RNA binding protein fox-1 homolog 1

Overview
NameRNA binding protein fox-1 homolog 1
Smed IDSMED30030133
Uniprot Best hitRNA binding protein fox-1 homolog 1 OS=Mus musculus OX=10090 GN=Rbfox1 PE=1 SV=3 (E=2.69615e-33)
Length (bp)1366
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA binding protein fox-1 homolog 1 (SMED30030133) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA binding protein fox-1 homolog 1 (SMED30030133) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA binding protein fox-1 homolog 1 (SMED30030133) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA binding protein fox-1 homolog 1 (SMED30030133) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030133

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030133SMESG000019470.1 SmedASXL_013763SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030133SMESG000019470.1 SmedASXL_013763SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30030133SMESG000019470.1 dd_Smed_v4_6567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030133SMESG000019470.1 dd_Smed_v4_6567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30030133SMESG000019470.1 dd_Smed_v4_6567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30030133SMESG000019470.1 dd_Smed_v4_6567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30030133SMESG000019470.1 dd_Smed_v4_6567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epitheliumSMED30030133SMESG000019470.1 dd_Smed_v4_6567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
ventral epidermis cellSMED30030133SMESG000019470.1 dd_Smed_v4_6567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Human
Match: RBFOX1 (RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Acc:HGNC:18222])

HSP 1 Score: 132.494 bits (332), Expect = 5.190e-35
Identity = 60/110 (54.55%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + ++K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   98 TDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 207          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Human
Match: RBFOX1 (RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Acc:HGNC:18222])

HSP 1 Score: 132.494 bits (332), Expect = 5.669e-35
Identity = 60/110 (54.55%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + ++K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   97 TDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 206          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Human
Match: RBFOX2 (RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Acc:HGNC:9906])

HSP 1 Score: 129.028 bits (323), Expect = 4.461e-34
Identity = 57/91 (62.64%), Postives = 75/91 (82.42%), Query Frame = 1
Query:  523 DSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKV 795
            +SK + KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK+
Sbjct:   85 ESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKM 175          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Human
Match: RBFOX2 (RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Acc:HGNC:9906])

HSP 1 Score: 129.028 bits (323), Expect = 4.461e-34
Identity = 57/91 (62.64%), Postives = 75/91 (82.42%), Query Frame = 1
Query:  523 DSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKV 795
            +SK + KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK+
Sbjct:   85 ESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKM 175          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Human
Match: RBFOX3 (RNA binding fox-1 homolog 3 [Source:HGNC Symbol;Acc:HGNC:27097])

HSP 1 Score: 130.568 bits (327), Expect = 7.511e-34
Identity = 60/100 (60.00%), Postives = 75/100 (75.00%), Query Frame = 1
Query:  514 SDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   45 SDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKTGNPYTN 144          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Celegans
Match: asd-1 (RNA-binding protein ASD-1 [Source:UniProtKB/TrEMBL;Acc:G5EEW7])

HSP 1 Score: 119.398 bits (298), Expect = 1.241e-29
Identity = 50/83 (60.24%), Postives = 66/83 (79.52%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK 789
            +R+H+SNIPF+YRE D+  + +  G ++DVEIIFNERGSKGFGFVT  NPDDA +AR + NG  +EGRR+E+N+AT R+  KK
Sbjct:   75 RRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKK 157          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Celegans
Match: fox-1 (Sex determination protein fox-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10572])

HSP 1 Score: 118.627 bits (296), Expect = 1.395e-29
Identity = 53/97 (54.64%), Postives = 73/97 (75.26%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK-KVENGVSNVRYPL 828
            KR+H+SNIPFR+R+ D++ + + +G + DVEIIFNERGSKGFGFVT   P DA +AR +L+G  +EGR+IE+N ATAR+ +KK K   G+ +   PL
Sbjct:   94 KRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNERGSKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNCATARVHSKKVKPTGGILDQMNPL 190          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Celegans
Match: asd-1 (RNA-binding protein ASD-1 [Source:UniProtKB/TrEMBL;Acc:G5EEW7])

HSP 1 Score: 119.398 bits (298), Expect = 1.910e-29
Identity = 50/83 (60.24%), Postives = 66/83 (79.52%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK 789
            +R+H+SNIPF+YRE D+  + +  G ++DVEIIFNERGSKGFGFVT  NPDDA +AR + NG  +EGRR+E+N+AT R+  KK
Sbjct:  100 RRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKK 182          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Celegans
Match: asd-1 (RNA-binding protein ASD-1 [Source:UniProtKB/TrEMBL;Acc:G5EEW7])

HSP 1 Score: 119.398 bits (298), Expect = 1.910e-29
Identity = 50/83 (60.24%), Postives = 66/83 (79.52%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK 789
            +R+H+SNIPF+YRE D+  + +  G ++DVEIIFNERGSKGFGFVT  NPDDA +AR + NG  +EGRR+E+N+AT R+  KK
Sbjct:  100 RRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKK 182          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Celegans
Match: fox-1 (Sex determination protein fox-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10572])

HSP 1 Score: 119.013 bits (297), Expect = 1.962e-29
Identity = 53/97 (54.64%), Postives = 73/97 (75.26%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK-KVENGVSNVRYPL 828
            KR+H+SNIPFR+R+ D++ + + +G + DVEIIFNERGSKGFGFVT   P DA +AR +L+G  +EGR+IE+N ATAR+ +KK K   G+ +   PL
Sbjct:  153 KRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNERGSKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNCATARVHSKKVKPTGGILDQMNPL 249          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0473371)

HSP 1 Score: 129.798 bits (325), Expect = 4.140e-32
Identity = 63/119 (52.94%), Postives = 81/119 (68.07%), Query Frame = 1
Query:  520 IDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPL 876
            +D+K   KR+H+SNIPFR+R+ D+R +   +G +LDVEIIFNERGSKGFGFVTFAN +DA +AR+ L+G  VEGR+IE+N ATAR+  KK     V NV     +   LP      WP 
Sbjct:  370 LDAKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKV--TAVPNVCVQWPEGYRLPV---AAWPF 483          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0332985)

HSP 1 Score: 128.642 bits (322), Expect = 5.642e-32
Identity = 56/90 (62.22%), Postives = 73/90 (81.11%), Query Frame = 1
Query:  520 IDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK 789
            +D+K   KR+H+SNIPFR+R+ D+R +   +G +LDVEIIFNERGSKGFGFVTFAN +DA +AR+ L+G  VEGR+IE+N ATAR+  KK
Sbjct:  211 LDAKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKK 300          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0113419)

HSP 1 Score: 129.413 bits (324), Expect = 7.619e-32
Identity = 56/90 (62.22%), Postives = 73/90 (81.11%), Query Frame = 1
Query:  520 IDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK 789
            +D+K   KR+H+SNIPFR+R+ D+R +   +G +LDVEIIFNERGSKGFGFVTFAN +DA +AR+ L+G  VEGR+IE+N ATAR+  KK
Sbjct:  370 LDAKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKK 459          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0305096)

HSP 1 Score: 129.413 bits (324), Expect = 9.165e-32
Identity = 56/90 (62.22%), Postives = 73/90 (81.11%), Query Frame = 1
Query:  520 IDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK 789
            +D+K   KR+H+SNIPFR+R+ D+R +   +G +LDVEIIFNERGSKGFGFVTFAN +DA +AR+ L+G  VEGR+IE+N ATAR+  KK
Sbjct:  436 LDAKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKK 525          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0305095)

HSP 1 Score: 129.413 bits (324), Expect = 9.289e-32
Identity = 56/90 (62.22%), Postives = 73/90 (81.11%), Query Frame = 1
Query:  520 IDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKK 789
            +D+K   KR+H+SNIPFR+R+ D+R +   +G +LDVEIIFNERGSKGFGFVTFAN +DA +AR+ L+G  VEGR+IE+N ATAR+  KK
Sbjct:  436 LDAKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKK 525          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Zebrafish
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 130.568 bits (327), Expect = 3.538e-35
Identity = 62/111 (55.86%), Postives = 81/111 (72.97%), Query Frame = 1
Query:  487 DLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVR 819
            D+ Q  +  S+   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N +
Sbjct:   90 DVTQTDVLISESTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVVNPYTNSK 200          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Zebrafish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 131.724 bits (330), Expect = 2.499e-34
Identity = 61/100 (61.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:  514 SDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  103 SDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 202          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Zebrafish
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 130.954 bits (328), Expect = 3.324e-34
Identity = 62/109 (56.88%), Postives = 80/109 (73.39%), Query Frame = 1
Query:  487 DLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            D+ Q  +  S+   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:   73 DVTQTDVLISESTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVVNPYTN 181          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Zebrafish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 132.109 bits (331), Expect = 4.337e-34
Identity = 61/100 (61.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:  514 SDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  144 SDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 243          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Zebrafish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 131.724 bits (330), Expect = 6.823e-34
Identity = 61/100 (61.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:  514 SDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  150 SDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 249          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Xenopus
Match: lsm12 (LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031])

HSP 1 Score: 134.806 bits (338), Expect = 6.998e-35
Identity = 61/110 (55.45%), Postives = 81/110 (73.64%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D  Q   P+ + ++K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   87 TDGQQQTQPSENTENKTQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTLNPYTN 196          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Xenopus
Match: lsm12 (LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031])

HSP 1 Score: 134.42 bits (337), Expect = 7.281e-35
Identity = 61/110 (55.45%), Postives = 81/110 (73.64%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D  Q   P+ + ++K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   78 TDGQQQTQPSENTENKTQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTLNPYTN 187          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Xenopus
Match: lsm12 (LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031])

HSP 1 Score: 134.42 bits (337), Expect = 7.409e-35
Identity = 61/110 (55.45%), Postives = 81/110 (73.64%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D  Q   P+ + ++K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:  100 TDGQQQTQPSENTENKTQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTLNPYTN 209          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Xenopus
Match: yaf2 (YY1 associated factor 2 [Source:Xenbase;Acc:XB-GENE-949941])

HSP 1 Score: 125.561 bits (314), Expect = 3.563e-32
Identity = 58/95 (61.05%), Postives = 73/95 (76.84%), Query Frame = 1
Query:  529 KISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   94 KQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSMDADRAREKLNGTIVEGRKIEVNNATARVMTNKKPVNPYTN 188          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Xenopus
Match: yaf2 (YY1 associated factor 2 [Source:Xenbase;Acc:XB-GENE-949941])

HSP 1 Score: 125.946 bits (315), Expect = 7.456e-32
Identity = 58/95 (61.05%), Postives = 73/95 (76.84%), Query Frame = 1
Query:  529 KISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:  139 KQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSMDADRAREKLNGTIVEGRKIEVNNATARVMTNKKPVNPYTN 233          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Mouse
Match: Rbfox1 (RNA binding protein, fox-1 homolog (C. elegans) 1 [Source:MGI Symbol;Acc:MGI:1926224])

HSP 1 Score: 133.65 bits (335), Expect = 2.594e-35
Identity = 61/110 (55.45%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + +SK   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   97 TDGQPQTQPSENTESKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 206          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Mouse
Match: Rbfox1 (RNA binding protein, fox-1 homolog (C. elegans) 1 [Source:MGI Symbol;Acc:MGI:1926224])

HSP 1 Score: 133.265 bits (334), Expect = 1.325e-34
Identity = 61/110 (55.45%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + +SK   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   77 TDGQPQTQPSENTESKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 186          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Mouse
Match: Rbfox1 (RNA binding protein, fox-1 homolog (C. elegans) 1 [Source:MGI Symbol;Acc:MGI:1926224])

HSP 1 Score: 133.65 bits (335), Expect = 3.150e-34
Identity = 61/110 (55.45%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + +SK   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:  117 TDGQPQTQPSENTESKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 226          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Mouse
Match: Rbfox1 (RNA binding protein, fox-1 homolog (C. elegans) 1 [Source:MGI Symbol;Acc:MGI:1926224])

HSP 1 Score: 133.265 bits (334), Expect = 3.383e-34
Identity = 61/110 (55.45%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + +SK   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   97 TDGQPQTQPSENTESKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 206          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Mouse
Match: Rbfox3 (RNA binding protein, fox-1 homolog (C. elegans) 3 [Source:MGI Symbol;Acc:MGI:106368])

HSP 1 Score: 130.954 bits (328), Expect = 3.796e-34
Identity = 63/107 (58.88%), Postives = 79/107 (73.83%), Query Frame = 1
Query:  493 NQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            NQ + P SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   84 NQQLHP-SDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKPGNPYAN 189          
BLAST of RNA binding protein fox-1 homolog 1 vs. UniProt
Match: sp|Q9JJ43|RFOX1_MOUSE (RNA binding protein fox-1 homolog 1 OS=Mus musculus OX=10090 GN=Rbfox1 PE=1 SV=3)

HSP 1 Score: 132.88 bits (333), Expect = 2.696e-33
Identity = 61/110 (55.45%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + +SK   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   97 TDGQPQTQPSENTESKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 206          
BLAST of RNA binding protein fox-1 homolog 1 vs. UniProt
Match: sp|A6NFN3|RFOX3_HUMAN (RNA binding protein fox-1 homolog 3 OS=Homo sapiens OX=9606 GN=RBFOX3 PE=2 SV=4)

HSP 1 Score: 130.568 bits (327), Expect = 4.453e-33
Identity = 60/100 (60.00%), Postives = 75/100 (75.00%), Query Frame = 1
Query:  514 SDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   90 SDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKTGNPYTN 189          
BLAST of RNA binding protein fox-1 homolog 1 vs. UniProt
Match: sp|Q8BIF2|RFOX3_MOUSE (RNA binding protein fox-1 homolog 3 OS=Mus musculus OX=10090 GN=Rbfox3 PE=1 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 4.840e-33
Identity = 63/107 (58.88%), Postives = 79/107 (73.83%), Query Frame = 1
Query:  493 NQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            NQ + P SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   84 NQQLHP-SDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKPGNPYAN 189          
BLAST of RNA binding protein fox-1 homolog 1 vs. UniProt
Match: sp|Q95KI0|RFOX1_MACFA (RNA binding protein fox-1 homolog 1 OS=Macaca fascicularis OX=9541 GN=RBFOX1 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 5.606e-33
Identity = 60/110 (54.55%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + ++K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:  100 TDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 209          
BLAST of RNA binding protein fox-1 homolog 1 vs. UniProt
Match: sp|Q5NVN8|RFOX1_PONAB (RNA binding protein fox-1 homolog 1 OS=Pongo abelii OX=9601 GN=RBFOX1 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 5.646e-33
Identity = 60/110 (54.55%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  484 VDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
             D      P+ + ++K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:   98 TDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTN 207          
BLAST of RNA binding protein fox-1 homolog 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19277138 (tr|A0A564ZE62|A0A564ZE62_HYMDI RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14780 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.424e-35
Identity = 65/86 (75.58%), Postives = 75/86 (87.21%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVE 798
            KR+H+SNIPFRYRE D+RQLL P+G +LDVEIIFNERGSKGFGFVTFA P++A KAR+ LNG  VEGR+IEIN ATAR+M KKK E
Sbjct:  198 KRLHVSNIPFRYREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARESLNGTIVEGRKIEINNATARVMTKKKSE 283          
BLAST of RNA binding protein fox-1 homolog 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19276184 (tr|A0A564ZEY3|A0A564ZEY3_HYMDI RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14780 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.769e-35
Identity = 65/86 (75.58%), Postives = 75/86 (87.21%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVE 798
            KR+H+SNIPFRYRE D+RQLL P+G +LDVEIIFNERGSKGFGFVTFA P++A KAR+ LNG  VEGR+IEIN ATAR+M KKK E
Sbjct:  210 KRLHVSNIPFRYREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARESLNGTIVEGRKIEINNATARVMTKKKSE 295          
BLAST of RNA binding protein fox-1 homolog 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19095431 (tr|W6UMG1|W6UMG1_ECHGR Fox-1 C OS=Echinococcus granulosus OX=6210 GN=EGR_05801 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.465e-35
Identity = 64/86 (74.42%), Postives = 76/86 (88.37%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVE 798
            KR+H+SNIPFR+RE D+RQLL P+G +LDVEIIFNERGSKGFGFVTFA P++A KAR++LNG  VEGR+IEIN ATAR+M KKK E
Sbjct:   60 KRLHVSNIPFRFREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARENLNGTVVEGRKIEINNATARVMTKKKSE 145          
BLAST of RNA binding protein fox-1 homolog 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15783626 (tr|A0A158QBS1|A0A158QBS1_HYMDI RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS401 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 5.943e-35
Identity = 65/86 (75.58%), Postives = 75/86 (87.21%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVE 798
            KR+H+SNIPFRYRE D+RQLL P+G +LDVEIIFNERGSKGFGFVTFA P++A KAR+ LNG  VEGR+IEIN ATAR+M KKK E
Sbjct:  292 KRLHVSNIPFRYREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARESLNGTIVEGRKIEINNATARVMTKKKSE 377          
BLAST of RNA binding protein fox-1 homolog 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|17414434 (tr|A0A3P6QUU1|A0A3P6QUU1_TAEAS RRM domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9634 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 8.053e-35
Identity = 64/86 (74.42%), Postives = 76/86 (88.37%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVE 798
            KR+H+SNIPFR+RE D+RQLL P+G +LDVEIIFNERGSKGFGFVTFA P++A KAR++LNG  VEGR+IEIN ATAR+M KKK E
Sbjct:   69 KRLHVSNIPFRFREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARENLNGTVVEGRKIEINNATARVMTKKKSE 154          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Cavefish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 134.806 bits (338), Expect = 3.390e-35
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 1
Query:  457 MDKAKSLNIVDLNQDV-LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNV 816
            + +A  +   D +Q + L  SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +NV
Sbjct:  130 IPQADEVAQTDASQQLQLQPSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTNV 250          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Cavefish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 132.88 bits (333), Expect = 9.054e-35
Identity = 65/120 (54.17%), Postives = 85/120 (70.83%), Query Frame = 1
Query:  457 MDKAKSLNIVDLNQDV-LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            + +A  +   D +Q + L  SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:   88 IPQADEVAQTDASQQLQLQPSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 207          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Cavefish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 133.65 bits (335), Expect = 1.210e-34
Identity = 65/120 (54.17%), Postives = 85/120 (70.83%), Query Frame = 1
Query:  457 MDKAKSLNIVDLNQDV-LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            + +A  +   D +Q + L  SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  125 IPQADEVAQTDASQQLQLQPSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 244          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Cavefish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 133.65 bits (335), Expect = 1.223e-34
Identity = 65/120 (54.17%), Postives = 85/120 (70.83%), Query Frame = 1
Query:  457 MDKAKSLNIVDLNQDV-LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            + +A  +   D +Q + L  SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  125 IPQADEVAQTDASQQLQLQPSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 244          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Cavefish
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 132.494 bits (332), Expect = 1.735e-34
Identity = 62/106 (58.49%), Postives = 78/106 (73.58%), Query Frame = 1
Query:  496 QDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            Q  L +SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:  124 QLTLQSSDSPEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKAANPYTN 229          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Sea Lamprey
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 61.2326 bits (147), Expect = 3.382e-11
Identity = 30/52 (57.69%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  658 KGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            +GFGFVTF N  DA +AR+ L+G  VEGR+IE+N ATAR+M  KK  N  +N
Sbjct:    2 QGFGFVTFENSADADRAREKLHGTMVEGRKIEVNNATARVMTNKKAVNPYAN 53          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 55.0694 bits (131), Expect = 1.783e-8
Identity = 25/74 (33.78%), Postives = 51/74 (68.92%), Query Frame = 1
Query:  544 RMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFN-ERG-SKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEIN 759
            R+++ ++ F   E  +  + +P+G++ +++++ + E G SKGFGF+TF++ D A KA + LNG ++ GR +++N
Sbjct:  273 RLYVGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKVN 346          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 53.9138 bits (128), Expect = 3.087e-8
Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 1
Query:  580 ETDVRQLLKPYGQLLDVEIIFNERG---SKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVAT 768
            E  +  +   YG++ +V +I  +R    S+GF FVTFANPDDA  A  D+NGK ++GR I++  AT
Sbjct:   20 ENALETIFSKYGRVAEV-LIMKDRETNRSRGFAFVTFANPDDAKGAERDMNGKPLDGRNIKVEQAT 84          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 52.373 bits (124), Expect = 1.186e-7
Identity = 35/91 (38.46%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  610 YGQLLDVEIIFNERG---SKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQA----MLPTNNH 861
            YG++ DV ++  +R    S+GF FVTFANP+DA +A  D NGK +EGR + ++ AT     K   E+     RY  S+       +PT N 
Sbjct:   30 YGRVADV-LLMKDRETNLSRGFAFVTFANPEDAKEAERDANGKVLEGRAMRVDQAT-----KPSFESFPGGGRYGFSRGPPRVCGVPTTNR 114          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 51.2174 bits (121), Expect = 3.356e-7
Identity = 23/79 (29.11%), Postives = 50/79 (63.29%), Query Frame = 1
Query:  544 RMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERG--SKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATAR 774
            R+++ ++ F   E  ++ + +P+G++ + +++ +     S+G+GFVTFA+ + A KA + LNG ++ GR +++   T R
Sbjct:  260 RLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVGHVTER 338          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Yeast
Match: MRD1 (Essential conserved small ribosomal subunit (40s) synthesis factor; component of the 90S preribosome; required for production of 18S rRNA and small ribosomal subunit; contains five consensus RNA-binding domains and binds to the pre-rRNA at two sites within the 18S region [Source:SGD;Acc:S000006316])

HSP 1 Score: 47.3654 bits (111), Expect = 3.809e-6
Identity = 27/81 (33.33%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  511 NSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFN-ERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRI 750
            N+   S   S ++ + N+PF     DV +L   +GQL  V +    ++ ++GF FV F  P +A  A D L+G  + GRR+
Sbjct:  753 NTKTKSNKKSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833          

HSP 2 Score: 46.2098 bits (108), Expect = 7.933e-6
Identity = 24/73 (32.88%), Postives = 42/73 (57.53%), Query Frame = 1
Query:  544 RMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERG--SKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEI 756
            R+ + NI +  +E D R+L  P+G+L +V +  + R   SKGF +V F +  +A  A  +L+ +  +GR + I
Sbjct:  346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 45.8246 bits (107), Expect = 9.010e-6
Identity = 22/64 (34.38%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  589 VRQLLKPYGQLLDVEIIFNER--GSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATAR 774
            +R   K +   L   ++++ +   S+G+GFV+F + DDA  A D + G+D+ GR + IN A  R
Sbjct:  178 LRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKR 241          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Nematostella
Match: EDO44890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE7])

HSP 1 Score: 97.8265 bits (242), Expect = 3.728e-25
Identity = 42/72 (58.33%), Postives = 58/72 (80.56%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEI 756
            KR+H++NIPFR+R+ D+RQ+   +G + DVEII+NERGSKGFGFVTF    +A KAR+ LNG  V+GR++E+
Sbjct:   10 KRLHVTNIPFRFRDNDLRQMFGSFGVIADVEIIYNERGSKGFGFVTFNTAAEANKAREKLNGTIVDGRKVEV 81          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Nematostella
Match: EDO29715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2V2])

HSP 1 Score: 60.077 bits (144), Expect = 1.153e-11
Identity = 33/72 (45.83%), Postives = 43/72 (59.72%), Query Frame = 1
Query:  553 ISNIPFRYRETDVRQLLKPYGQLLDVEII---FNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEIN 759
            + ++PF   E D+R   + YG +  V+II   F  R SKGFGFV   N  +A KA D+LNG  VEGR I +N
Sbjct:    5 VGSLPFSIEEADLRGFFEEYGAVDSVKIISDKFTGR-SKGFGFVEMPNDAEAQKAIDELNGGTVEGRTIVVN 75          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Nematostella
Match: EDO35153 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMA7])

HSP 1 Score: 55.8398 bits (133), Expect = 6.632e-9
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  544 RMHISNIPFRYRETDVRQLLKPYG-QLLDVEIIFNERG---------SKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEI 756
            +++  N+PF+  + +++ + +     + DV I+   R          S+GFGFVTFANP+DA  A + LNGK+V+GR ++I
Sbjct:   13 KVYAGNLPFKLTQDELKAVFEAESLTVTDVVIMKEPRNEFYQQQEPRSRGFGFVTFANPEDAQTAVNSLNGKEVQGRTLKI 93          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Nematostella
Match: EDO27598 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8T6])

HSP 1 Score: 54.6842 bits (130), Expect = 7.344e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  544 RMHISNIPFRYRETDVRQLLKPYG-QLLDVEIIFNERG---------SKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEI 756
            +++  N+PF+  + +++ + +     + DV I+   R          S+GFGFVTFANP+DA  A   LNGK+V+GR ++I
Sbjct:    8 KVYAGNLPFKLTQDELKAVFEAESLTVTDVLIVKEPRNEFYQQQEPRSRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 88          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Nematostella
Match: EDO39290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ5])

HSP 1 Score: 53.9138 bits (128), Expect = 1.734e-8
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 1
Query:  544 RMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATAR 774
            R+ +  +P   RE+DV + L+ YG++ D+ +       +G+GFV F +  DA  A  DLNG+D+ G R+ +  +  R
Sbjct:    3 RIFLGRLPRDVRESDVEKFLRGYGKIRDISL------KRGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSKGR 73          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Medaka
Match: rbfox3b (RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:101159826])

HSP 1 Score: 134.035 bits (336), Expect = 8.567e-34
Identity = 62/103 (60.19%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  505 LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            L +SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  318 LQHSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 420          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Medaka
Match: rbfox3b (RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:101159826])

HSP 1 Score: 132.88 bits (333), Expect = 9.009e-34
Identity = 62/103 (60.19%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  505 LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            L +SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  236 LQHSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 338          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Medaka
Match: rbfox3b (RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:101159826])

HSP 1 Score: 134.035 bits (336), Expect = 9.825e-34
Identity = 62/103 (60.19%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  505 LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            L +SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  318 LQHSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 420          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Medaka
Match: rbfox3b (RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:101159826])

HSP 1 Score: 133.65 bits (335), Expect = 9.986e-34
Identity = 62/103 (60.19%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  505 LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            L +SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  299 LQHSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 401          
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Medaka
Match: rbfox3b (RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:101159826])

HSP 1 Score: 132.88 bits (333), Expect = 1.132e-33
Identity = 62/103 (60.19%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  505 LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSN 813
            L +SD   K   KR+H+SNIPFR+R+ D+RQ+   +G++LDVEIIFNERGSKGFGFVTF    DA +AR+ LNG  VEGR+IE+N ATAR+M  KKV N  +N
Sbjct:  253 LQHSDSSEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKVANPYTN 355          
BLAST of RNA binding protein fox-1 homolog 1 vs. Planmine SMEST
Match: SMESG000019470.1 (SMESG000019470.1)

HSP 1 Score: 494.967 bits (1273), Expect = 1.888e-176
Identity = 271/272 (99.63%), Postives = 272/272 (100.00%), Query Frame = 1
Query:  457 MDKAKSLNIVDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHXXXXXXXXXXXXXXXXXXXXXXXXXXGLNQNIFNNFQLSLSNRLLAVNALQMGTDYSNLAYLQNIQALANGCHNQPNIHLFSQIPVSYNSLTKSNPLVHHPNLISTQRFAPY 1272
            MDKAKSLNIVDLNQDVLPNSDIDSKISSKRMHISNIPFRYRE+DVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHSNNLILNSNLCNPSNLLMPLNSLSTSGLNQNIFNNFQLSLSNRLLAVNALQMGTDYSNLAYLQNIQALANGCHNQPNIHLFSQIPVSYNSLTKSNPLVHHPNLISTQRFAPY
Sbjct:    1 MDKAKSLNIVDLNQDVLPNSDIDSKISSKRMHISNIPFRYRESDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHSNNLILNSNLCNPSNLLMPLNSLSTSGLNQNIFNNFQLSLSNRLLAVNALQMGTDYSNLAYLQNIQALANGCHNQPNIHLFSQIPVSYNSLTKSNPLVHHPNLISTQRFAPY 272          
BLAST of RNA binding protein fox-1 homolog 1 vs. Planmine SMEST
Match: SMESG000019470.1 (SMESG000019470.1)

HSP 1 Score: 489.189 bits (1258), Expect = 4.089e-174
Identity = 271/277 (97.83%), Postives = 272/277 (98.19%), Query Frame = 1
Query:  457 MDKAKSLNIVDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSK-----GFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHXXXXXXXXXXXXXXXXXXXXXXXXXXGLNQNIFNNFQLSLSNRLLAVNALQMGTDYSNLAYLQNIQALANGCHNQPNIHLFSQIPVSYNSLTKSNPLVHHPNLISTQRFAPY 1272
            MDKAKSLNIVDLNQDVLPNSDIDSKISSKRMHISNIPFRYRE+DVRQLLKPYGQLLDVEIIFNERGSK     GFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHSNNLILNSNLCNPSNLLMPLNSLSTSGLNQNIFNNFQLSLSNRLLAVNALQMGTDYSNLAYLQNIQALANGCHNQPNIHLFSQIPVSYNSLTKSNPLVHHPNLISTQRFAPY
Sbjct:    1 MDKAKSLNIVDLNQDVLPNSDIDSKISSKRMHISNIPFRYRESDVRQLLKPYGQLLDVEIIFNERGSKNFSGTGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHSNNLILNSNLCNPSNLLMPLNSLSTSGLNQNIFNNFQLSLSNRLLAVNALQMGTDYSNLAYLQNIQALANGCHNQPNIHLFSQIPVSYNSLTKSNPLVHHPNLISTQRFAPY 277          
BLAST of RNA binding protein fox-1 homolog 1 vs. Planmine SMEST
Match: SMESG000033763.1 (SMESG000033763.1)

HSP 1 Score: 140.584 bits (353), Expect = 2.162e-37
Identity = 61/86 (70.93%), Postives = 73/86 (84.88%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVE 798
            KR+H+SNIPFR+RE D+R LL P+G ++DVEIIFNERGSKGFGFVTFAN  DA +AR+ LNG  VEGR+IE+N ATAR+M KKK E
Sbjct:  102 KRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAE 187          
BLAST of RNA binding protein fox-1 homolog 1 vs. Planmine SMEST
Match: SMESG000033763.1 (SMESG000033763.1)

HSP 1 Score: 119.013 bits (297), Expect = 1.650e-28
Identity = 51/71 (71.83%), Postives = 61/71 (85.92%), Query Frame = 1
Query:  541 KRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIE 753
            KR+H+SNIPFR+RE D+R LL P+G ++DVEIIFNERGSKGFGFVTFAN  DA +AR+ LNG  VEGR+IE
Sbjct:   97 KRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIE 167          
BLAST of RNA binding protein fox-1 homolog 1 vs. Planmine SMEST
Match: SMESG000022369.1 (SMESG000022369.1)

HSP 1 Score: 52.373 bits (124), Expect = 9.493e-8
Identity = 28/89 (31.46%), Postives = 54/89 (60.67%), Query Frame = 1
Query:  505 LPNSDIDSKISSKRMHISNIPFRYRETDVRQLLKPYGQLLDVEIIFNE--RGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVA 765
            +   D D+ + SK + I N+     E D+ ++   YG++ DV ++ ++  + S+GFGFV F N DDA  A++ ++G  V+G++I ++ +
Sbjct:    6 IDKEDRDNPLPSKCLGIFNLSLETTEKDLHEMFFRYGEIEDVSLVIDKVTKRSRGFGFVYFKNIDDAEIAKEKVHGTIVQGKQIRVDYS 94          
The following BLAST results are available for this feature:
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBFOX15.190e-3554.55RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Ac... [more]
RBFOX15.669e-3554.55RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Ac... [more]
RBFOX24.461e-3462.64RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Ac... [more]
RBFOX24.461e-3462.64RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Ac... [more]
RBFOX37.511e-3460.00RNA binding fox-1 homolog 3 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asd-11.241e-2960.24RNA-binding protein ASD-1 [Source:UniProtKB/TrEMB... [more]
fox-11.395e-2954.64Sex determination protein fox-1 [Source:UniProtKB... [more]
asd-11.910e-2960.24RNA-binding protein ASD-1 [Source:UniProtKB/TrEMB... [more]
asd-11.910e-2960.24RNA-binding protein ASD-1 [Source:UniProtKB/TrEMB... [more]
fox-11.962e-2954.64Sex determination protein fox-1 [Source:UniProtKB... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbfox14.140e-3252.94gene:FBgn0052062 transcript:FBtr0473371[more]
Rbfox15.642e-3262.22gene:FBgn0052062 transcript:FBtr0332985[more]
Rbfox17.619e-3262.22gene:FBgn0052062 transcript:FBtr0113419[more]
Rbfox19.165e-3262.22gene:FBgn0052062 transcript:FBtr0305096[more]
Rbfox19.289e-3262.22gene:FBgn0052062 transcript:FBtr0305095[more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox3b3.538e-3555.86RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a2.499e-3461.00RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
rbfox3b3.324e-3456.88RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a4.337e-3461.00RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a6.823e-3461.00RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm126.998e-3555.45LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031][more]
lsm127.281e-3555.45LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031][more]
lsm127.409e-3555.45LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031][more]
yaf23.563e-3261.05YY1 associated factor 2 [Source:Xenbase;Acc:XB-GEN... [more]
yaf27.456e-3261.05YY1 associated factor 2 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbfox12.594e-3555.45RNA binding protein, fox-1 homolog (C. elegans) 1 ... [more]
Rbfox11.325e-3455.45RNA binding protein, fox-1 homolog (C. elegans) 1 ... [more]
Rbfox13.150e-3455.45RNA binding protein, fox-1 homolog (C. elegans) 1 ... [more]
Rbfox13.383e-3455.45RNA binding protein, fox-1 homolog (C. elegans) 1 ... [more]
Rbfox33.796e-3458.88RNA binding protein, fox-1 homolog (C. elegans) 3 ... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JJ43|RFOX1_MOUSE2.696e-3355.45RNA binding protein fox-1 homolog 1 OS=Mus musculu... [more]
sp|A6NFN3|RFOX3_HUMAN4.453e-3360.00RNA binding protein fox-1 homolog 3 OS=Homo sapien... [more]
sp|Q8BIF2|RFOX3_MOUSE4.840e-3358.88RNA binding protein fox-1 homolog 3 OS=Mus musculu... [more]
sp|Q95KI0|RFOX1_MACFA5.606e-3354.55RNA binding protein fox-1 homolog 1 OS=Macaca fasc... [more]
sp|Q5NVN8|RFOX1_PONAB5.646e-3354.55RNA binding protein fox-1 homolog 1 OS=Pongo abeli... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|192771381.424e-3575.58tr|A0A564ZE62|A0A564ZE62_HYMDI RRM domain-containi... [more]
gnl|BL_ORD_ID|192761841.769e-3575.58tr|A0A564ZEY3|A0A564ZEY3_HYMDI RRM domain-containi... [more]
gnl|BL_ORD_ID|190954312.465e-3574.42tr|W6UMG1|W6UMG1_ECHGR Fox-1 C OS=Echinococcus gra... [more]
gnl|BL_ORD_ID|157836265.943e-3575.58tr|A0A158QBS1|A0A158QBS1_HYMDI RRM domain-containi... [more]
gnl|BL_ORD_ID|174144348.053e-3574.42tr|A0A3P6QUU1|A0A3P6QUU1_TAEAS RRM domain-containi... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox3a3.390e-3554.55RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a9.054e-3554.17RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a1.210e-3454.17RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a1.223e-3454.17RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
rbfox3b1.735e-3458.49RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox3b3.382e-1157.69RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
RBM391.783e-833.78RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
rbmx3.087e-843.94RNA binding motif protein X-linked [Source:NCBI ge... [more]
rbmx1.186e-738.46RNA binding motif protein X-linked [Source:NCBI ge... [more]
RBM393.356e-729.11RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MRD13.809e-633.33Essential conserved small ribosomal subunit (40s) ... [more]
PUB19.010e-634.38Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448903.728e-2558.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297151.153e-1145.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351536.632e-935.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275987.344e-935.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392901.734e-833.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox3b8.567e-3460.19RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:... [more]
rbfox3b9.009e-3460.19RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:... [more]
rbfox3b9.825e-3460.19RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:... [more]
rbfox3b9.986e-3460.19RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:... [more]
rbfox3b1.132e-3360.19RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of RNA binding protein fox-1 homolog 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019470.11.888e-17699.63SMESG000019470.1[more]
SMESG000019470.14.089e-17497.83SMESG000019470.1[more]
SMESG000033763.12.162e-3770.93SMESG000033763.1[more]
SMESG000033763.11.650e-2871.83SMESG000033763.1[more]
SMESG000022369.19.493e-831.46SMESG000022369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030133 ID=SMED30030133|Name=RNA binding protein fox-1 homolog 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1366bp
AAGACTATCTATATCAAATAACCAGTTTGATTTTGAAATGGTTTCACTCA
AATTGTTCAGTTTGTAGACAGCTTGTTCGAAATATTATCACAGCGTCGCA
GCCTCACATGATACAAATCGAACAAAGACCAGTAGTCGCATATGATTAAT
GCTTTTAATTGTCATTAGTCACGATTTATACTAAATTGGAATTTGTTTCA
ATCGCTGACACGCGCACACACTCACTGGAAATTTTCTGCCTTCTCAAATC
GAAATGCACACAAACACGATGCACACCAATTGAAATCAACACTTCCTGAA
AGCCCATTGCCTGTTTTATTTTTACATTTTCATTAGTCGATTTTCTAAAA
CTTACTTGCATTCATTCTCATTCTCAACAGTGAATTGTTGAATATATCTC
GAAAATAATTTTCTGGGAATTTTAACATTTATCAGTTAATTGTATGATAC
CTAGTTATGGATAAAGCGAAATCTTTGAATATTGTTGATTTAAATCAAGA
CGTTCTTCCAAATTCTGACATCGATTCAAAAATATCTTCGAAAAGAATGC
ATATTTCAAATATCCCCTTTCGTTATAGAGAAACTGATGTACGACAACTG
TTAAAGCCTTATGGACAATTGCTGGACGTCGAAATAATTTTTAATGAACG
AGGATCTAAGGGATTTGGATTCGTAACTTTTGCAAATCCAGATGATGCTG
CAAAAGCTAGAGATGACCTAAATGGAAAAGATGTTGAAGGACGCCGAATT
GAAATTAACGTAGCAACAGCAAGAATGATGGCAAAGAAAAAAGTTGAAAA
TGGAGTATCCAATGTCAGATATCCATTAAGCCAACAAGCTATGCTCCCTA
CAAATAATCACAATGTTTGGCCTCTTTCTTCCAGTGTTCCACTTGTAACG
AACTCATTATGCATTGGGGCACAAAACACAATGCATTCCAACAATCTGAT
TCTGAATTCCAACCTTTGTAATCCTTCAAATCTCTTGATGCCACTAAACA
GCTTGTCTACCAGTGGTCTCAATCAGAATATATTTAATAACTTTCAGCTA
TCTTTATCAAATAGACTTTTAGCTGTCAATGCTCTTCAAATGGGAACCGA
TTATTCAAATTTGGCGTATTTACAAAATATTCAAGCCTTAGCAAACGGTT
GTCACAATCAGCCTAATATACACTTATTCTCGCAGATTCCAGTCAGTTAT
AATTCTCTAACTAAATCAAATCCTCTCGTCCATCATCCCAATCTAATAAG
CACTCAAAGGTTTGCACCGTATTGAATTTGAAAATAATTTTTATGTAAAT
ATAATGCATTTTTATTTGTTAATGTTATATGGAAATTGTATATTTTGAAT
TAATTTCGTTTATAAA
back to top

protein sequence of SMED30030133-orf-1

>SMED30030133-orf-1 ID=SMED30030133-orf-1|Name=SMED30030133-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=273bp
MDKAKSLNIVDLNQDVLPNSDIDSKISSKRMHISNIPFRYRETDVRQLLK
PYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEI
NVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNS
LCIGAQNTMHSNNLILNSNLCNPSNLLMPLNSLSTSGLNQNIFNNFQLSL
SNRLLAVNALQMGTDYSNLAYLQNIQALANGCHNQPNIHLFSQIPVSYNS
LTKSNPLVHHPNLISTQRFAPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0043484regulation of RNA splicing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0002023ciliated epithelium
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003101ventral epidermis cell
Vocabulary: INTERPRO
TermDefinition
IPR034237FOX1_RRM
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 30..101
e-value: 3.4E-21
score: 86.4
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 33..98
e-value: 4.2E-18
score: 64.9
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 29..105
score: 17.796
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 20..120
e-value: 3.6E-24
score: 86.9
NoneNo IPR availablePANTHERPTHR15597ATAXIN 2-BINDING PROTEIN 1-RELATEDcoord: 15..139
IPR034237FOX1, RNA recognition motifCDDcd12407RRM_FOX1_likecoord: 29..104
e-value: 2.54434E-45
score: 145.243
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 18..110