--AVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCD 604
            +V+ G +G F + R + +++ +  + L++ ++  L+  I   I+ + I    G  +  AV  YN  +  S  ++ I++ L+CCG     D+     F S  +P SCC 
Sbjct:   71 IVIFGLFGCFATCRGSPWMLKLYAMFLTLVFLSELVAGISGFIFRHEIKAVMGTAYENAVRSYNGTNSLSVALDTIQRTLRCCGVKNYTDWKEAPYFISKGIPLSCCK 178          
BLAST of SMED30030167 vs. Planmine SMEST
Match: SMESG000039913.1 (SMESG000039913.1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 319/321 (99.38%), Postives = 320/321 (99.69%), Query Frame = 2
Query:   41 MKCRNYSLAKREICCTESLNRTILCLKLLTSLVNXXXXXXXXXXXXXXXXXYFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMXXXXXXXXXXXXXXXXXXXXFCAVLAYKNKKIIQIKKRLKPIFVGEISEDFLDASIELGLIEIPNEFEYTEQPEKPVNLIYQCSDYKS 1003
            MKCRNYSLAKREICCTESLNRTILCLKLLTSLVNILISLLGFGLILIVGFVYFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMIVISSSLLLSILTNIIINIV+CAVLAYKNKKIIQIKKRLKPIFVGEISEDFLDASIELGLIEIPNEFE TEQPEKPVNLIYQCSDYKS
Sbjct:    1 MKCRNYSLAKREICCTESLNRTILCLKLLTSLVNILISLLGFGLILIVGFVYFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMIVISSSLLLSILTNIIINIVYCAVLAYKNKKIIQIKKRLKPIFVGEISEDFLDASIELGLIEIPNEFESTEQPEKPVNLIYQCSDYKS 321          
BLAST of SMED30030167 vs. Planmine SMEST
Match: SMESG000039913.1 (SMESG000039913.1)

HSP 1 Score: 420.239 bits (1079), Expect = 7.897e-149
Identity = 240/242 (99.17%), Postives = 241/242 (99.59%), Query Frame = 2
Query:  278 MCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMXXXXXXXXXXXXXXXXXXXXFCAVLAYKNKKIIQIKKRLKPIFVGEISEDFLDASIELGLIEIPNEFEYTEQPEKPVNLIYQCSDYKS 1003
            MCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMIVISSSLLLSILTNIIINIV+CAVLAYKNKKIIQIKKRLKPIFVGEISEDFLDASIELGLIEIPNEFE TEQPEKPVNLIYQCSDYKS
Sbjct:    1 MCVGLVVSGSYGFFHSVRENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMIVISSSLLLSILTNIIINIVYCAVLAYKNKKIIQIKKRLKPIFVGEISEDFLDASIELGLIEIPNEFESTEQPEKPVNLIYQCSDYKS 242          
BLAST of SMED30030167 vs. Planmine SMEST
Match: SMESG000051756.1 (SMESG000051756.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.101e-15
Identity = 37/103 (35.92%), Postives = 61/103 (59.22%), Query Frame = 2
Query:  440 YGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYN-NRDLFDSNTVPFSCCDYYHKN--RTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAM 739
            +G+++A  +Y+P    S+Y E+I+K L+CCG   PKD++   + F   TVP SCC++       + +KNL K        I I+ AFQTGCL +   +++P++
Sbjct:   18 FGISYATQIYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNL-KNLGKGSLAINIKYAFQTGCLTRLEKIVWPSI 119          
BLAST of SMED30030167 vs. Planmine SMEST
Match: SMESG000043617.1 (SMESG000043617.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.359e-7
Identity = 34/130 (26.15%), Postives = 65/130 (50.00%), Query Frame = 2
Query:  356 QTILLSIFWIVLLILIGT----SIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYN-NRDLFDSNTVPFSCCDYYHKNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIF 730
            Q  +  IF+  + I +G     + Y   IY    +  A+  Y+ KS +S +++ ++  L CCG  G  DY+ + +LF  + VP SCC  +  +++ +K        N  +I I+ A+  GC ++   +++
Sbjct:   97 QLFISVIFYFFMAITLGAMLFHTWYDKQIYTKNRVVTAIRSYDWKSFNSHHLDRLQNTLSCCGYEGAADYHQSNNLFLKDNVPLSCC--FDNSKSIIK-----CNPNVTKINIDNAYPPGCRKQLDSIVW 219          
The following BLAST results are available for this feature:
BLAST of SMED30030167 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030167 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030167 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tsp47F2.280e-623.81gene:FBgn0033629 transcript:FBtr0088151[more]
Tsp26A3.017e-625.00gene:FBgn0031760 transcript:FBtr0332600[more]
Tsp26A4.032e-625.00gene:FBgn0031760 transcript:FBtr0113024[more]
Tsp26A8.418e-624.68gene:FBgn0031760 transcript:FBtr0307300[more]
back to top
BLAST of SMED30030167 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030167 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sertad46.908e-726.61SERTA domain containing 4 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of SMED30030167 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030167 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030167 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P1M04.551e-1024.10Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4E0S1Q51.225e-826.43Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A183A6742.091e-725.63Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A504Z0036.174e-726.26Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4Z2D3Q22.567e-623.08Tetraspanin family isoform 1 OS=Schistosoma japoni... [more]
back to top
BLAST of SMED30030167 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cd632.191e-632.50CD63 molecule [Source:NCBI gene;Acc:103032697][more]
cd632.858e-632.50CD63 molecule [Source:NCBI gene;Acc:103032697][more]
tspan5b5.018e-626.62tetraspanin 5b [Source:ZFIN;Acc:ZDB-GENE-041212-12... [more]
tspan5b5.904e-626.62tetraspanin 5b [Source:ZFIN;Acc:ZDB-GENE-041212-12... [more]
back to top
BLAST of SMED30030167 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009492.11.350e-634.44pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-... [more]
back to top
BLAST of SMED30030167 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030167 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030167 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1132237.225e-726.49tetraspanin-33-like [Source:NCBI gene;Acc:10117514... [more]
tspan77.788e-625.93tetraspanin 6 [Source:NCBI gene;Acc:101163337][more]
tspan79.230e-625.93tetraspanin 6 [Source:NCBI gene;Acc:101163337][more]
back to top
BLAST of SMED30030167 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000039913.10.000e+099.38SMESG000039913.1[more]
SMESG000039913.17.897e-14999.17SMESG000039913.1[more]
SMESG000051756.11.101e-1535.92SMESG000051756.1[more]
SMESG000043617.12.359e-726.15SMESG000043617.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030167 ID=SMED30030167|Name=SMED30030167|organism=Schmidtea mediterranea sexual|type=transcript|length=1095bp
TTTTGTCACTTTATTGAAACTGATGTAACGGGCCCAGAAAATGAAATGTC
GAAATTATTCTTTAGCTAAAAGGGAAATTTGTTGCACCGAGTCATTAAAT
CGCACAATATTGTGTTTGAAACTATTAACTTCTTTGGTTAATATTTTAAT
AAGTCTTTTGGGATTTGGATTAATTTTAATAGTTGGTTTTGTGTACTTCT
ATCAACCAGCTTACCATTTTATAGTGGCTATAAACCAGTTGGTAAGTGTT
CCTCTGTTTACTTCTATCCTAGTCGTGATGTGCGTTGGCTTGGTCGTCTC
TGGATCATATGGATTCTTTCACTCTGTTAGAGAAAATTCTTACGTCATTA
ATATGCAGACGATTCTTTTATCTATATTTTGGATAGTGTTACTTATTCTC
ATTGGAACCTCAATATATGGTTATCACATTTATATTGACTATGGACTGAC
ATTTGCCGTCAACATGTACAACCCAAAGTCTCCATCATCCCAATATATGG
AAGTCATAGAGAAACATTTACAGTGCTGCGGGAATCTCGGGCCAAAGGAC
TACAACAACCGTGACCTGTTCGATAGCAATACGGTTCCATTTTCCTGCTG
TGATTATTATCACAAAAACCGAACGACAGTAAAAAACCTATGTAAATTTT
TCGAAGTAAACTATAAACGAATCCCGATAGAATTGGCTTTCCAAACCGGA
TGCTTGGAAAAGTTCCACGATGTGATTTTTCCAGCAATGATCGTCATTTC
CAGCAGTTTACTTTTGTCAATTCTTACCAACATTATTATCAATATTGTCT
TTTGTGCAGTTCTTGCTTACAAAAATAAAAAAATAATTCAGATAAAAAAA
AGACTAAAACCCATTTTTGTTGGAGAGATTTCTGAAGATTTCTTGGACGC
CTCAATTGAACTTGGACTTATTGAGATTCCAAATGAATTCGAGTATACGG
AGCAGCCGGAAAAGCCTGTAAATTTAATTTATCAATGTTCGGATTACAAA
TCATAATTCCTCAAATTTTACCCGGAATCAAATATTTATTACTTGAAAAC
AATTAATTTGTTTATTAATTTAAATTGTTTTTATCTTGTTCTATT
back to top

protein sequence of SMED30030167-orf-1

>SMED30030167-orf-1 ID=SMED30030167-orf-1|Name=SMED30030167-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MKCRNYSLAKREICCTESLNRTILCLKLLTSLVNILISLLGFGLILIVGF
VYFYQPAYHFIVAINQLVSVPLFTSILVVMCVGLVVSGSYGFFHSVRENS
YVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSS
QYMEVIEKHLQCCGNLGPKDYNNRDLFDSNTVPFSCCDYYHKNRTTVKNL
CKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMIVISSSLLLSILTNIII
NIVFCAVLAYKNKKIIQIKKRLKPIFVGEISEDFLDASIELGLIEIPNEF
EYTEQPEKPVNLIYQCSDYKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 129..229
e-value: 3.6E-8
score: 35.1
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 142..229
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 26..255
e-value: 1.8E-16
score: 60.6
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 24..249
NoneNo IPR availablePANTHERPTHR19282:SF431TETRASPANIN-17coord: 24..249
NoneNo IPR availableCDDcd03127tetraspanin_LELcoord: 127..229
e-value: 2.29312E-10
score: 54.4327
NoneNo IPR availableTMHMMTMhelixcoord: 232..254
NoneNo IPR availableTMHMMTMhelixcoord: 31..53
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 68..90