AAA domain-containing protein

Overview
NameAAA domain-containing protein
Smed IDSMED30030135
Length (bp)4690
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AAA domain-containing protein (SMED30030135) t-SNE clustered cells

Violin plots show distribution of expression levels for AAA domain-containing protein (SMED30030135) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030135

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030135SMESG000045800.1 Contig4877newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030135SMESG000045800.1 Contig4877uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030135SMESG000045800.1 Contig3692newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030135SMESG000045800.1 Contig3692uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030135SMESG000060226.1 SMESG000021986.1 Contig3692newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030135SMESG000060226.1 SMESG000021986.1 Contig3692uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30030135SMESG000045800.1 SmedASXL_015473SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30030135 SmedASXL_060050SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30030135SMESG000045800.1 dd_Smed_v4_14599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030135SMESG000045800.1 Contig16511newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030135SMESG000045800.1 Contig16511uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30030135SMESG000045800.1 Contig16511newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030135SMESG000045800.1 Contig16511uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30030135SMESG000045800.1 dd_Smed_v4_14599_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030135SMESG000045800.1 SMED_32658_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030135SMESG000045800.1 SMED_32658_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 46.595 bits (109), Expect = 7.541e-7
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ W+DIAG+E  K  I+EIV+ PMLRP
Sbjct:  389 NEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRP 424          

HSP 2 Score: 28.8758 bits (63), Expect = 7.541e-7
Identity = 25/95 (26.32%), Postives = 39/95 (41.05%), Query Frame = 2
Query: 3056 IRKQNSNNSPQVAA--LYGTNKKFLGTRR--GVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            + +Q   + PQ A+   YG  KK LG  R  G+  +F+ P+      +           A P +             E LK  EP  +EL++NE+
Sbjct:  304 VDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPV-------DERLKNLEPKMIELIMNEI 391          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 46.595 bits (109), Expect = 7.541e-7
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ W+DIAG+E  K  I+EIV+ PMLRP
Sbjct:  389 NEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRP 424          

HSP 2 Score: 28.8758 bits (63), Expect = 7.541e-7
Identity = 25/95 (26.32%), Postives = 39/95 (41.05%), Query Frame = 2
Query: 3056 IRKQNSNNSPQVAA--LYGTNKKFLGTRR--GVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            + +Q   + PQ A+   YG  KK LG  R  G+  +F+ P+      +           A P +             E LK  EP  +EL++NE+
Sbjct:  304 VDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPV-------DERLKNLEPKMIELIMNEI 391          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 46.595 bits (109), Expect = 7.541e-7
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ W+DIAG+E  K  I+EIV+ PMLRP
Sbjct:  389 NEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRP 424          

HSP 2 Score: 28.8758 bits (63), Expect = 7.541e-7
Identity = 25/95 (26.32%), Postives = 39/95 (41.05%), Query Frame = 2
Query: 3056 IRKQNSNNSPQVAA--LYGTNKKFLGTRR--GVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            + +Q   + PQ A+   YG  KK LG  R  G+  +F+ P+      +           A P +             E LK  EP  +EL++NE+
Sbjct:  304 VDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPV-------DERLKNLEPKMIELIMNEI 391          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 46.595 bits (109), Expect = 7.541e-7
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ W+DIAG+E  K  I+EIV+ PMLRP
Sbjct:  389 NEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRP 424          

HSP 2 Score: 28.8758 bits (63), Expect = 7.541e-7
Identity = 25/95 (26.32%), Postives = 39/95 (41.05%), Query Frame = 2
Query: 3056 IRKQNSNNSPQVAA--LYGTNKKFLGTRR--GVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            + +Q   + PQ A+   YG  KK LG  R  G+  +F+ P+      +           A P +             E LK  EP  +EL++NE+
Sbjct:  304 VDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPV-------DERLKNLEPKMIELIMNEI 391          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 46.595 bits (109), Expect = 7.541e-7
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ W+DIAG+E  K  I+EIV+ PMLRP
Sbjct:  389 NEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRP 424          

HSP 2 Score: 28.8758 bits (63), Expect = 7.541e-7
Identity = 25/95 (26.32%), Postives = 39/95 (41.05%), Query Frame = 2
Query: 3056 IRKQNSNNSPQVAA--LYGTNKKFLGTRR--GVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            + +Q   + PQ A+   YG  KK LG  R  G+  +F+ P+      +           A P +             E LK  EP  +EL++NE+
Sbjct:  304 VDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPV-------DERLKNLEPKMIELIMNEI 391          
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Match: figl-1 (Fidgetin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16299])

HSP 1 Score: 53.1434 bits (126), Expect = 1.402e-6
Identity = 24/30 (80.00%), Postives = 27/30 (90.00%), Query Frame = 1
Query: 4582 KFSDLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            K  D+FTGIRAP KG+LLFGPPGTGKT+IG
Sbjct:  337 KRPDVFTGIRAPPKGVLLFGPPGTGKTMIG 366          
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Match: figl-1 (Fidgetin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16299])

HSP 1 Score: 53.1434 bits (126), Expect = 1.402e-6
Identity = 24/30 (80.00%), Postives = 27/30 (90.00%), Query Frame = 1
Query: 4582 KFSDLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            K  D+FTGIRAP KG+LLFGPPGTGKT+IG
Sbjct:  337 KRPDVFTGIRAPPKGVLLFGPPGTGKTMIG 366          
BLAST of AAA domain-containing protein vs. Ensembl Fly
Match: spas (gene:FBgn0039141 transcript:FBtr0084534)

HSP 1 Score: 53.9138 bits (128), Expect = 1.312e-6
Identity = 22/27 (81.48%), Postives = 25/27 (92.59%), Query Frame = 1
Query: 4591 DLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            +LFTG+RAPAKGLLLFGPPG GKTL+ 
Sbjct:  507 ELFTGLRAPAKGLLLFGPPGNGKTLLA 533          
BLAST of AAA domain-containing protein vs. Ensembl Fly
Match: spas (gene:FBgn0039141 transcript:FBtr0084533)

HSP 1 Score: 53.9138 bits (128), Expect = 1.312e-6
Identity = 22/27 (81.48%), Postives = 25/27 (92.59%), Query Frame = 1
Query: 4591 DLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            +LFTG+RAPAKGLLLFGPPG GKTL+ 
Sbjct:  507 ELFTGLRAPAKGLLLFGPPGNGKTLLA 533          
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 49.2914 bits (116), Expect = 4.558e-8
Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  376 SEIMDHGPPVAWDDIAGLEFAKATIKEIVVWPMLRP 411          

HSP 2 Score: 29.6462 bits (65), Expect = 4.558e-8
Identity = 25/90 (27.78%), Postives = 41/90 (45.56%), Query Frame = 2
Query: 3065 QNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            Q    SP    ++   KK LG    RG  S+FI+P+   + ++   D++P      P+              E LK FEP  +EL+++E+
Sbjct:  308 QGQRGSP--GNVFTITKKCLGANRSRGASSKFISPM--PRQEEDLKDNTPKD--MQPVD-------------ERLKNFEPKIIELIMSEI 378          
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 49.2914 bits (116), Expect = 4.558e-8
Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  376 SEIMDHGPPVAWDDIAGLEFAKATIKEIVVWPMLRP 411          

HSP 2 Score: 29.6462 bits (65), Expect = 4.558e-8
Identity = 25/90 (27.78%), Postives = 41/90 (45.56%), Query Frame = 2
Query: 3065 QNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            Q    SP    ++   KK LG    RG  S+FI+P+   + ++   D++P      P+              E LK FEP  +EL+++E+
Sbjct:  308 QGQRGSP--GNVFTITKKCLGANRSRGASSKFISPM--PRQEEDLKDNTPKD--MQPVD-------------ERLKNFEPKIIELIMSEI 378          
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Match: fignl1 (fidgetin-like 1 [Source:NCBI gene;Acc:100124890])

HSP 1 Score: 49.2914 bits (116), Expect = 6.087e-9
Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 3
Query: 3366 KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            +I+D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  372 EIMDHGPPLNWDDIAGLEFAKTTIKEIVVWPMLRP 406          

HSP 2 Score: 30.0314 bits (66), Expect = 6.087e-9
Identity = 29/97 (29.90%), Postives = 45/97 (46.39%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQV--AALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+ SN  PQ   + LYG  KK LG    RG+  +F+ PV   +  Q  N               + N   +  + E LK  EP  +EL+++E+
Sbjct:  288 VDQQKKYSNQ-PQRNPSPLYGGAKKSLGAARSRGLHGKFVPPVPRQEDVQDSNRKV----------YGQGNSEMNAPSDERLKNIEPKMIELIMSEI 373          

HSP 3 Score: 22.7126 bits (47), Expect = 6.087e-9
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query: 2970 TC--GFRTAKEQL 3002
            TC  GF+TAKEQL
Sbjct:  274 TCESGFKTAKEQL 286          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 49.2914 bits (116), Expect = 8.070e-9
Identity = 20/36 (55.56%), Postives = 28/36 (77.78%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P++WDDIAG+E  K  I+EIV+ PM+RP
Sbjct:  398 NEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRP 433          

HSP 2 Score: 30.4166 bits (67), Expect = 8.070e-9
Identity = 27/95 (28.42%), Postives = 42/95 (44.21%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+   +     +  G  KK LG    RG+  +F+ PV  NK D +        S+ A    P        +  + LK  EP  VEL++NE+
Sbjct:  313 VDQKKKGHQSQHTSKSSNGVMKKSLGAGRSRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEPAH------LTDDCLKNVEPRMVELIMNEI 400          

HSP 3 Score: 20.7866 bits (42), Expect = 8.070e-9
Identity = 9/14 (64.29%), Postives = 11/14 (78.57%), Query Frame = 3
Query: 2961 DNNTCGFRTAKEQL 3002
            DN+   F+TAKEQL
Sbjct:  298 DNSLPTFKTAKEQL 311          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 49.2914 bits (116), Expect = 8.070e-9
Identity = 20/36 (55.56%), Postives = 28/36 (77.78%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P++WDDIAG+E  K  I+EIV+ PM+RP
Sbjct:  398 NEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRP 433          

HSP 2 Score: 30.4166 bits (67), Expect = 8.070e-9
Identity = 27/95 (28.42%), Postives = 42/95 (44.21%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+   +     +  G  KK LG    RG+  +F+ PV  NK D +        S+ A    P        +  + LK  EP  VEL++NE+
Sbjct:  313 VDQKKKGHQSQHTSKSSNGVMKKSLGAGRSRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEPAH------LTDDCLKNVEPRMVELIMNEI 400          

HSP 3 Score: 20.7866 bits (42), Expect = 8.070e-9
Identity = 9/14 (64.29%), Postives = 11/14 (78.57%), Query Frame = 3
Query: 2961 DNNTCGFRTAKEQL 3002
            DN+   F+TAKEQL
Sbjct:  298 DNSLPTFKTAKEQL 311          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 49.2914 bits (116), Expect = 8.070e-9
Identity = 20/36 (55.56%), Postives = 28/36 (77.78%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P++WDDIAG+E  K  I+EIV+ PM+RP
Sbjct:  398 NEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRP 433          

HSP 2 Score: 30.4166 bits (67), Expect = 8.070e-9
Identity = 27/95 (28.42%), Postives = 42/95 (44.21%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+   +     +  G  KK LG    RG+  +F+ PV  NK D +        S+ A    P        +  + LK  EP  VEL++NE+
Sbjct:  313 VDQKKKGHQSQHTSKSSNGVMKKSLGAGRSRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEPAH------LTDDCLKNVEPRMVELIMNEI 400          

HSP 3 Score: 20.7866 bits (42), Expect = 8.070e-9
Identity = 9/14 (64.29%), Postives = 11/14 (78.57%), Query Frame = 3
Query: 2961 DNNTCGFRTAKEQL 3002
            DN+   F+TAKEQL
Sbjct:  298 DNSLPTFKTAKEQL 311          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 49.2914 bits (116), Expect = 8.070e-9
Identity = 20/36 (55.56%), Postives = 28/36 (77.78%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P++WDDIAG+E  K  I+EIV+ PM+RP
Sbjct:  398 NEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRP 433          

HSP 2 Score: 30.4166 bits (67), Expect = 8.070e-9
Identity = 27/95 (28.42%), Postives = 42/95 (44.21%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+   +     +  G  KK LG    RG+  +F+ PV  NK D +        S+ A    P        +  + LK  EP  VEL++NE+
Sbjct:  313 VDQKKKGHQSQHTSKSSNGVMKKSLGAGRSRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEPAH------LTDDCLKNVEPRMVELIMNEI 400          

HSP 3 Score: 20.7866 bits (42), Expect = 8.070e-9
Identity = 9/14 (64.29%), Postives = 11/14 (78.57%), Query Frame = 3
Query: 2961 DNNTCGFRTAKEQL 3002
            DN+   F+TAKEQL
Sbjct:  298 DNSLPTFKTAKEQL 311          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IHT0|FIGL1_XENTR (Fidgetin-like protein 1 OS=Xenopus tropicalis OX=8364 GN=fignl1 PE=2 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 2.468e-8
Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 3
Query: 3366 KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            +I+D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  372 EIMDHGPPLNWDDIAGLEFAKTTIKEIVVWPMLRP 406          

HSP 2 Score: 30.0314 bits (66), Expect = 2.468e-8
Identity = 29/97 (29.90%), Postives = 45/97 (46.39%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQV--AALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+ SN  PQ   + LYG  KK LG    RG+  +F+ PV   +  Q  N               + N   +  + E LK  EP  +EL+++E+
Sbjct:  288 VDQQKKYSNQ-PQRNPSPLYGGAKKSLGAARSRGLHGKFVPPVPRQEDVQDSNRKV----------YGQGNSEMNAPSDERLKNIEPKMIELIMSEI 373          

HSP 3 Score: 22.7126 bits (47), Expect = 2.468e-8
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query: 2970 TC--GFRTAKEQL 3002
            TC  GF+TAKEQL
Sbjct:  274 TCESGFKTAKEQL 286          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BPY9|FIGL1_MOUSE (Fidgetin-like protein 1 OS=Mus musculus OX=10090 GN=Fignl1 PE=1 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 4.942e-8
Identity = 20/36 (55.56%), Postives = 28/36 (77.78%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P++WDDIAG+E  K  I+EIV+ PM+RP
Sbjct:  398 NEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRP 433          

HSP 2 Score: 30.4166 bits (67), Expect = 4.942e-8
Identity = 27/95 (28.42%), Postives = 42/95 (44.21%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+   +     +  G  KK LG    RG+  +F+ PV  NK D +        S+ A    P        +  + LK  EP  VEL++NE+
Sbjct:  313 VDQKKKGHQSQHTSKSSNGVMKKSLGAGRSRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEPAH------LTDDCLKNVEPRMVELIMNEI 400          

HSP 3 Score: 20.7866 bits (42), Expect = 4.942e-8
Identity = 9/14 (64.29%), Postives = 11/14 (78.57%), Query Frame = 3
Query: 2961 DNNTCGFRTAKEQL 3002
            DN+   F+TAKEQL
Sbjct:  298 DNSLPTFKTAKEQL 311          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DDU8|FIGL1_XENLA (Fidgetin-like protein 1 OS=Xenopus laevis OX=8355 GN=fignl1 PE=2 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.896e-7
Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 3
Query: 3366 KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            +I+D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  371 EIMDHGPPLNWDDIAGLEFAKTTIKEIVVWPMLRP 405          

HSP 2 Score: 30.4166 bits (67), Expect = 1.896e-7
Identity = 28/97 (28.87%), Postives = 46/97 (47.42%), Query Frame = 2
Query: 3050 IDIRKQNSNNSPQV--AALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K++SN  PQ     LYG  KK LG    RG+  +FI P+   +  +  N               + N   +  + E+LK  EP  +EL+++E+
Sbjct:  287 VDQQKKHSNQ-PQRNPGPLYGGGKKSLGAARSRGLHGKFIPPLPRQEDVEDSNRKV----------YGQGNSEMNSTSDEHLKNIEPKMIELIMSEI 372          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6GX84|FIGL1_RAT (Fidgetin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Fignl1 PE=2 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 2.255e-7
Identity = 19/36 (52.78%), Postives = 28/36 (77.78%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P++W+DIAG+E  K  I+EIV+ PM+RP
Sbjct:  392 NEIMDHGPPVHWEDIAGVEFAKATIKEIVVWPMMRP 427          

HSP 2 Score: 30.0314 bits (66), Expect = 2.255e-7
Identity = 29/98 (29.59%), Postives = 48/98 (48.98%), Query Frame = 2
Query: 3053 DIRKQNSNNSPQVAALYGTNKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESI----INHENLKQFEPAKVELLLNEV 3328
            D +K++  +     +  G  KK LG    RG+  +F+ PV  NK D +  + +        +K PKS++  S     +  + LK  EP  VEL++NE+
Sbjct:  307 DQKKRSHQSQHTSKSFNGAIKKSLGAGRSRGIFGKFVPPV-SNKQDGSEQNGN--------VK-PKSSRAGSAEPAHLTDDRLKNVEPRMVELIMNEI 394          

HSP 3 Score: 20.7866 bits (42), Expect = 2.255e-7
Identity = 9/14 (64.29%), Postives = 11/14 (78.57%), Query Frame = 3
Query: 2961 DNNTCGFRTAKEQL 3002
            DN+   F+TAKEQL
Sbjct:  291 DNSLPTFKTAKEQL 304          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PIW4|FIGL1_HUMAN (Fidgetin-like protein 1 OS=Homo sapiens OX=9606 GN=FIGNL1 PE=1 SV=2)

HSP 1 Score: 46.595 bits (109), Expect = 3.361e-6
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ W+DIAG+E  K  I+EIV+ PMLRP
Sbjct:  389 NEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRP 424          

HSP 2 Score: 28.8758 bits (63), Expect = 3.361e-6
Identity = 25/95 (26.32%), Postives = 39/95 (41.05%), Query Frame = 2
Query: 3056 IRKQNSNNSPQVAA--LYGTNKKFLGTRR--GVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            + +Q   + PQ A+   YG  KK LG  R  G+  +F+ P+      +           A P +             E LK  EP  +EL++NE+
Sbjct:  304 VDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPV-------DERLKNLEPKMIELIMNEI 391          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A1S3IGH9 (fidgetin-like protein 1 OS=Lingula unguis OX=7574 GN=LOC106164080 PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.475e-12
Identity = 34/91 (37.36%), Postives = 49/91 (53.85%), Query Frame = 2
Query: 3062 KQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIIN--HENLKQFEPAKVELLLNEV 3328
            K+NS   P  A+ YG NKK LGTRRG+ S+F+ PV+         D S S  ++  +K    NK ++      E LK  +P  +EL+ NE+
Sbjct:  318 KKNSRQGPVNASNYGMNKKSLGTRRGLTSKFVPPVMN-------RDGSDSDESSTLLKRSGLNKAQTTDEPVDERLKNIDPKMIELIANEI 401          

HSP 2 Score: 50.0618 bits (118), Expect = 2.475e-12
Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  399 NEIMDHGPPVSWDDIAGLEFAKNTIKEIVVWPMLRP 434          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A3P7Y347 (AAA domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS65 PE=4 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.284e-11
Identity = 34/89 (38.20%), Postives = 53/89 (59.55%), Query Frame = 2
Query: 3062 KQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            KQN NN+ + + +YG++K+ LG+RRGVR  F+ P   +  D T     P+SS  A       NK E+ I  E LKQF+   V+++++E+
Sbjct:    8 KQNENNN-RTSLMYGSSKRSLGSRRGVRGNFVPPFEKDS-DST---SKPTSSYIA------ENKSEASICDERLKQFDQKIVDMIMSEI 85          

HSP 2 Score: 48.9062 bits (115), Expect = 1.284e-11
Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 3
Query: 3366 KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            +I+D    I WDDIAGLE  K+ +QEIV+LPMLRP
Sbjct:   84 EIMDSKSSITWDDIAGLEFSKKTLQEIVILPMLRP 118          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A430QHE8 (AAA_lid_3 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0009439 PE=4 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.359e-11
Identity = 33/89 (37.08%), Postives = 53/89 (59.55%), Query Frame = 2
Query: 3062 KQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            KQN NN+ + + +YG++K+ LG+RRGVR  F+ P   +  D T     P+SS  A       NK E+ +  E LKQF+   V+++++E+
Sbjct:  160 KQNENNN-RTSLMYGSSKRSLGSRRGVRGNFVPPFEKDS-DST---SKPTSSYIAE------NKSEASVCDERLKQFDQKIVDMIMSEI 237          

HSP 2 Score: 49.6766 bits (117), Expect = 1.359e-11
Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 3
Query: 3366 KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            +I+D    I WDDIAGLE  K+ +QEIV+LPMLRP
Sbjct:  236 EIMDSKSSITWDDIAGLEFSKKTLQEIVILPMLRP 270          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A183LAG0 (AAA domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS785 PE=4 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.387e-11
Identity = 34/89 (38.20%), Postives = 53/89 (59.55%), Query Frame = 2
Query: 3062 KQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            KQN NN+ + + +YG++K+ LG+RRGVR  F+ P   +  D T     P+SS  A       NK E+ I  E LKQF+   V+++++E+
Sbjct:   59 KQNENNN-RTSLMYGSSKRSLGSRRGVRGNFVPPFEKDS-DST---SKPTSSYIA------ENKSEASICDERLKQFDQKIVDMIMSEI 136          

HSP 2 Score: 48.9062 bits (115), Expect = 1.387e-11
Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D    I WDDIAGLE  K+ +QEIV+LPMLRP
Sbjct:  134 SEIMDSKSSITWDDIAGLEFSKKTLQEIVILPMLRP 169          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A183ND79 (AAA domain-containing protein OS=Schistosoma mattheei OX=31246 PE=4 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.393e-11
Identity = 34/89 (38.20%), Postives = 53/89 (59.55%), Query Frame = 2
Query: 3062 KQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            KQN NN+ + + +YG++K+ LG+RRGVR  F+ P   +  D T     P+SS  A       NK E+ I  E LKQF+   V+++++E+
Sbjct:    8 KQNENNN-RTSLMYGSSKRSLGSRRGVRGNFVPPFEKDS-DST---SKPTSSYIA------ENKSEASICDERLKQFDQKIVDMIMSEI 85          

HSP 2 Score: 48.9062 bits (115), Expect = 1.393e-11
Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 3
Query: 3366 KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            +I+D    I WDDIAGLE  K+ +QEIV+LPMLRP
Sbjct:   84 EIMDSKSSITWDDIAGLEFSKKTLQEIVILPMLRP 118          
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 49.6766 bits (117), Expect = 1.531e-7
Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +I+D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  382 SEIMDHGPPVAWDDIAGLEFAKTTIKEIVVWPMLRP 417          

HSP 2 Score: 27.335 bits (59), Expect = 1.531e-7
Identity = 22/75 (29.33%), Postives = 36/75 (48.00%), Query Frame = 2
Query: 3110 NKKFLGT--RRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
             KK LG    RG  S+F++P +  + D+  +D +  +    PI              E LK FEP  +EL+++E+
Sbjct:  327 TKKCLGANRSRGTHSKFVSP-MPRQEDEGRDDPAQDT---PPID-------------ERLKNFEPKIIELIMSEI 384          
BLAST of AAA domain-containing protein vs. Ensembl Sea Lamprey
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 49.2914 bits (116), Expect = 3.470e-9
Identity = 21/36 (58.33%), Postives = 27/36 (75.00%), Query Frame = 3
Query: 3363 QKILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
             +++D G P+ WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  380 NEVMDHGPPVSWDDIAGLEFAKATIKEIVVWPMLRP 415          

HSP 2 Score: 30.8018 bits (68), Expect = 3.470e-9
Identity = 31/90 (34.44%), Postives = 40/90 (44.44%), Query Frame = 2
Query: 3065 QNSNNSPQVAALYGTNKKFLGTR--RGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            QN   +PQ +A     KK LGT   RG   +F++PV+         D S S+           N   S I  E LK  +P  VEL+ NEV
Sbjct:  309 QNRACAPQASA-----KKSLGTSKPRGPYGKFVSPVL-------REDGSESTGQC----TRGQNGEPSQIIDERLKNIDPKMVELINNEV 382          

HSP 3 Score: 49.6766 bits (117), Expect = 4.900e-6
Identity = 22/27 (81.48%), Postives = 25/27 (92.59%), Query Frame = 1
Query: 4591 DLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            D+FTG+R P KG+LLFGPPGTGKTLIG
Sbjct:  416 DIFTGLRGPPKGILLFGPPGTGKTLIG 442          
BLAST of AAA domain-containing protein vs. Ensembl Sea Lamprey
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 49.6766 bits (117), Expect = 4.342e-6
Identity = 21/27 (77.78%), Postives = 25/27 (92.59%), Query Frame = 1
Query: 4591 DLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            +LFTG+RAPAKGLLLFGPPG GKT++ 
Sbjct:  229 ELFTGLRAPAKGLLLFGPPGNGKTMLA 255          
BLAST of AAA domain-containing protein vs. Ensembl Yeast
Match: YTA6 (Putative ATPase of the CDC48/PAS1/SEC18 (AAA) family; localized to the cortex of mother cells but not to daughter cells; relocalizes from cytoplasm to plasma membrane foci upon DNA replication stress [Source:SGD;Acc:S000005995])

HSP 1 Score: 50.0618 bits (118), Expect = 2.564e-6
Identity = 19/27 (70.37%), Postives = 23/27 (85.19%), Query Frame = 1
Query: 4591 DLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            DLF G+R P +G+LLFGPPGTGKT+I 
Sbjct:  495 DLFKGLREPVRGMLLFGPPGTGKTMIA 521          
BLAST of AAA domain-containing protein vs. Ensembl Yeast
Match: SAP1 (Putative ATPase of the AAA family; interacts with the Sin1p transcriptional repressor in the two-hybrid system [Source:SGD;Acc:S000000849])

HSP 1 Score: 48.9062 bits (115), Expect = 6.477e-6
Identity = 18/27 (66.67%), Postives = 23/27 (85.19%), Query Frame = 1
Query: 4591 DLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            DLF G+R P +G+LLFGPPGTGKT++ 
Sbjct:  629 DLFRGLREPVRGMLLFGPPGTGKTMLA 655          
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Match: fignl1 (fidgetin like 1 [Source:NCBI gene;Acc:101168425])

HSP 1 Score: 49.6766 bits (117), Expect = 2.250e-9
Identity = 23/35 (65.71%), Postives = 27/35 (77.14%), Query Frame = 3
Query: 3366 KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            +I+D G PI WDDIAGLE  K  I+EIV+ PMLRP
Sbjct:  351 EIMDHGPPIGWDDIAGLEFAKNTIKEIVVWPMLRP 385          

HSP 2 Score: 33.8834 bits (76), Expect = 2.250e-9
Identity = 30/97 (30.93%), Postives = 46/97 (47.42%), Query Frame = 2
Query: 3050 IDIRKQNSNNS--PQVAALYGTNKKFLGTRR--GVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            +D +K+ S  S   Q   +  T KK LG  R  G  S+F++P+   + +   N  S SS+   PI              E LK FEP  +EL+++E+
Sbjct:  270 VDQQKKCSQQSRGAQAFGMTATVKKSLGANRPRGTFSKFVSPI--PRQEDEDNAASQSSTQEPPIL------------DERLKNFEPKIIELIMSEI 352          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000045800.1 (SMESG000045800.1)

HSP 1 Score: 245.358 bits (625), Expect = 1.235e-69
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 3
Query:  291 MVDKIVNNKNSFHMSSPNTDFKVTNEIKQKVLQFNFHPIEVKTQDYKETTTLNKIEKVNQILTSDDETPKKLYSFKTFVNQKNNQNTXXXXXXXXXXXXXXXXXQNNDISASNFKDQKCGFNYKENFSNETKIYSNKIFETQ 716
            MVDKIVNNKNSFHMSSPNTDFKVTNEIKQKVLQFNFHPIEVKTQDYKETTTLNKIEKVNQILTSDDETPKKLYSFKTFVNQKNNQNTGSLSFGSFEESKSKFELQNNDISASNFKDQKCGFNYKENFSNETKIYSNKIFETQ
Sbjct:    1 MVDKIVNNKNSFHMSSPNTDFKVTNEIKQKVLQFNFHPIEVKTQDYKETTTLNKIEKVNQILTSDDETPKKLYSFKTFVNQKNNQNTGSLSFGSFEESKSKFELQNNDISASNFKDQKCGFNYKENFSNETKIYSNKIFETQ 142          

HSP 2 Score: 192.586 bits (488), Expect = 1.032e-51
Identity = 92/94 (97.87%), Postives = 93/94 (98.94%), Query Frame = 2
Query: 3047 GIDIRKQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNKIDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEV 3328
            GIDIRKQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNK DQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNE+
Sbjct:  164 GIDIRKQNSNNSPQVAALYGTNKKFLGTRRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEI 257          

HSP 3 Score: 101.293 bits (251), Expect = 1.517e-21
Identity = 79/186 (42.47%), Postives = 88/186 (47.31%), Query Frame = 3
Query: 2940 NNEINISDNNTCGFRTAKEQLVNDLYL*LSFINELRGLTSGNKIQIIVRK*RLCMELTKSFLGHAEGCEANLLRPS*AIK*IKRIMTILHHQVPPLQ*RCQKAINMNP*LTMKI*SNLNPPKWNCFLMK*INLEGVY*KYFQ---------KILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 3470
            NNEINISDNNTCGFRTAKEQL  D+          R   S N  Q+            K FLG   G  +  + P   +   K   T   H            I M              PK N +    IN E +  K F+         +ILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP
Sbjct:  143 NNEINISDNNTCGFRTAKEQLGIDI----------RKQNSNNSPQVAA-----LYGTNKKFLGTRRGVRSEFIAP---VIGNKTDQTYNDHSPSS---SAAAPIKM--------------PKSNKY-ESIINHENL--KQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRP 290          

HSP 4 Score: 58.5362 bits (140), Expect = 3.059e-8
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 1
Query: 4591 DLFTGIRAPAKGLLLFGPPGTGKTLIG 4671
            DLFTGIRAPAKGLLLFGPPGTGKTLIG
Sbjct:  291 DLFTGIRAPAKGLLLFGPPGTGKTLIG 317          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000077977.1 (SMESG000077977.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.259e-8
Identity = 51/164 (31.10%), Postives = 78/164 (47.56%), Query Frame = -3
Query: 1752 LSHLFNIYG--TLTDSDRGTQ---QKIRKYLHNNGIVKTRTAPYRLQCNG*REKLSKSQWR*LLDLSINAIRTLLLMTTSKTPHSRIFRFSRSLV-----------SGKYYII*NMI------F**KK*H*LKLCSFFARIEHPSGKIDTVSTRHLALSEIDIN 2177
            L  LF++ G  +   SDRG+Q   + ++ +LH NG++K+RT PY  Q                      AIR+LL   T+ TPH ++FR  RSLV             +  +I N I      F  +      +   F+R+E  +G++DTVS + LA + +DIN
Sbjct: 2759 LDDLFSLLGPPSCIHSDRGSQFESKIVKDFLHRNGVLKSRTMPYNPQ----------------------AIRSLLCTKTNSTPHDKLFRLQRSLVIPYNTPNFFTTPNQTTLIKNQIRHKNYPFVEEVKLIKAISPHFSRVEFQNGRVDTVSNKFLAPT-VDIN 2899          
The following BLAST results are available for this feature:
BLAST of AAA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIGNL17.541e-755.56fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL17.541e-755.56fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL17.541e-755.56fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL17.541e-755.56fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL17.541e-755.56fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
figl-11.402e-680.00Fidgetin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
figl-11.402e-680.00Fidgetin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spas1.312e-681.48gene:FBgn0039141 transcript:FBtr0084534[more]
spas1.312e-681.48gene:FBgn0039141 transcript:FBtr0084533[more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fignl14.558e-861.11fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
fignl14.558e-861.11fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fignl16.087e-962.86fidgetin-like 1 [Source:NCBI gene;Acc:100124890][more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Fignl18.070e-955.56fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
Fignl18.070e-955.56fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
Fignl18.070e-955.56fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
Fignl18.070e-955.56fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
back to top
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IHT0|FIGL1_XENTR2.468e-862.86Fidgetin-like protein 1 OS=Xenopus tropicalis OX=8... [more]
sp|Q8BPY9|FIGL1_MOUSE4.942e-855.56Fidgetin-like protein 1 OS=Mus musculus OX=10090 G... [more]
sp|Q6DDU8|FIGL1_XENLA1.896e-762.86Fidgetin-like protein 1 OS=Xenopus laevis OX=8355 ... [more]
sp|Q6GX84|FIGL1_RAT2.255e-752.78Fidgetin-like protein 1 OS=Rattus norvegicus OX=10... [more]
sp|Q6PIW4|FIGL1_HUMAN3.361e-655.56Fidgetin-like protein 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of AAA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IGH92.475e-1237.36fidgetin-like protein 1 OS=Lingula unguis OX=7574 ... [more]
A0A3P7Y3471.284e-1138.20AAA domain-containing protein OS=Schistosoma matth... [more]
A0A430QHE81.359e-1137.08AAA_lid_3 domain-containing protein OS=Schistosoma... [more]
A0A183LAG01.387e-1138.20AAA domain-containing protein OS=Schistosoma margr... [more]
A0A183ND791.393e-1138.20AAA domain-containing protein OS=Schistosoma matth... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fignl11.531e-761.11fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fignl13.470e-958.33fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
spast4.342e-677.78spastin [Source:NCBI gene;Acc:405851][more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YTA62.564e-670.37Putative ATPase of the CDC48/PAS1/SEC18 (AAA) fami... [more]
SAP16.477e-666.67Putative ATPase of the AAA family; interacts with ... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fignl12.250e-965.71fidgetin like 1 [Source:NCBI gene;Acc:101168425][more]
back to top
BLAST of AAA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000045800.11.235e-69100.00SMESG000045800.1[more]
SMESG000077977.11.259e-831.10SMESG000077977.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030135 ID=SMED30030135|Name=AAA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4690bp
TTTTATCAAAATCTATTATTAGTTGAAGTAATTTTTCAAAAGTTTTATCT
AACAAAATTTTACTATTTGAAATGAACAAAGAAAACTGTTCTGAAGAGAA
ATTAAATGTAATACGGAAAGAAGTTTTTTCATGCTCTTATAATAACTGTT
ATTCATCTATTGAGAATTATTTTGAAATTTTTGATAAACCTTCTAAAAGA
TATAGTAACTACGCAGATGAAATTCTATTTAATATTAAAAATTTAAATAA
TGTTAGCCAAACTTGGAAATCGGGTTTAAATATTGACAGAATGGTTGATA
AAATCGTCAATAACAAAAATAGTTTCCATATGAGTTCTCCAAACACTGAT
TTTAAAGTTACCAATGAAATTAAGCAAAAAGTTCTTCAGTTTAATTTTCA
TCCAATTGAAGTTAAAACTCAGGATTATAAAGAAACAACTACTTTAAATA
AAATTGAAAAAGTAAATCAAATTTTAACCAGTGATGATGAAACCCCCAAA
AAGCTTTATTCATTCAAAACCTTTGTAAACCAGAAGAATAATCAGAATAC
TGGTTCTTTATCATTTGGTTCTTTCGAAGAATCTAAATCTAAATTTGAGT
TACAAAATAATGACATATCTGCTTCCAATTTTAAGGATCAGAAATGTGGT
TTTAATTATAAAGAAAATTTTTCAAATGAAACCAAAATATATTCTAATAA
AATCTTTGAAACACAGGTATGTTTATTTATAATAAATTTATATTACAGGC
CATGTGGTACTGCAGTACTATTGCTACTGCTAATAATATATTAAGGTAAT
TGAGAATTTCTTTTCTGTTTATCAAAGATTTTGTAATTATCAGGACACAA
TGACCTCGATGTATGATGAAATATTGGTGTGTAGATGTGTCTGTATGTCT
TTGAATGAGATGAATCCTAATAGTAACATTTAAAAAATTAATATTTCATT
TCTAAATTATGCAAATAAAAAGTAGTTTAAGTAGTGCTTTGATTGCGTGT
TTGAATTTCTGTTGAAAGTTTACCAAATACATATCTCAATAACATATCAA
GTTATGATGATTCTAATATTGTTTATTGATTATTTAATAGAATTTCTTTT
TCAATAATTGCTTCATTTATTTATTAATTTTTTTCATTTTTATTTACCAA
TATTGTACTTTTAGCTTTTTTTTAATAAATCTCTTGAAATTTTATCATGA
GTATAAAGATTATTGAAAAAGAATTATTTATTGAAAGTTATTTATATGAT
TTCAAAGCTCTTGTTTACGAATTACTCTAACTTATTAAAGCATTTAATTA
TTTTCTATTCGTTCATTACATCTTATTAAAAAGCCACTTTCTCACGTAAA
TATAATTGCAAACTAAGTTATTGTCAGAAATCCCATGTTTAGAAGTTCCG
AATTTGTAATAACAAGCAATATGCAATTTTTATTTAATAAAAATTTAATG
ATATTGTGAGTGAATCACAATTTTTAACAAATATATTGTTACAATATTAT
TACATTCTTCTCCTGTTGGTTTGGAATCCTGCCGTTGGCCTAGTTTGTCT
ACCATATCTGGTCGTTGTGTCTAGTGGTGTTTTGGTCACTGTCGTTTCCT
GTTCTCCGTTATTAAGAATTGAGATATTAAACTCGTTCTCGACGGTATTT
TGTAGCTGTAGTAGGTAAAGTTGCTCATTGTTAAAGTTTTCTTCATTTAA
AGTGTCGTTGTGTGTGTCACAACTTTTTGTGGATTCAGCAACATCCTTTT
CGTTGATGTCTATTTCAGAAAGAGCTAAATGTCTGGTCGAAACGGTATCT
ATCTTTCCGCTTGGGTGTTCAATCCTGGCAAAAAAGGAACAAAGCTTCAA
TTAATGTTACTTTTTCTACTAGAAGATCATATTTTATATAATATAGTATT
TACCAGATACTAAAGACCTCGAAAATCTAAAAATTCTGGAATGAGGAGTT
TTGCTCGTTGTCATTAAAAGTAGTGTGCGTATGGCATTTATTGACAAGTC
TAGCAATCATCTCCACTGTGATTTACTCAATTTTTCACGTTAGCCGTTAC
ATTGTAGTCTATATGGAGCTGTCCTAGTCTTTACAATACCGTTGTTATGA
AGGTATTTCCTGATTTTCTGTTGAGTCCCTCGATCACTGTCAGTTAAAGT
TCCATATATGTTAAATAGATGACTAAGTCAAATGATTTCTAGTTTTCTTC
AAAAGCGTAAATTTTGTAGCTATTCAAAATTCATCATAAACTGAATTCTT
TTTGACATAATAATGAAATAGCCAATTTTTTCCAAAAATAGGTTAGAAAA
ACAAACACTATACACATTTTAGTATAATCGTTTGCAATATCTATTTTATA
AAGTAATAATTTTTTGTCGATTCTCAGTACATTTTACGTTCCATACGTAT
ATATAATTTTCGTAATATATCCCCCTATGACTAACGCTATAAATTTATTC
TATTGACTATAATACATAGAATATATTACGAAATGACATTTGTCTTAAAT
TTGGAATGAAAGTACAAAAGGATTTATTTTACTCCCGTCATTTATTGGGA
GTTAAGGGGCTAGTATTTCTATAAAAGTAATGAAACTGAAAATGAAGTGG
ATAGTGAAATTGAGAAATGTTTTCTTACACTCTGTTCCTGGTCCACGAAT
TATTTTTTCGAAGTTTGTCGGTGTGTGAAGATAAACCTACTGATTAATTT
AGGTGAGTTTGAGTTATATAACATAGTAAACTGGGATGCAGAAATACTTA
TGTAAAGAGCATCATTTGAAGTTATATAAAAAAATGAATTTTATTTATAA
AAATTATGATGAAAAATATTCATAATTAACAATTAGCACGTTAAGTTATT
ATTTTTTTAACTTTCATAAGTTGTAAATCTGTTGAAATATCTAAGATTTT
ACAATCGAATTATAAAATTTTTACAAAAATACTTTATAGAATAATGAAAT
CAATATTAGTGATAACAATACTTGTGGATTTAGAACGGCTAAAGAACAAT
TGGTAAATGATTTATATTTATAATTATCGTTTATTAATGAACTAAGGGGA
TTGACATCCGGAAACAAAATTCAAATAATAGTCCGCAAGTAGCGGCTCTG
TATGGAACTAACAAAAAGTTTCTTGGGACACGCAGAGGGGTGCGAAGCGA
ATTTATTGCGCCCGTCATAGGCAATAAAATAGATCAAACGTATAATGACC
ATTCTCCATCATCAAGTGCCGCCGCTCCAATAAAGATGCCAAAAAGCAAT
AAATATGAATCCATAATTAACCATGAAAATTTAAAGCAATTTGAACCCGC
CAAAGTGGAATTGCTTCTTAATGAAGTAAATTAATTTAGAAGGAGTTTAT
TGAAAATATTTTCAAAAGATTTTGGATTTTGGAAAGCCAATTTACTGGGA
TGACATAGCCGGCCTTGAATCTCCTAAGCAAATTATTCAGGAAATTGTTA
TGTTGCCAATGCTAAGACCGTAATATCTCCAATTTAAATTTTATTCGAAT
TTATTTGTTCATTTTTTGAATATTTGCTAAAAATAATAATAATAACAATT
ATAATTATAATAATTTCGATATATAGAGTTTTTTATTGATTCTGGAGAAG
ACATTGATAAGGTCTAGATTTTTATTTTTCATGGCGTTCAAGTATGACTT
CAATAATCATACTTGAAGAGAATTGTGATTTTATTTATGTACCAGAATAT
AAAACTCATGAAGAGGAAAATCCACACATAAATAAAAATGTTAAAAATTC
AGTTATTGTATTCTTTATGAATTGAGTCTTCTAATGTAATACAAAGTACA
CTATAAATCATCAGAGAAAGTGATAATCCGATTGATTTGAATTCCAAATC
GGCGTGGCTTGTCATTTTAATATAATTAATATGTTAAATAAACTTATGCA
TAAACAGCAGCTCGATAGTCAGGTAAAATACACAAATGACATCAAGTAAT
TATGAGAGATTAGGAGAAAATAATTTCATTCTTATAATAAATGATTTCGA
TATGTATAATAACGCACATTGTTACTATCTTTTATAACCATATTGTCGAA
ATTATTATTTACTGCAGGTAAGATGCTGCATTTCCTAATTTTGTGGTTTT
ACGGCATCAAACAACTGAAATAATCAAAACACAAATTACAGCTTTCATAC
ACTCGACAAAACTTATAAAATTAAATACGGTTAATTAGGTATTTCAGTGT
TGCCTTTTGTAGGTTAATTTTTGGAACGTCGTGTTTCATATCTTCAAGCA
AACTCAATTTCCGGCTAATATTGTGAAATAATGAAAACATTCTATTGGTC
GGTTTCCCTAGCAAATGAACGCGCATCTTCATATTTCCCGTTTAAAATGA
TTATGGTTGTTGTTGACTCTGAAATCCAATGATTATTTTATGGTTACCAA
CCACACCAAATGATTATAATCTCATTATATTATACCTTTCTTTGAGAAAT
TCGCATGTGATATTTTTCTGGTCTCTATTAATAAAAAAGTATTATACGCA
AGTTAAACTCATGAAAATATAATTTATAGATATATTGATTAATAAATATT
GTTAAAACATAATCATTAAATTATATAATGTAAATTTAGTGATCTTTTCA
CTGGAATAAGGGCTCCTGCTAAGGGATTGCTGCTATTCGGACCCCCGGGT
ACTGGAAAAACTCTTATAGGTTTGTATTGCTGTCAGTTTG
back to top

protein sequence of SMED30030135-orf-1

>SMED30030135-orf-1 ID=SMED30030135-orf-1|Name=SMED30030135-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=241bp
MNKENCSEEKLNVIRKEVFSCSYNNCYSSIENYFEIFDKPSKRYSNYADE
ILFNIKNLNNVSQTWKSGLNIDRMVDKIVNNKNSFHMSSPNTDFKVTNEI
KQKVLQFNFHPIEVKTQDYKETTTLNKIEKVNQILTSDDETPKKLYSFKT
FVNQKNNQNTGSLSFGSFEESKSKFELQNNDISASNFKDQKCGFNYKENF
SNETKIYSNKIFETQVCLFIINLYYRPCGTAVLLLLLIIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 217..239