SMED30030128

Overview
NameSMED30030128
Smed IDSMED30030128
Length (bp)1544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30030128 (SMED30030128) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30030128 (SMED30030128) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030128 (SMED30030128) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030128 (SMED30030128) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030128

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030128SMESG000017016.1 dd_Smed_v4_933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30030128SMESG000017016.1 dd_Smed_v4_933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030128SMESG000017016.1 dd_Smed_v4_933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
oocyteSMED30030128SMESG000017016.1 Contig172GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30030128SMESG000017016.1 Contig172GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030128 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003234:35045..38624 +7532
Homology
BLAST of SMED30030128 vs. Ensembl Fly
Match: Lsd-2 (gene:FBgn0030608 transcript:FBtr0110968)

HSP 1 Score: 54.299 bits (129), Expect = 1.321e-7
Identity = 59/223 (26.46%), Postives = 95/223 (42.60%), Query Frame = 2
Query:  329 HFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAV---RNLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELLDKYFPDNEQCAEE-----PISNTDIMTKIK---RLSGKTQKRLYRRASEQINLLLKA 964
            H +SL+R+   P+VN +       Y  +K  N + +  LT AE  +     TA P      R + ++D  +V  ++KLE K PII ++   I N       D ++   + ++          +    +A    + V+AT       S  +  V T   L   + LL+ YFP  E   EE     P S   ++  ++   RLS K  +R+YR  S QI  + K 
Sbjct:   36 HLESLERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCVTRAVTTAAPFVTKLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVIDVVQPHLERVVKFKAAGQQKAASLKDLAWQKANEVLATQYG----SLAVNGVDTTTAL--AERLLEYYFPKCESDVEEDNVPVPASEDPVLHTVQTVGRLSNKISRRVYRNVSRQIKQVQKG 252          
BLAST of SMED30030128 vs. Ensembl Fly
Match: Lsd-1 (gene:FBgn0039114 transcript:FBtr0084456)

HSP 1 Score: 50.8322 bits (120), Expect = 1.720e-6
Identity = 58/247 (23.48%), Postives = 105/247 (42.51%), Query Frame = 2
Query:  299 MACSVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVR----NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELLDKYF---------------PDNEQCAEEPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLN 982
            MA + S +  H +++DR+ + P+V  S+  V + Y  +K++N +       AE T+ A  +T +P AV+    ++  +DNV+   L+ LE++ P++          P  +Y +  E     L+ PV K  D+V +  +  + +             P T       +      D+ +DKY                 DNE   +E  +   I    +R S K ++RL +R   +   L K S E ++
Sbjct:    1 MATATSGSGLHLEAIDRIGSIPLVESSVKRVETIYDKVKNNNRLFSWYFETAEATISAAYETIQP-AVKLFEPSIQRLDNVMCKSLDILEQRIPLVY-------LPPEMMYWNTKEYMSDHLVRPVLKRADSVKQIGNAVLES-------------PLTTYAAERIDGAFTVGDKFVDKYLVPIQTDQDQTDGPQEDDNEAVPDERGAIKAIHHG-QRFSRKLKRRLTQRTIAEARALKKQSKEAIH 225          
BLAST of SMED30030128 vs. Ensembl Fly
Match: Lsd-1 (gene:FBgn0039114 transcript:FBtr0335002)

HSP 1 Score: 50.8322 bits (120), Expect = 1.720e-6
Identity = 58/247 (23.48%), Postives = 105/247 (42.51%), Query Frame = 2
Query:  299 MACSVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVR----NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELLDKYF---------------PDNEQCAEEPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLN 982
            MA + S +  H +++DR+ + P+V  S+  V + Y  +K++N +       AE T+ A  +T +P AV+    ++  +DNV+   L+ LE++ P++          P  +Y +  E     L+ PV K  D+V +  +  + +             P T       +      D+ +DKY                 DNE   +E  +   I    +R S K ++RL +R   +   L K S E ++
Sbjct:    1 MATATSGSGLHLEAIDRIGSIPLVESSVKRVETIYDKVKNNNRLFSWYFETAEATISAAYETIQP-AVKLFEPSIQRLDNVMCKSLDILEQRIPLVY-------LPPEMMYWNTKEYMSDHLVRPVLKRADSVKQIGNAVLES-------------PLTTYAAERIDGAFTVGDKFVDKYLVPIQTDQDQTDGPQEDDNEAVPDERGAIKAIHHG-QRFSRKLKRRLTQRTIAEARALKKQSKEAIH 225          
BLAST of SMED30030128 vs. Ensembl Fly
Match: Lsd-1 (gene:FBgn0039114 transcript:FBtr0084455)

HSP 1 Score: 49.6766 bits (117), Expect = 5.214e-6
Identity = 37/133 (27.82%), Postives = 68/133 (51.13%), Query Frame = 2
Query:  299 MACSVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVR----NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTV 685
            MA + S +  H +++DR+ + P+V  S+  V + Y  +K++N +       AE T+ A  +T +P AV+    ++  +DNV+   L+ LE++ P++          P  +Y +  E     L+ PV K  D+V
Sbjct:    1 MATATSGSGLHLEAIDRIGSIPLVESSVKRVETIYDKVKNNNRLFSWYFETAEATISAAYETIQP-AVKLFEPSIQRLDNVMCKSLDILEQRIPLVY-------LPPEMMYWNTKEYMSDHLVRPVLKRADSV 125          
BLAST of SMED30030128 vs. Ensembl Xenopus
Match: fzd10 (frizzled class receptor 10 [Source:Xenbase;Acc:XB-GENE-480379])

HSP 1 Score: 55.0694 bits (131), Expect = 1.589e-7
Identity = 62/249 (24.90%), Postives = 117/249 (46.99%), Query Frame = 2
Query:  347 RVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKD----TAEPIAVR---NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPST--RLTNVSTNYLLDKTDELLDKYFPD-NEQCAEEPISNTDIMT--------KIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSA 1039
            RV + P+V+ +   V S Y   K ++  I +    AE ++K++      +A PI  R    +   +N+    L+K+E+K PI+ + S  I +  S    D +   K+T++  +   +D      H ++    +VV  S++ V+ S+  ++ N   N  L K++ LL++Y P  +E+ A E        +        ++  LS K +KR Y++A  +I      S E ++Q+   V+ I   K+   +A
Sbjct:   19 RVISLPLVSSTYDMVSSAYTATKENHPYIKSVCDLAEKSVKSITSVALTSAMPIIHRLEPQIAVANNIACMGLDKIEEKLPILYQPSDKIVSNAS----DAVAGAKETVLQSITGVVDKTKGAVHDSVEMTKAVVNGSINTVLGSSVVQMMNTGVNTALTKSENLLEQYLPPTDEELAIEATKTEGFESGKLPSYYIRLGSLSTKARKRAYQQALTRIGDAKNRSQEAISQLHKTVDLIEFAKKNVNNA 263          
BLAST of SMED30030128 vs. Ensembl Xenopus
Match: fzd10 (frizzled class receptor 10 [Source:Xenbase;Acc:XB-GENE-480379])

HSP 1 Score: 55.0694 bits (131), Expect = 1.926e-7
Identity = 62/249 (24.90%), Postives = 117/249 (46.99%), Query Frame = 2
Query:  347 RVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKD----TAEPIAVR---NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPST--RLTNVSTNYLLDKTDELLDKYFPD-NEQCAEEPISNTDIMT--------KIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSA 1039
            RV + P+V+ +   V S Y   K ++  I +    AE ++K++      +A PI  R    +   +N+    L+K+E+K PI+ + S  I +  S    D +   K+T++  +   +D      H ++    +VV  S++ V+ S+  ++ N   N  L K++ LL++Y P  +E+ A E        +        ++  LS K +KR Y++A  +I      S E ++Q+   V+ I   K+   +A
Sbjct:   14 RVISLPLVSSTYDMVSSAYTATKENHPYIKSVCDLAEKSVKSITSVALTSAMPIIHRLEPQIAVANNIACMGLDKIEEKLPILYQPSDKIVSNAS----DAVAGAKETVLQSITGVVDKTKGAVHDSVEMTKAVVNGSINTVLGSSVVQMMNTGVNTALTKSENLLEQYLPPTDEELAIEATKTEGFESGKLPSYYIRLGSLSTKARKRAYQQALTRIGDAKNRSQEAISQLHKTVDLIEFAKKNVNNA 258          
BLAST of SMED30030128 vs. TrEMBL
Match: A0A0T6B2K4 (Uncharacterized protein (Fragment) OS=Oryctes borbonicus OX=1629725 GN=AMK59_6323 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.918e-8
Identity = 71/245 (28.98%), Postives = 111/245 (45.31%), Query Frame = 2
Query:  320 NYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAV---RNLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYL---LDKTDELLDKYFPDNEQCAEE-----PI-SNTDIMTKIK---RLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEI 1009
            N     S++R+ N PIV     +  + Y  IK+SN +   TL +AE ++  V DTA P      + LG ID V+   L+ +E++ P I          P  IYH+    T++ ++ PV K  D+V +  +  +                S++ T  + + L   LD  D+ +DKY PD+ Q  EE     PI S    +  IK   R S K Q+RL  R   +   L + S E ++ +  + E I
Sbjct:    9 NLPKMVSVERIINIPIVESGWKYAGNIYNKIKNSNNLFTWTLDRAEDSIYNVLDTAAPAVFLIEKPLGAIDKVLCRSLDIVEQRVPSI-------TLPPQVIYHN----TREYVVRPVLKRADSVKQIGNSVL----------------SSKYTVYAADKLDGALDFADKYVDKYLPDDSQGNEEKDHKHPIQSGNKALQTIKHMDRFSRKLQRRLTMRTLAEAKALKEHSVEAIHVLAYVAELI 226          
BLAST of SMED30030128 vs. TrEMBL
Match: A0A2G8KWI5 (Putative perilipin-2 isoform X2 OS=Stichopus japonicus OX=307972 GN=BSL78_10788 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.601e-7
Identity = 61/246 (24.80%), Postives = 108/246 (43.90%), Query Frame = 2
Query:  314 SQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAV---RNLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDT-VSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELLDKYFPDNEQCAEEPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSA 1039
            S+N     ++ R  N PIV  ++  V   YQW K SN +I  +L  AE ++     TA+P+     R L  ++++   QL+ LE+K PI+ E S  +     +     +E +K      + + +DT V +     +     +   ++D  +P  +  +       +K D   +K   +NE         +  + +  ++S K +KRLY +A   I    + S E L ++   V+ I   KE   SA
Sbjct:   29 SENQVDDNAISRFTNLPIVTSALTSVSDAYQWTKDSNALIGYSLGMAEKSVALAAYTAQPVVSALERPLSAVNSMANQQLDMLEEKVPILTEPSDEVVKTLKESAWTAVEHSKVAGTQKMNQLMDTRVGQVVASTVDAALQLSDMAVDYCLPDEKAKSNEAEVEQEK-DASEEKGVTENEVAVPSNERFSHSVNRASQVSTKVRKRLYHKALVNIQYAQRRSEETLQKLHFTVDLIQYAKENIDSA 273          
BLAST of SMED30030128 vs. TrEMBL
Match: V3ZM47 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_162734 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.084e-7
Identity = 62/248 (25.00%), Postives = 122/248 (49.19%), Query Frame = 2
Query:  341 LDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVR---NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTK---KTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELL-------DKYFPD-NEQCAEE-PISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSA 1039
            + R+ N P+V+ +       YQ  K+SN +I  +   AE ++K V +T+ P+  +    + +++ V V QL KLE+K P+I +        P+++Y++G E+ K    T++ P     ++V       I+ V +V    +D  + ++        Y+ DK D++L       DKY  + +E C  E  +   + +T++  LS K ++R+Y++A   I  +   S E +++++  V+ I   +     A
Sbjct:   11 IQRLGNLPMVSSAWNLGCDVYQKTKASNSLIKKSFDMAEGSVKTVANTSLPLIAKVQPQIDYVNQVAVQQLVKLEEKYPVITK-------SPNQVYNEGKEACKGACHTVVQPAVNGYNSVVTMGTEQITRVKNVGQNILDKTLETSY-----GKYVADKVDDVLTYSENYVDKYLCESDETCKMEVDMVTKNPITRVGVLSHKVRQRMYKKAMTDITQVKIRSQEAIDKLKFNVDLIEYARSNIDGA 246          
BLAST of SMED30030128 vs. TrEMBL
Match: Q9PTK6 (Perilipin OS=Xenopus laevis OX=8355 GN=fatvg PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.899e-6
Identity = 74/290 (25.52%), Postives = 132/290 (45.52%), Query Frame = 2
Query:  299 MACSVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKD----TAEPIAVR---NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPS--TRLTNVSTNYLLDKTDELLDKYFP--DNEQCAE-------EPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSAVAKEYSHTLDVIK-ANNPLNIVNHS 1111
            M+ +V Q       +DR+ N P V+ +   V S Y   K ++  I +    AE ++K++      +A PI  R    +   +N+    L+K+E+K PI+ + S  I +  S    D +   K+T++  +   +D      H ++    +VV  S++ V+ S   ++ N   N  L  ++ LL++Y P  D E   E       E     +   ++  LS K +KR Y++A  +I+     S E + Q+   ++ I   K+   SA  K Y+  +D  K + +P N  N S
Sbjct:    1 MSAAVEQQEQQQSVVDRIINLPFVSSTYDMVSSAYTNTKENHPYIKSVCDVAEKSVKSITSVALTSAMPIIHRLEPQIAIANNIACIGLDKIEEKLPILYQPSDKIVSNAS----DAVAGAKETVLQSITGVVDKTKGAVHDSVEMTKAVVNGSINTVLGSGVVQMMNTGVNTALTTSENLLEQYLPPTDEELAIEAAKTEGFESGKQPNYYVRLGSLSTKARKRAYQQALGRISDAKSRSQEAIAQLNKTMDLIEFAKKNVNSANQKLYNTWVDWTKSSGDPANEGNES 286          
BLAST of SMED30030128 vs. TrEMBL
Match: Q6IP21 (Perilipin OS=Xenopus laevis OX=8355 GN=plin2 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.336e-6
Identity = 74/290 (25.52%), Postives = 132/290 (45.52%), Query Frame = 2
Query:  299 MACSVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKD----TAEPIAVR---NLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPS--TRLTNVSTNYLLDKTDELLDKYFP--DNEQCAE-------EPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSAVAKEYSHTLDVIK-ANNPLNIVNHS 1111
            M+ +V Q       +DR+ N P V+ +   V S Y   K ++  I +    AE ++K++      +A PI  R    +   +N+    L+K+E+K PI+ + S  I +  S    D +   K+T++  +   +D      H ++    +VV  S++ V+ S   ++ N   N  L  ++ LL++Y P  D E   E       E     +   ++  LS K +KR Y++A  +I+     S E + Q+   ++ I   K+   SA  K Y+  +D  K + +P N  N S
Sbjct:    1 MSAAVEQQEQQQSVVDRIINLPFVSSTYDMVSSAYTNTKENHPYIKSVCDVAEKSVKSITSVALTSAMPIIHRLEPQIAIANNIACIGLDKIEEKLPILYQPSDKIVSNAS----DAVAGAKETVLQSITGVVDKTKGAVHDSVEMTKAVVNGSINTVLGSGVVQMMNTGVNTALTTSENLLEQYLPPTDEELAIEAAKTEGFESGKQPNYYVRLGSLSTKARKRAYQQALGRISDAKSRSQEAIAQLNKTMDLIEFAKKNVNSANQKLYNTWVDWTKSSGDPANEGNES 286          
BLAST of SMED30030128 vs. Planmine SMEST
Match: SMESG000017016.1 (SMESG000017016.1)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 382/387 (98.71%), Postives = 384/387 (99.22%), Query Frame = 2
Query:  299 MACSVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELLDKYFPDNEQCAEEPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSAVAKEYSHTLDVIKANNPLNIVNHSQLVQEAFNYSKSLKKVVSESTDVTLEYMVNSALGGLDVIXXXXXXXXXXXXXSRPENIAGEILIHTSTAVTEIRIVLDAFIYNMKQYSKKKFHGEEMTEMIDMTASSQGSCSDTDE 1459
            MACSVSQN SHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILESSSSIKNIPSKIYHDGIESTKKTLMWPVCKTLDTVSRTSHMAISTVSSVVATSMDIVIPSTRLTNVSTNYLLDKTDELLDKYFPDNEQCAEEPISN DIMTKIKRLSGKTQKRLYRRASE+INLLLKASYEKLNQIQMMVEEINKQKETFQSAVAKEYSHTLDVIKANNPLNIVNHSQLVQEA NYSKSLKKVVSESTDVTLEYMVNSALGGLDVINNNLFKLQNFLQQSRPENIAGEILIHTSTAVTEIRIVLDAFIYNMKQYSKKKFHGEEMTEMIDMTASSQGSCSD+DE
Sbjct:    1 MACSVSQNCSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILESSSSIKNIPSKIYHDGIESTKKTLMWPVCKTLDTVSRTSHMAISTVSSVVATSMDIVIPSTRLTNVSTNYLLDKTDELLDKYFPDNEQCAEEPISNPDIMTKIKRLSGKTQKRLYRRASERINLLLKASYEKLNQIQMMVEEINKQKETFQSAVAKEYSHTLDVIKANNPLNIVNHSQLVQEALNYSKSLKKVVSESTDVTLEYMVNSALGGLDVINNNLFKLQNFLQQSRPENIAGEILIHTSTAVTEIRIVLDAFIYNMKQYSKKKFHGEEMTEMIDMTASSQGSCSDSDE 387          
BLAST of SMED30030128 vs. Planmine SMEST
Match: SMESG000017013.1 (SMESG000017013.1)

HSP 1 Score: 247.284 bits (630), Expect = 3.469e-77
Identity = 154/353 (43.63%), Postives = 238/353 (67.42%), Query Frame = 2
Query:  299 MAC-SVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELLDKYFPDNEQCAEEPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSAVAKEYSHTLDVIKANNPLNIVNHSQLVQEAFNYSKSLKKVVSESTDVTLEYMVNSALGGLDVIXXXXXXXXXXXXXSRPENIAGEILIHTSTAVTEIRIVLDAFI 1354
            M C +++ +   +KS+D++Q YPIVNDS+ +V+ YY+W+KS+N II+N LTKAE T+K VK++ EPIA   L +ID+V+ NQLE+LEK CPIIL+SS +I +  SK+Y +  ES  KT+ WPV KT+ TVS+TSH AISTVSSVV      V+P+  L  V  NY++DKTDE LD++ P+ ++ +EE + N+++  +++R S +TQ R+ R+A  +I+LL K+S EKL +IQ +V E+  ++   + ++  EY H ++ IK + P+  + H  L++E    SK L K +S S+ +T+E+MV +AL     +N NL  LQN L ++ PE ++   L +++  +T  R  L+ FI
Sbjct:    1 MNCVAITNSDPTYKSIDKMQQYPIVNDSLVYVIGYYKWLKSTNSIIENALTKAEKTIKTVKESTEPIAANKLKYIDHVLYNQLERLEKTCPIILQSSKTIADASSKVYRNNFESAVKTIFWPVTKTIKTVSKTSHFAISTVSSVVE-----VMPANYLVCVPANYVIDKTDEFLDRFLPEYDESSEEELENSNLYYRVRRFSARTQTRICRQALSKIDLLQKSSLEKLERIQNLVSEVQNKRMELKGSIMHEYFHAIETIKDSIPMIPLEHWNLMKEILYNSKELLKSLSISSTLTIEFMVKNALEISISLNKNLLNLQNMLNKANPEFVSDSTLAYSTNVITLTRAWLEFFI 348          
BLAST of SMED30030128 vs. Planmine SMEST
Match: SMESG000075481.1 (SMESG000075481.1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.842e-19
Identity = 42/85 (49.41%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  326 SHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILE 580
            S  KSL+R++ YP++ D+      YY WIK  N  +++TLT  E  LK VKD  EPIA   LG +DN   NQL+KLE K PII E
Sbjct:    8 SQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLKIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKE 92          
BLAST of SMED30030128 vs. Planmine SMEST
Match: SMESG000075481.1 (SMESG000075481.1)

HSP 1 Score: 88.1965 bits (217), Expect = 9.599e-19
Identity = 42/85 (49.41%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  326 SHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILE 580
            S  KSL+R++ YP++ D+      YY WIK  N  +++TLT  E  LK VKD  EPIA   LG +DN   NQL+KLE K PII E
Sbjct:    8 SQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLKIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKE 92          
BLAST of SMED30030128 vs. Planmine SMEST
Match: SMESG000016757.1 (SMESG000016757.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.903e-18
Identity = 94/365 (25.75%), Postives = 161/365 (44.11%), Query Frame = 2
Query:  332 FKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILEXXXXXXXXXXXXYHDGIESTKKTLMWPVCKTLDTVSRTSHMAIXXXXXXXXXXMDIVIPSTRLTNVSTNYLLDKTDELLDKYF-PDNEQCAEEPISNTDIMTKIKRLSGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSAVAKEYSHTLDVIKANNPLNIVNHSQLVQEAFNYSKSLKKVVSESTDVTLEYMVNSALGGLDVIXXXXXXXXXXXXXSRPENIAGEILIHTSTAVTEIRIVLDAFIYNMKQYSKK--KFHGEEMTEMID 1417
            F+S DR+ +YPIV++S+G  L  YQWIKS N  I  T TK E  L +++++ +PIA   L  +D VV  QLEK EK  P++L+ +  +           +++T ++ + P+  ++  V                    +V   + LT +    L+  T E +  YF P+ +       + +    K  + S KT  RL +    +I+   K + E L  I ++   I K+     + +               P NIV   QL+++ FN S+ L   +S         +     G LD +  N+ KLQ  L +S+ +  + +     + A  +I   LD F   ++ +  +  K   E+ TE+ D
Sbjct:    7 FQSFDRICHYPIVHESVGCFLKVYQWIKSRNKTIHGTFTKVETVLISIQNSTKPIAASKLKPLDQVVNKQLEKFEKFFPVVLDDTDVV-----------LKNTIRSFVNPITNSISCVVHKG--------------FKLVSNLSSLTKLDYEELVYNTIENMFNYFIPEIDDTWHVSSNCSHKNQKSMKFSKKTFHRLSKIKIIEIDRFQKLNVEYLQNIHILANRIQKESGGLYNEI---------------PSNIV---QLMEDIFNNSRLLDNSLSTFKVAPSNSLAFDLAGSLDFLKKNISKLQIVLFESKLDFDSDKFFNQMNFATDQIYSGLDTFCTQLRNFVDRESKQTNEKRTELSD 328          
The following BLAST results are available for this feature:
BLAST of SMED30030128 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lsd-21.321e-726.46gene:FBgn0030608 transcript:FBtr0110968[more]
Lsd-11.720e-623.48gene:FBgn0039114 transcript:FBtr0084456[more]
Lsd-11.720e-623.48gene:FBgn0039114 transcript:FBtr0335002[more]
Lsd-15.214e-627.82gene:FBgn0039114 transcript:FBtr0084455[more]
back to top
BLAST of SMED30030128 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fzd101.589e-724.90frizzled class receptor 10 [Source:Xenbase;Acc:XB-... [more]
fzd101.926e-724.90frizzled class receptor 10 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SMED30030128 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0T6B2K41.918e-828.98Uncharacterized protein (Fragment) OS=Oryctes borb... [more]
A0A2G8KWI54.601e-724.80Putative perilipin-2 isoform X2 OS=Stichopus japon... [more]
V3ZM476.084e-725.00Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
Q9PTK61.899e-625.52Perilipin OS=Xenopus laevis OX=8355 GN=fatvg PE=2 ... [more]
Q6IP213.336e-625.52Perilipin OS=Xenopus laevis OX=8355 GN=plin2 PE=1 ... [more]
back to top
BLAST of SMED30030128 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030128 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017016.10.000e+098.71SMESG000017016.1[more]
SMESG000017013.13.469e-7743.63SMESG000017013.1[more]
SMESG000075481.18.842e-1949.41SMESG000075481.1[more]
SMESG000075481.19.599e-1949.41SMESG000075481.1[more]
SMESG000016757.11.903e-1825.75SMESG000016757.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030128 ID=SMED30030128|Name=SMED30030128|organism=Schmidtea mediterranea sexual|type=transcript|length=1544bp
TATTTTTTAAATTCAAAAATTTTAAATTTAATTAAATGATTTATGTTCTA
AATTCTATATTAAGAATTGATTTTGAAAATACGCACATTGCAAAATAGAC
TTTGATATTTAGACTATATAATTTAATCATACTGATAGCATATAATGACG
AACACACGAATTATTAACTCGAATTAGAGATTTACAAAACACTTACAAAA
CATTTAAGAACTATGACCGTTATTTGCGTTTACGACTGTTGTTTAAATAT
ATAAATACAATTGTGTTGATATCAATTATTTAATTTCAAATATTGAAAAT
GGCTTGTTCTGTTTCTCAAAATTATTCTCATTTTAAGTCTTTGGACAGAG
TTCAAAATTATCCAATTGTTAATGATTCGATTGGATTCGTTCTTAGTTAT
TATCAATGGATCAAATCTTCAAACGGCATCATTGATAATACTTTGACAAA
AGCTGAAATGACTCTTAAAGCAGTAAAAGACACTGCTGAACCGATTGCCG
TACGAAATTTGGGTTTCATCGACAATGTTGTTGTAAACCAATTGGAGAAA
TTGGAGAAGAAGTGCCCAATTATTCTTGAATCTTCAAGCTCTATTAAAAA
CATTCCAAGCAAAATCTATCACGATGGCATCGAGTCGACAAAGAAAACAT
TAATGTGGCCAGTTTGCAAAACCTTGGATACGGTATCGAGAACATCGCAT
ATGGCGATATCAACGGTCTCGTCGGTCGTTGCTACGTCCATGGACATCGT
CATTCCGTCAACCCGTCTGACGAATGTTTCAACTAATTACTTGCTGGATA
AGACTGACGAATTGCTGGATAAATATTTCCCTGACAACGAGCAATGCGCC
GAAGAGCCAATCAGCAATACAGATATCATGACGAAAATAAAAAGGCTTTC
TGGGAAAACTCAGAAACGACTCTACCGAAGAGCGTCAGAGCAAATCAATT
TGCTGTTAAAGGCGAGCTATGAGAAATTGAATCAAATCCAAATGATGGTC
GAGGAGATCAACAAGCAAAAGGAAACGTTCCAGAGCGCTGTTGCTAAGGA
ATACTCGCACACCTTGGACGTGATCAAGGCGAATAATCCGCTGAATATCG
TTAACCATTCCCAACTTGTCCAAGAAGCTTTCAACTATTCAAAATCCTTA
AAGAAAGTCGTATCGGAATCAACAGATGTCACCTTGGAATACATGGTCAA
CAGCGCTCTCGGAGGTCTCGATGTAATCAATAACAATCTATTCAAGCTGC
AGAACTTCCTCCAGCAATCCAGGCCGGAAAATATCGCCGGCGAAATCCTA
ATCCACACGAGCACGGCTGTCACGGAGATCCGAATCGTGCTCGATGCCTT
CATTTACAACATGAAACAATATTCCAAGAAGAAATTTCACGGAGAAGAAA
TGACGGAGATGATTGACATGACGGCGAGCTCCCAGGGTTCCTGCTCCGAC
ACTGATGAATGAGGATAGGAGGATAGGAGGGCCTGGTAAGGGGCGGGCGG
GGGCTTCTATTGATTTATCTAATAATCTGTGACTGTTTCAATAA
back to top

protein sequence of SMED30030128-orf-1

>SMED30030128-orf-1 ID=SMED30030128-orf-1|Name=SMED30030128-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MACSVSQNYSHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLT
KAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILESSSSIK
NIPSKIYHDGIESTKKTLMWPVCKTLDTVSRTSHMAISTVSSVVATSMDI
VIPSTRLTNVSTNYLLDKTDELLDKYFPDNEQCAEEPISNTDIMTKIKRL
SGKTQKRLYRRASEQINLLLKASYEKLNQIQMMVEEINKQKETFQSAVAK
EYSHTLDVIKANNPLNIVNHSQLVQEAFNYSKSLKKVVSESTDVTLEYMV
NSALGGLDVINNNLFKLQNFLQQSRPENIAGEILIHTSTAVTEIRIVLDA
FIYNMKQYSKKKFHGEEMTEMIDMTASSQGSCSDTDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004279Perilipin
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005811lipid particle
GO:0032994protein-lipid complex
Vocabulary: biological process
TermDefinition
GO:0006642triglyceride mobilization
GO:0006810transport
GO:0006869lipid transport
GO:0010883regulation of lipid storage
GO:0010898positive regulation of triglyceride catabolic process
GO:0019915lipid storage
GO:0022008neurogenesis
GO:0034389lipid particle organization
GO:1990044protein localization to lipid particle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004279PerilipinPFAMPF03036Perilipincoord: 15..250
e-value: 3.0E-12
score: 46.3
NoneNo IPR availablePANTHERPTHR14024:SF49LIPID STORAGE DROPLETS SURFACE-BINDING PROTEIN 1coord: 9..298
NoneNo IPR availablePANTHERPTHR14024ADIPOPHILIN/PERILIPINcoord: 9..298