Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30030117
Length (bp)1509
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neur_chan_LBD domain-containing protein (SMED30030117) t-SNE clustered cells

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30030117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30030117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30030117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030117SMESG000066647.1 SmedASXL_004709SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30030117SMESG000066647.1 dd_Smed_v4_14925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030117SMESG000066647.1 dd_Smed_v6_14925_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030117SMESG000066647.1 OX_Smed_1.0.14566ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRG3 (gamma-aminobutyric acid type A receptor gamma3 subunit [Source:HGNC Symbol;Acc:HGNC:4088])

HSP 1 Score: 50.8322 bits (120), Expect = 4.358e-6
Identity = 72/294 (24.49%), Postives = 116/294 (39.46%), Query Frame = 2
Query:  305 FNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYV-ISSLFILTLI 1138
             NK  R   K L  D  IK  V    +++  IG + +I  +Y  D+     W +  L   + T+K    NS      W P     N    +K    H IT        +N   +    R++      L+L++FP D     +  +S   P  E+         +R  K S    D++ W LY+      R      T  A     +++    +RR  YF    ++   L   LS V+F + K     R  L  T VLT+     +  + LP++SY+T +D +V +  LF+   +
Sbjct:   51 LNKLLREYDKKLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNS-TMKILTLNSNMVGLIWIPDTIFRN----SKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPKEEM--------IYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAAL 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: lgc-8 (Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL;Acc:Q6BEQ0])

HSP 1 Score: 50.447 bits (119), Expect = 1.793e-6
Identity = 45/196 (22.96%), Postives = 91/196 (46.43%), Query Frame = 2
Query:  617 KRRVSGVF--LENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHI----ETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLI---CSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEK 1174
            ++ +  VF  L ++ +N FP+D Q   I +   +    E+  +   D         F    EW     +    ETE  ++ + +++   V  AL+VK    RRP +++W + + T++I   C   L T   +  L + R+ L  T +L+      +V   +PK S L  L  ++++ +F++ +  L+  L++ + +
Sbjct:  141 RQNIYAVFTNLCDMNINEFPYDQQTCMIKMGPWSYTMKEVTCIVGGDIERNETTGKFQGNSEWDFEGIVSSVGETEDPDVNFTFSE---VHFALTVK----RRPQFYVWVLLIPTYIITVVCIFGLFTPTANHGLREERVNLGITTLLSSAVILQIVANAMPKTSELPLLGNFILAEIFVVAIGVLFAVLVLTLHQ 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: lgc-53 (Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL;Acc:Q2PJ95])

HSP 1 Score: 49.6766 bits (117), Expect = 4.123e-6
Identity = 75/321 (23.36%), Postives = 128/321 (39.88%), Query Frame = 2
Query:  248 SIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLD--NQTETLK------YDWANSWSPKL-YIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLV---------NDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVD-KKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVIS--SLFILTLICL 1144
            + INETL  +  + +   S++K         N+ ++   +V V +    I EI      + ADV     WR+P LD  ++   LK      +     WSP + ++ +   E        I    F +  +    RVS      L+L +FP D Q   +   S +  T+E+R+V          DPD  +  +            ++ +  E       YT  A +   L VK    R   Y++   ++ T+L   +S + F +D K LP        +L+     F  +V   LP++SY+  LD ++        L+L+ L
Sbjct:   78 TAINETLRKNLLQELFDDSYDKN--------NLPSANSTEVIVELTVQSITEISEFSSSFKADVWFSQIWRDPRLDFSDRNYCLKNISLASHKLPTMWSPNVCFVNSKKVEIHASPSQNILLLIFPNGTVWLNFRVSLTGPCKLDLTYFPMDRQSCNLVFESYSYNTAEVRIVWRDWDAVTIPDPDSKNLPD------------FELVNIEHMNATLVYT--AGLWDQLEVKFTFRRLYGYYVLQAYMPTYLSVFISWIAFWIDTKALPARITLGVSSLMALTFQFGNIVKN-LPRVSYVKALDIWMFGCVGFIFLSLVEL 375          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 51.9878 bits (123), Expect = 1.195e-6
Identity = 88/381 (23.10%), Postives = 152/381 (39.90%), Query Frame = 2
Query:   71 SSPLHLQPESISHQPFLPA-----SGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMITFNE----FNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPA----LSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            +SPL   P        LP        F P+  +E+   D+          T   S K  ++D   I+N+ L  + NK                 L  D  ++  V    V++  IG +D I  +Y  D+     W +  L   + ++K    NS      W P  +  N+    K   + + T N     +++  +    R++      L+L++FP D     +  +S   P +EI+        +R  ++S    D++ W LY+      R  +    D+A  +      +++    +RR  YF    ++   +I  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI T   L
Sbjct:    4 NSPLQEAPSHAYGYFVLPLLNNQIMAFGPSKAEEEDYEDVPINK------TWVLSPKVYESDVTLILNKLLQGYDNK-----------------LRPDIGVRPTVIETAVYVNSIGPVDPINMEYTIDIFFAQTWYDSRLKFNS-SMKLLMLNSNMVGKIWIPDTFFRNS---RKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPKNEIQ--------YRWQRRSVEVADQRYWRLYQFAFVGLRNSS----DVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV-SVCFIFTFAAL 344          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 51.9878 bits (123), Expect = 1.259e-6
Identity = 88/384 (22.92%), Postives = 154/384 (40.10%), Query Frame = 2
Query:   53 RLLKAHSSPLHLQPESISHQPF--LPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMITFNE----FNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPA----LSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            RL+  H  P       I+   F    +  F P+  +E+   D+          T   S K  ++D   I+N+ L  + NK                 L  D  ++  V    V++  IG +D I  +Y  D+     W +  L   + ++K    NS      W P  +  N+    K   + + T N     +++  +    R++      L+L++FP D     +  +S   P +EI+        +R  ++S    D++ W LY+      R  +    D+A  +      +++    +RR  YF    ++   +I  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI T   L
Sbjct:    1 RLILLHYLPFQCLSAYIASLWFSVYDSMAFGPSKAEEEDYEDVPINK------TWVLSPKVYESDVTLILNKLLQGYDNK-----------------LRPDIGVRPTVIETAVYVNSIGPVDPINMEYTIDIFFAQTWYDSRLKFNS-SMKLLMLNSNMVGKIWIPDTFFRNS---RKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPKNEIQ--------YRWQRRSVEVADQRYWRLYQFAFVGLRNSS----DVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV-SVCFIFTFAAL 344          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 50.8322 bits (120), Expect = 2.397e-6
Identity = 93/386 (24.09%), Postives = 152/386 (39.38%), Query Frame = 2
Query:   47 TTRLLKAHSSP-----LHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            +++ L A + P     L L    I+H P   +S  L +D+DE          + N ++  +   K  ++D   I+N  L  + NK                 L  D  +K  V    +F+  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+LN+FP D     +  +S   P  EI         ++  + S    D + W LY+      R  +     ++     L+V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   10 SSKCLNAMAIPAVTLKLFLWAFLIAHLPL--SSVQLESDDDE----------VTNKTWVLTP--KVYESDVTHILNSLLDGYDNK-----------------LRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TMKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEI--------VYKWKRSSVEVGDIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 350          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 50.8322 bits (120), Expect = 2.763e-6
Identity = 93/386 (24.09%), Postives = 152/386 (39.38%), Query Frame = 2
Query:   47 TTRLLKAHSSP-----LHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            +++ L A + P     L L    I+H P   +S  L +D+DE          + N ++  +   K  ++D   I+N  L  + NK                 L  D  +K  V    +F+  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+LN+FP D     +  +S   P  EI         ++  + S    D + W LY+      R  +     ++     L+V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   10 SSKCLNAMAIPAVTLKLFLWAFLIAHLPL--SSVQLESDDDE----------VTNKTWVLTP--KVYESDVTHILNSLLDGYDNK-----------------LRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TMKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEI--------VYKWKRSSVEVGDIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 350          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 50.8322 bits (120), Expect = 2.763e-6
Identity = 93/386 (24.09%), Postives = 152/386 (39.38%), Query Frame = 2
Query:   47 TTRLLKAHSSP-----LHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            +++ L A + P     L L    I+H P   +S  L +D+DE          + N ++  +   K  ++D   I+N  L  + NK                 L  D  +K  V    +F+  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+LN+FP D     +  +S   P  EI         ++  + S    D + W LY+      R  +     ++     L+V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   10 SSKCLNAMAIPAVTLKLFLWAFLIAHLPL--SSVQLESDDDE----------VTNKTWVLTP--KVYESDVTHILNSLLDGYDNK-----------------LRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TMKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEI--------VYKWKRSSVEVGDIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 350          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 54.299 bits (129), Expect = 3.579e-7
Identity = 80/322 (24.84%), Postives = 127/322 (39.44%), Query Frame = 2
Query:  224 KSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            K +DND  SI+N  L  + NK                 L  D  +K  V    +++  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+L++FP D     +  +S   P  EI         ++  + S    D + W LY+      R    E    +     ++V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   90 KFHDNDVTSILNGLLKGYDNK-----------------LRPDIGVKPTVIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TIKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPKEEI--------IYQWKRSSVEVGDVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 380          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 53.9138 bits (128), Expect = 4.538e-7
Identity = 80/322 (24.84%), Postives = 127/322 (39.44%), Query Frame = 2
Query:  224 KSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            K +DND  SI+N  L  + NK                 L  D  +K  V    +++  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+L++FP D     +  +S   P  EI         ++  + S    D + W LY+      R    E    +     ++V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   90 KFHDNDVTSILNGLLKGYDNK-----------------LRPDIGVKPTVIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TIKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPKEEI--------IYQWKRSSVEVGDVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 380          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg3 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 3 [Source:MGI Symbol;Acc:MGI:95624])

HSP 1 Score: 53.9138 bits (128), Expect = 3.551e-7
Identity = 73/294 (24.83%), Postives = 117/294 (39.80%), Query Frame = 2
Query:  305 FNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYV-ISSLFILTLI 1138
             NK  R   K L  D  IK  V    +++  IG + +I  +Y  D+     W +  L   + T+K    NS      W P     N    +K    H IT        +N   +    R++      L+L++FP D     +T +S   P  E+         +R  K S    D++ W LY+      R      T  A     +++    +RR  YF    ++   L   LS V+F + K     R  L  T VLT+     +  + LP++SY+T +D +V +  LF+   +
Sbjct:   51 LNKLLREYDKKLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNS-TMKILTLNSNMVGLIWIPDTIFRN----SKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEM--------IYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAAL 331          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C7B7|ELIC_DICCH (Cys-loop ligand-gated ion channel OS=Dickeya chrysanthemi OX=556 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 8.739e-10
Identity = 66/278 (23.74%), Postives = 130/278 (46.76%), Query Frame = 2
Query:  368 VYVCVVFLKIGEIDTIKEQYAADVLIKSKWR---------EPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRP------ALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVIS---SLFILTLICL 1144
            V V +   KI  ++T+++ Y  D  I ++W          +P++   T+  ++     W P L   N +G        ++ F +     +    R  G F  +++   FPFD Q   + +   +    ++R  +    T  I+ +      EW++ K   T   ++ Y++  L++V+P       ++V+  A R P+Y++W+  L   LI + S   F ++      RLQ ++TL+LT+VA+ F  +  LP++ Y T +D+ +I+   S+F   L+ +
Sbjct:   14 VSVSIFINKIYGVNTLEQTYKVDGYIVAQWTGKPRKTPGDKPLIVENTQIERWINNGLWVPALEFINVVGSPDTGNKRLMLFPD---GRVIYNARFLGSFSNDMDFRLFPFDRQQFVLELEPFSYNNQQLRFSDIQVYTENIDNEEI---DEWWIRKA-STHISDIRYDH--LSSVQPNQNEFSRITVRIDAVRNPSYYLWSFILPLGLIIAASWSVFWLESF--SERLQTSFTLMLTVVAYAFYTSNILPRLPYTTVIDQMIIAGYGSIFAAILLII 280          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P28473|GBRG3_RAT (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Rattus norvegicus OX=10116 GN=Gabrg3 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.378e-6
Identity = 73/294 (24.83%), Postives = 117/294 (39.80%), Query Frame = 2
Query:  305 FNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYV-ISSLFILTLI 1138
             NK  R   K L  D  IK  V    +++  IG + +I  +Y  D+     W +  L   + T+K    NS      W P     N    +K    H IT        +N   +    R++      L+L++FP D     +T +S   P  E+         +R  K S    D++ W LY+      R      T  A     +++    +RR  YF    ++   L   LS V+F + K     R  L  T VLT+     +  + LP++SY+T +D +V +  LF+   +
Sbjct:   51 LNKLLREYDKKLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNS-TMKILTLNSNMVGLIWIPDTIFRN----SKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEM--------IYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAAL 331          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P27681|GBRG3_MOUSE (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Mus musculus OX=10090 GN=Gabrg3 PE=2 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 2.484e-6
Identity = 73/294 (24.83%), Postives = 117/294 (39.80%), Query Frame = 2
Query:  305 FNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYV-ISSLFILTLI 1138
             NK  R   K L  D  IK  V    +++  IG + +I  +Y  D+     W +  L   + T+K    NS      W P     N    +K    H IT        +N   +    R++      L+L++FP D     +T +S   P  E+         +R  K S    D++ W LY+      R      T  A     +++    +RR  YF    ++   L   LS V+F + K     R  L  T VLT+     +  + LP++SY+T +D +V +  LF+   +
Sbjct:   51 LNKLLREYDKKLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNS-TMKILTLNSNMVGLIWIPDTIFRN----SKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEM--------IYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAAL 331          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A0V0J6K7 (Neur_chan_LBD domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR135000 PE=3 SV=1)

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 262/343 (76.38%), Postives = 299/343 (87.17%), Query Frame = 2
Query:  359 KHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMR 1387
            K QVY+CV+FLKIGEIDTIKEQYAADVLIK+KWR+  +D    + +YDW ++W+PKLYIENTIGE +E ++  I  NEF HAFL EKRRVSGVFLENLELNHFPFDVQDLTITVASNLP+SEIRL+NDPDE HRINKQSFVDEQEWYLYKHI++EQ ELA EY + A+VRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVD+  PQ+RLQLT+TLVLTLVAFKFVVNQCLPKISYLTYLDKY+ISSLF LTLIC+WHG I VIEKV+ RF  ++  DME+YVI+ + IGY  +N+ F++MIYCVACKRRRDM  +D EY+EKV+CQM  KG RA R
Sbjct:  289 KRQVYLCVIFLKIGEIDTIKEQYAADVLIKAKWRDADMDT-AGSKEYDWLHNWTPKLYIENTIGEIREQIHQTIALNEFGHAFLVEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPSSEIRLLNDPDEPHRINKQSFVDEQEWYLYKHIDSEQHELANEYIENASVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDRSQPQSRLQLTFTLVLTLVAFKFVVNQCLPKISYLTYLDKYIISSLFFLTLICIWHGGIAVIEKVAQRFDILLWADMELYVILLIGIGYFTFNVGFMLMIYCVACKRRRDMKSKDSEYLEKVKCQMNKKGSRAHR 630          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A2T7Q004 (Neur_chan_LBD domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01623 PE=3 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 3.364e-119
Identity = 190/358 (53.07%), Postives = 251/358 (70.11%), Query Frame = 2
Query:  305 FNKFHRL--DSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQT-------ETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQ 1351
            FN F  L    +  +V T IK  V VCV F K+GEIDT+KEQY ADV+++++WREP LD Q        E  KY     W+PKLYIEN  G+ KE+  + + FNE   AF+ EKR + G F+ENLEL+ FPFDVQDLT+TVAS  P++E+ L+ D D  H +NKQSFVDEQEWYLY H +  + EL  +  D A  R A+SVKCRAARRP YF+WNIF+VTFLICSLS  TF+VDK LPQNRLQL +TL+LT VAFK VVNQ LP+ISYLTY+DKY+++S+ +++ +C WH +++ I  ++DR      D +E  V+I + I Y+ +N+ FI++IY   CK+RR M  RD+E+ E+ +
Sbjct:   30 FNDFRVLMYRRRSTSVVTDIK--VLVCVQFFKVGEIDTLKEQYTADVIVRARWREPSLDGQLSEQGDMLEPGKY-----WNPKLYIENAYGDPKENFRYRVMFNEKGEAFISEKRTIKGTFMENLELDDFPFDVQDLTVTVASEFPSTEVELIEDSDNRHMVNKQSFVDEQEWYLYCHTQCTKWELKIDPVDDAAKRSAISVKCRAARRPGYFVWNIFIVTFLICSLSFATFSVDKSLPQNRLQLAFTLMLTSVAFKSVVNQSLPRISYLTYMDKYLLASMIMMSGVCAWHAVVITI--LNDR---GFADHVESIVLIVLGIVYVLFNVGFIIIIYLFPCKKRRTMAVRDREHKEQAR 375          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A210Q143 (Cys-loop ligand-gated ion channel OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24637 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.521e-118
Identity = 178/342 (52.05%), Postives = 247/342 (72.22%), Query Frame = 2
Query:  350 TSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLK-YDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKG 1372
            +S + +V +CV F K+GEIDT+KEQY ADV++K+KWREP LD Q +T +  ++   W+PKLYIEN++G+ KE + + + +N+   A++ EKR + G F+ENLEL+ FPFDVQD+TITVAS LP+SE+ L+ D D+ H +NKQ+FVDEQEW+LY H E  +R++  +  D++  R ALSVKCRAARRP YF+WNIF+VTFLICSL+  TF+V+  LPQNRLQL++TLVLT VAFK  VN  LP+ISYLTY+DKY++ ++ +LT +C+WH ++  +     R      D +E  V+  +A  Y+ YNI F ++IY    K+RR+M Q+DKEY      QMKY  
Sbjct:   19 SSFQVKVKICVQFFKVGEIDTLKEQYTADVIVKAKWREPSLDGQNKTSESVEFNKMWNPKLYIENSLGDPKEQIRYQVLYNDKGEAYVSEKRVIKGTFMENLELDDFPFDVQDITITVASELPSSEVELIEDDDDHHVVNKQAFVDEQEWHLYMHTECVKRDIVIDQADMSVRRSALSVKCRAARRPGYFVWNIFVVTFLICSLAFTTFSVNNNLPQNRLQLSFTLVLTAVAFKSAVNSSLPRISYLTYMDKYLLIAMVMLTAVCVWHAIVSTLATQEKR------DRIESVVLTVLAAIYIFYNIGFFIVIYVSPWKKRREMQQKDKEY------QMKYAA 348          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A1S3HM70 (uncharacterized protein LOC106156405 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106156405 PE=3 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 6.820e-115
Identity = 180/334 (53.89%), Postives = 239/334 (71.56%), Query Frame = 2
Query:  368 VYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLD----NQTETL---KYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKV 1348
            V VCV+FLK+GEIDT+KEQ++ADVL+K+KWREP LD    N+ E +   + D+   W+PKL++ENT+G+ KE  +  + F+    AF+CE +R+ G F+ENLELN FPFDVQDLT+TV S  P SE+ L+ D  E HR+ KQSF+DEQEW LYKH+E+E + LA  + D +  R  LSVKCRAARRP +F+WNIFLVTFL CSLS  TF+V+  LPQNRLQL++TLVLT VAFKFV+NQ LP++SYLTYLDKY++ S+  L ++C WH ++  I+   D          E+  +  +A+ Y+G+N      IY  ACKRRR M Q+D+EY+E V
Sbjct:   55 VEVCVIFLKLGEIDTLKEQFSADVLVKAKWREPELDRKGKNKDELIDEDEIDFEKYWNPKLFVENTVGDPKEVRWRTLAFSSEGDAFICENQRLKGTFVENLELNDFPFDVQDLTVTVTSERPASELNLIEDRMELHRVYKQSFIDEQEWSLYKHLESESKFLAEPHGDPSVKRVLLSVKCRAARRPWFFVWNIFLVTFLFCSLSFATFSVEYNLPQNRLQLSFTLVLTAVAFKFVINQSLPRVSYLTYLDKYLLGSMCQLAIVCAWHSIVAKIDSKHD------AKVAELVFLTALAVIYIGFNAGICFHIYAFACKRRRIMKQKDREYMESV 382          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A2C9MAB6 (Neur_chan_LBD domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106069993 PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 1.208e-114
Identity = 190/382 (49.74%), Postives = 256/382 (67.02%), Query Frame = 2
Query:  212 SESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQ-------TETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEY 1336
            S+S    ++  A  + E   +   +R R KS N   ++       D  IK  V VCV F K+GEIDT+KEQY ADV+++S+WREP LD Q       T+  KY     W+PKLYIEN+ G+ KE   + + FN+   A++ EKR V G F+ENLEL+ FPFDVQDLT+TVAS  P +++ +V D +  H +NKQSFVDEQEW+LY H E  QREL  +  D +  R A+SVKCRAARRP YF+WNIF++TFLIC+LS  TF+VDK LPQNRLQL++TLVLT VAFK VVNQ LP+ISYLTY+DKY+++S+F+++ +C WHG++  +E       ++     E  V+  +A  Y+ YNI F ++IY   CK+RR M Q+D E+
Sbjct:   46 SKSPTHRNSSVAVDLGEGSGSLKRRRSRKKSMNGGDKVK------DDRIK--VQVCVQFFKVGEIDTLKEQYTADVIVRSRWREPSLDGQLSEGGDITDVRKY-----WNPKLYIENSYGDHKEMFRYRLVFNDKGEAYMTEKRTVKGTFMENLELDDFPFDVQDLTVTVASEFPYTDVEVVEDLENHHMVNKQSFVDEQEWHLYSHTECIQRELTIDQFDPSVRRSAVSVKCRAARRPGYFVWNIFMITFLICTLSFATFSVDKWLPQNRLQLSFTLVLTAVAFKSVVNQSLPRISYLTYMDKYLLASMFMMSAVCTWHGVVTTLEGNKPLANFI-----EYIVLGCLAAIYVVYNIGFCILIYVFPCKKRRIMAQKDVEH 409          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: GABRG3 (gamma-aminobutyric acid type A receptor gamma3 subunit [Source:NCBI gene;Acc:103040847])

HSP 1 Score: 49.6766 bits (117), Expect = 5.032e-6
Identity = 75/324 (23.15%), Postives = 125/324 (38.58%), Query Frame = 2
Query:  212 SESTKSNDNDRASI-INETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYV-ISSLFILTLI 1138
            S++  S D +   + +N+ L    ++    +  N   +   K L  D  +K  V    +F+  IG + +I  +Y  D++    W +  L     T+K    NS      W P     N    +K    H IT        +N   +    R++      L+L++FP D     +  +S   P  E+          R N     D++ W LY+      R         A     ++V    +RR  YF    ++   L   LS V+F + K     R  L  T VLT+     V    LP++SY+T +D +V +  LF+   +
Sbjct:   84 SQTIASEDEEYDDVTVNQMLAPRTHETDATQILNNLLKEYDKKLRPDIGVKPTVIDVDIFVNSIGPVSSINMEYQIDIIFAQTWTDSRL-RYNSTMKILTLNSNMVGLIWVPDTIFRN----SKNADSHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPRDEMIY------KWRKNSVEAADQKSWRLYQFDFMGLRNTTDVIKTTAGDYVVMTVYFDLSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTVARTSLPRVSYVTAMDLFVTVCFLFVFAAL 396          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:103027255])

HSP 1 Score: 48.9062 bits (115), Expect = 9.178e-6
Identity = 92/380 (24.21%), Postives = 146/380 (38.42%), Query Frame = 2
Query:   53 RLLKAHSSPLHLQPESISHQPFLPASGF-LPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            R   A +S L L     +H   LP+S     ND+DE          + N ++  +   K  ++D   I+N  L  + NK                 L  D  ++  V    +F+  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+L +FP D     +  +S   P  EI         +R  + S    D + W LY+      R        ++     L+V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   10 RCNPARASSLFLWLLIAAH---LPSSSIQTENDDDE----------VTNKTWVLTP--KVYESDVTHILNSLLDGYDNK-----------------LRPDIGVQPTVITTDMFVNSIGPVNAINMEYTIDIFFAQTWYDSRLRFNS-TMKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLYNFPMDEHSCPLEFSSYGYPKEEI--------VYRWKRSSVEVGDIRSWRLYQFSFVGLRNSTEVVRTVSGDYVVLTVFFELSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 343          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 50.8322 bits (120), Expect = 4.273e-7
Identity = 57/261 (21.84%), Postives = 115/261 (44.06%), Query Frame = 2
Query:  377 CVVFLK-IGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKY-----DWANS-----WSPKLYIENTIGEAKE------HVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYV 1108
            C + +K  G ++     Y+ ++ ++  W +P + N  ++++Y     D  NS     W P L+ EN    A +         +M TF  +   FLC   R+S V    + L  +P D Q  +I + S   T+   L+   ++T  ++  + V   ++ L       +    Y Y   + V+    +     R   Y++  +++ + L+  +S ++F ++ +    R+ L  T +LT+       N  LPK+SY+  +D ++
Sbjct:   73 CSILVKGFGPVEEATMDYSINIFLRQTWNDPRILNVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQMYQLVTGFKYMYTFAMWITCFLC--FRLSLVLACPMSLEVYPMDAQYCSIYLESYGYTTN-DLIFQWNDTEPVSFGAGVSTPKFTLSNETFLGECTKEYTYGTFSCVKATFFLD----RDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWM 326          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 127.102 bits (318), Expect = 2.976e-32
Identity = 81/299 (27.09%), Postives = 153/299 (51.17%), Query Frame = 2
Query:  395 IGEIDTIKEQYAADVLIKSKWREPML-DNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEK-RRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETE---QRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIV 1276
            +G+ID I++Q+  ++ + + WREP L   + E +K  W N WSPK+   N++   + +    + + E +   L ++  ++ G F E   L  FP D+Q+L+I ++S+     +    D  +   + +Q+F   ++W LY H+ T+   Q        D +   P   +     RR  ++ WN  +V  ++ +LS  +FA+  +   +RL +T  L+L  VA+KFV +  LP+ SYLT+LDKY + +L  ++ I + + + V +E         +   + +YVI+    G +  +  ++V
Sbjct:   27 LGDIDVIRQQFTCELWMTASWREPKLAGKKNEEVK--WDNEWSPKISFSNSLLLDRVYKGRRLYYEENSTVPLAQEVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEKDMAKPDYLRQQTFSSPRDWVLYPHVHTDTATQEGEGLGPNDRSY--PVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIAVAVESRDTYDMVCLYAGLALYVILQCMAGILTLHKHYVV 321          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO26859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV8])

HSP 1 Score: 70.4774 bits (171), Expect = 3.258e-14
Identity = 43/141 (30.50%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  761 INKQSFVDEQEWYLYKHIETE---QRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEK 1174
            + +Q+F   ++W LY H+ T+   Q        D +   P   +     RR  ++ WN  +V  ++ +LS  +FA+  +   +RL +T  L+L  VA+KFV +  LP+ SYLT+LDKY + +L  ++ I + + + V +E 
Sbjct:    7 LRQQTFSSPRDWVLYPHVHTDTATQEGEGLGPNDRS--YPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIAVAVES 145          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO38597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCG0])

HSP 1 Score: 58.5362 bits (140), Expect = 1.436e-9
Identity = 61/263 (23.19%), Postives = 107/263 (40.68%), Query Frame = 2
Query:  395 IGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWA----------NSWSPKLYIENTIGEAKEHVYHMITFNEFNHAF-----LCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFV-DEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISS-LFILT 1132
            IG ID  K +++ D+  + +WRE  L    +  K              N+W P ++I+N+    KE  +H +  +   +       +    R++      +    FP DVQ       S   T +  ++       R  K   + DE E   Y   E   R+    Y       P  ++  +  RR  Y+++  +L   L+  LS ++F +D +    R+ L    +L + +F  +     P +SY T LD Y+IS  +F+ T
Sbjct:   15 IGAIDEKKMEFSVDIFFRQRWREERLCYLPQAGKGSGQRLILNPVLLKNTWRPDVFIKNS----KEARFHEVPSDNVMYGISPDGNILLSSRITTTLSCQMNFRRFPMDVQKCHFQTGSYGHTEDDIVIR-----CRGGKGLIISDEVEISQYSITEVTSRDFKGVYNTGVFSEPIATIVLK--RRLMYYVYGYYLPAGLVVFLSWISFWIDPRSVPARVSLGVITILAMGSF--LHGGKGPSVSYATALDVYIISCYVFVFT 264          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 54.6842 bits (130), Expect = 4.914e-8
Identity = 64/271 (23.62%), Postives = 117/271 (43.17%), Query Frame = 2
Query:  389 LKIGEIDTIKEQYAADVLIKSKWREPMLDNQ-TETLKYDWANSWSPKLYIENT--IGEAKEHVYHMITFNEF----NHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS---NLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIE 1171
            L I  I+ I   Y  D  ++  WR+P L ++  +TL    +N+   K+++ +T  +       + + T N+         +    RV+      + L  FP DVQ+  I + S   +    + +  N  D    +NK+  + +   Y    I   +    Y    +A     L+   R  RR  YFI +I+    LI  LS ++F +  +    R+ L  T VLT+     ++N  +PK+SY+  +D Y+I     +  + L +  ++ I+
Sbjct:   39 LSIDAINVIDMDYRMDFFLRQLWRDPRLKHRFDDTLAL--SNTMLDKIWVPDTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRMFPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKK--IRDMPQYNLSDINVSRHFTMY----VAGNWSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFVFAVLLEYTFVLYID 301          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 49.2914 bits (116), Expect = 2.224e-6
Identity = 62/298 (20.81%), Postives = 129/298 (43.29%), Query Frame = 2
Query:  314 FHRLDSKCLNV-DTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQT------ETLKYDWANSWSPKLYIENTI-----GEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQREL----AYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKIS-YLTYLDKYVISSLFI----LTLICL 1144
            F   DS+   V + S K  V   +  ++I  +++  +     V I+ KW  PML   T      E++  + A  W P + + N       G  +++   +I  ++    +       S     N+ + +FPFD Q+ ++   S         +    ++  ++K  +V+  EW+L        R       Y + D+       ++     R+P Y+++N+ +   LI +L+L+ F +  +  + ++ L  T++L +  F  +V + LP  S ++  L +Y ++++F+    L   CL
Sbjct:   46 FRNYDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTC---NINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSDSADLSK--YVNNGEWHLLAMPAKLNRVFYNCCKYPFYDV-------TLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGE-KVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCL 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:101155813])

HSP 1 Score: 53.5286 bits (127), Expect = 3.066e-7
Identity = 82/355 (23.10%), Postives = 146/355 (41.13%), Query Frame = 2
Query:  134 FLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMITFNE----FNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPA----LSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            FLP+ +++D   D+          T   S K  ++D   I+N+ L  + NK                 L  D  ++  V    V++  IG +D I  +Y  D+     W +  L   + ++K    NS      W P  +  N+    K   + + T N     +++  +    R++      L+L++FP D     +  +S   P +EI         +R  +++    D++ W LY+      R  +    D+A  +      +++    +RR  YF    ++   +I  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI T   L
Sbjct:   23 FLPSKQEDDDYEDVPINK------TWVLSPKVYESDVTLILNKLLQGYDNK-----------------LRPDIGVRPTVIETAVYVNSIGPVDPINMEYTIDIFFAQTWYDSRLKFNS-SMKLLMLNSNMVGKIWIPDTFFRNS---RKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPRNEI--------MYRWQRRAVEVADQRYWRLYQFAFVGMRNTS----DVAHTQSGEYVIMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYITAMDLFV-SVCFIFTFAAL 337          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 51.6026 bits (122), Expect = 1.243e-6
Identity = 73/284 (25.70%), Postives = 115/284 (40.49%), Query Frame = 2
Query:  338 LNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            L  D  +K  V    +F+  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+LN+FP D     +  +S   P  EI         +R  + S    D + W LY+      R  +     ++     L+V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   46 LRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TMKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPREEI--------VYRWKRSSVEVGDIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 315          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 51.6026 bits (122), Expect = 1.339e-6
Identity = 73/284 (25.70%), Postives = 115/284 (40.49%), Query Frame = 2
Query:  338 LNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            L  D  +K  V    +F+  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+LN+FP D     +  +S   P  EI         +R  + S    D + W LY+      R  +     ++     L+V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   80 LRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TMKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPREEI--------VYRWKRSSVEVGDIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 349          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 51.2174 bits (121), Expect = 1.522e-6
Identity = 73/284 (25.70%), Postives = 115/284 (40.49%), Query Frame = 2
Query:  338 LNVDTSIKHQVYVCVVFL-KIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANS------WSPKLYIENTIGEAKEHVYHMIT-----FNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVAS-NLPTSEIRLVNDPDETHRINKQSF--VDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICL 1144
            L  D  +K  V    +F+  IG ++ I  +Y  D+     W +  L   + T+K    NS      W P  +  N    +K+   H IT        +N   +    R++      L+LN+FP D     +  +S   P  EI         +R  + S    D + W LY+      R  +     ++     L+V    +RR  YF    ++   LI  LS V+F ++K     R  L  T VLT+     +  + LPK+SY+T +D +V S  FI     L
Sbjct:   80 LRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNS-TMKVLRLNSNMVGKIWIPDTFFRN----SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPREEI--------VYRWKRSSVEVGDIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-SVCFIFVFAAL 349          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000066647.1 (SMESG000066647.1)

HSP 1 Score: 953.74 bits (2464), Expect = 0.000e+0
Identity = 469/469 (100.00%), Postives = 469/469 (100.00%), Query Frame = 2
Query:   41 MITTRLLKAHSSPLHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI 1447
            MITTRLLKAHSSPLHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRLQLTYTLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI
Sbjct:    1 MITTRLLKAHSSPLHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRLQLTYTLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI 469          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000066647.1 (SMESG000066647.1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 363/365 (99.45%), Postives = 365/365 (100.00%), Query Frame = 2
Query:  353 SIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI 1447
            ++KHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRLQLTYTLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI
Sbjct:  224 NVKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRLQLTYTLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI 588          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000021796.1 (SMESG000021796.1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 315/459 (68.63%), Postives = 365/459 (79.52%), Query Frame = 2
Query:   71 SSPLHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESIRNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI 1447
            SSPL +    ++     P + F P+D+     +D+     RN    +S++   N+++R       +F   N R                       K QVYVCVVFLKIGEIDTIKEQYAAD+LIK KWREP LD+ TE L+YDWANSW+PKLYIENTIGEAKEHVY MI FNE  HAFLCEKRRVSG+FLENLELNHFPFDVQDLTIT+ASNLP++EIRLVNDPDETHR+NKQSFVDEQEWYL+KHIETEQ+ELAYEY D ++V+PA+SVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDK LPQNRLQLT+TLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILT+IC+WHG+IVVIE+ + + +Y +P DME+YVII MA+ + GYN  FIVMIY VACKRRR M QRDKEY+E++QCQ+KYKG R ++MIQQTHQ+HEVKEN   TF+
Sbjct:    3 SSPL-ININGLTQNSSPPETVFSPSDDAAMPLIDV-----RNRYKHESDNYSVNNDER-------IFGDQNNR-----------------------KRQVYVCVVFLKIGEIDTIKEQYAADILIKCKWREPRLDHNTEKLEYDWANSWTPKLYIENTIGEAKEHVYQMIIFNENQHAFLCEKRRVSGIFLENLELNHFPFDVQDLTITIASNLPSTEIRLVNDPDETHRVNKQSFVDEQEWYLFKHIETEQKELAYEYADPSSVKPAISVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKSLPQNRLQLTFTLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILTVICVWHGMIVVIERFASKSEYDLPKDMEIYVIIGMAVAFAGYNFGFIVMIYAVACKRRRIMKQRDKEYLERLQCQLKYKGARTIKMIQQTHQMHEVKENRRGTFL 425          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000039749.1 (SMESG000039749.1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 274/421 (65.08%), Postives = 334/421 (79.33%), Query Frame = 2
Query:  203 YTKSESTKSNDNDRASIINETLFNHANKR-----IRMKSFNKFHRL-DSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI 1447
            Y K  S  S +ND    + E    H ++R     +R+   +  H L +      DT  K QVY+CVVFLKIGEIDTIKEQ+ AD+++K+KWREP LD   + L YDW+  W+PKLY+ENT+G+ +EHVY MITFNEF HAFLCEKRRVSGVFLENLELNHFPFDVQDLTI VA+ L +SEIRLVNDPDE HRINKQSFVDEQEW+LYK+IE+EQ+++ +EY D  +VRPAL V+CRAARRPAYF+WN+FLVTFLICSLSLVTFAVDK LPQNRLQL+YTLVLTL+AFKFVVNQCLPKISYLTYLDKY+IS+LF LTL+C WHGL+VVI ++  R    + +++E+YV+I +++GY  YN+ F+++IY VA KRRR M + DKEY+EKVQCQ+K KG R  RM QQT Q+HEVK NG+  FI
Sbjct:   20 YRKRSSGSSQNNDSEFSVYEI---HQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTVFI 437          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000039749.1 (SMESG000039749.1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 274/421 (65.08%), Postives = 334/421 (79.33%), Query Frame = 2
Query:  203 YTKSESTKSNDNDRASIINETLFNHANKR-----IRMKSFNKFHRL-DSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRXXXXXXXXXXXXAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNATFI 1447
            Y K  S  S +ND    + E    H ++R     +R+   +  H L +      DT  K QVY+CVVFLKIGEIDTIKEQ+ AD+++K+KWREP LD   + L YDW+  W+PKLY+ENT+G+ +EHVY MITFNEF HAFLCEKRRVSGVFLENLELNHFPFDVQDLTI VA+ L +SEIRLVNDPDE HRINKQSFVDEQEW+LYK+IE+EQ+++ +EY D  +VRPAL V+CRAARRPAYF+WN+FLVTFLICSLSLVTFAVDK LPQNRLQL+YTLVLTL+AFKFVVNQCLPKISYLTYLDKY+IS+LF LTL+C WHGL+VVI ++  R    + +++E+YV+I +++GY  YN+ F+++IY VA KRRR M + DKEY+EKVQCQ+K KG R  RM QQT Q+HEVK NG+  FI
Sbjct:   18 YRKRSSGSSQNNDSEFSVYEI---HQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTVFI 435          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GABRG34.358e-624.49gamma-aminobutyric acid type A receptor gamma3 sub... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lgc-81.793e-622.96Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL... [more]
lgc-534.123e-623.36Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg11.195e-623.10gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg11.259e-622.92gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg22.397e-624.09gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
gabrg22.763e-624.09gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
gabrg22.763e-624.09gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GABRG23.579e-724.84gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
GABRG24.538e-724.84gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gabrg33.551e-724.83gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P0C7B7|ELIC_DICCH8.739e-1023.74Cys-loop ligand-gated ion channel OS=Dickeya chrys... [more]
sp|P28473|GBRG3_RAT2.378e-624.83Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|P27681|GBRG3_MOUSE2.484e-624.83Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J6K70.000e+076.38Neur_chan_LBD domain-containing protein OS=Schisto... [more]
A0A2T7Q0043.364e-11953.07Neur_chan_LBD domain-containing protein OS=Pomacea... [more]
A0A210Q1431.521e-11852.05Cys-loop ligand-gated ion channel OS=Mizuhopecten ... [more]
A0A1S3HM706.820e-11553.89uncharacterized protein LOC106156405 isoform X5 OS... [more]
A0A2C9MAB61.208e-11449.74Neur_chan_LBD domain-containing protein OS=Biompha... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GABRG35.032e-623.15gamma-aminobutyric acid type A receptor gamma3 sub... [more]
gabrg29.178e-624.21gamma-aminobutyric acid type A receptor gamma2 sub... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glra4a4.273e-721.84glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327902.976e-3227.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268593.258e-1430.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385971.436e-923.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375554.914e-823.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420542.224e-620.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gabrg13.066e-723.10gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg21.243e-625.70gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg21.339e-625.70gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg21.522e-625.70gamma-aminobutyric acid type A receptor gamma2 sub... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066647.10.000e+0100.00SMESG000066647.1[more]
SMESG000066647.10.000e+099.45SMESG000066647.1[more]
SMESG000021796.10.000e+068.63SMESG000021796.1[more]
SMESG000039749.10.000e+065.08SMESG000039749.1[more]
SMESG000039749.10.000e+065.08SMESG000039749.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030117 ID=SMED30030117|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1509bp
CATGTAAGGGAGGAGAATAAATACGAAAAAAAAGCTACGCATGATTACCA
CTCGGCTTTTGAAAGCGCATTCCAGTCCCCTTCATTTGCAACCGGAATCT
ATTTCACACCAGCCGTTTCTGCCGGCATCTGGATTTCTTCCGAACGACGA
AGATGAAGACACTCGGTTGGATATTGAGTTTGAATCTATTCGCAATGCAT
CATATACGAAATCGGAGTCCACAAAATCTAACGACAACGACAGAGCTAGT
ATCATCAACGAAACCTTGTTTAATCATGCGAATAAGCGTATAAGGATGAA
GTCTTTCAATAAATTTCATAGATTGGACTCAAAATGCTTGAATGTTGACA
CCTCCATTAAGCATCAAGTTTATGTTTGCGTGGTTTTCCTGAAAATTGGG
GAAATAGACACTATCAAAGAGCAGTACGCGGCTGATGTCCTCATCAAATC
AAAATGGAGGGAACCAATGTTGGATAATCAAACAGAAACCTTGAAATATG
ATTGGGCGAATTCATGGAGTCCCAAATTGTACATTGAAAATACTATCGGA
GAAGCCAAAGAACATGTGTACCACATGATTACATTCAATGAGTTTAACCA
TGCGTTCCTATGCGAGAAAAGGCGAGTGTCTGGAGTATTTTTGGAGAATC
TCGAATTGAATCATTTTCCGTTTGATGTGCAGGATCTTACAATCACCGTC
GCCTCTAATCTACCAACATCCGAAATACGACTCGTGAATGATCCTGATGA
AACACATCGAATAAACAAACAATCCTTTGTTGATGAGCAAGAGTGGTATT
TGTACAAGCATATCGAAACCGAACAGAGGGAACTGGCATACGAATATACG
GATCTTGCCACAGTCCGCCCAGCTCTCTCTGTCAAGTGCAGAGCAGCCAG
GAGGCCAGCATATTTTATATGGAATATTTTTCTAGTAACTTTTCTCATCT
GTTCTCTCTCATTGGTGACTTTTGCCGTAGACAAGAAACTTCCACAAAAC
CGACTTCAGCTCACTTATACTCTTGTTTTAACACTTGTGGCTTTCAAATT
CGTTGTAAACCAATGCCTCCCAAAAATCTCCTACTTGACATATTTGGATA
AGTATGTGATTTCGAGCCTATTCATTTTAACTTTAATATGTTTGTGGCAT
GGCTTGATCGTTGTAATAGAAAAAGTGTCGGATCGGTTTAAATATGTAAT
TCCTGATGACATGGAGGTTTACGTTATCATTTTCATGGCAATCGGATACA
TGGGGTACAACATAGCATTCATTGTCATGATATATTGCGTGGCTTGCAAA
CGAAGGCGAGATATGATGCAAAGAGATAAAGAGTATGTGGAGAAAGTTCA
ATGCCAGATGAAATACAAAGGGATGCGTGCAATGAGGATGATCCAGCAGA
CCCATCAATTGCACGAAGTCAAAGAAAATGGGAACGCAACGTTTATATGA
CATTTCATCAGATTTAATCACCTTTCATCATTCAATATACAACTTTTTAC
CTAGTTCTC
back to top

protein sequence of SMED30030117-orf-1

>SMED30030117-orf-1 ID=SMED30030117-orf-1|Name=SMED30030117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=470bp
MITTRLLKAHSSPLHLQPESISHQPFLPASGFLPNDEDEDTRLDIEFESI
RNASYTKSESTKSNDNDRASIINETLFNHANKRIRMKSFNKFHRLDSKCL
NVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTET
LKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVF
LENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQ
EWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVT
FLICSLSLVTFAVDKKLPQNRLQLTYTLVLTLVAFKFVVNQCLPKISYLT
YLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMA
IGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRM
IQQTHQLHEVKENGNATFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR036719Neuro-gated_channel_TM_sf
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 99..281
e-value: 1.4E-17
score: 65.9
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 105..258
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 105..270
e-value: 3.0E-8
score: 33.4
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 289..416
e-value: 5.2E-19
score: 70.4
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 81..392
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 109..288
e-value: 6.53417E-18
score: 79.259
NoneNo IPR availableCDDcd19050LGIC_TM_bactcoord: 291..366
e-value: 4.06098E-17
score: 75.3226
NoneNo IPR availableTMHMMTMhelixcoord: 357..376
NoneNo IPR availableTMHMMTMhelixcoord: 322..344
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 396..418
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 81..392
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 289..382