ATP-dependent RNA helicase DDX3X

Overview
NameATP-dependent RNA helicase DDX3X
Smed IDSMED30030115
Length (bp)1982
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DDX3X (SMED30030115) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DDX3X (SMED30030115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase DDX3X (SMED30030115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DDX3X (SMED30030115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030115

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30030115h1SMcG0010144 Contig4698GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30030115h1SMcG0010144 Contig4698GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30030115h1SMcG0010144 Contig4698GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30030115h1SMcG0018295 Contig4698GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30030115h1SMcG0018295 Contig4698GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30030115h1SMcG0018295 Contig4698GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30030115h1SMcG0010144 dd_Smed_v4_3817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030115h1SMcG0010144 dd_Smed_v4_3817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30030115h1SMcG0010144 DN298916smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
musculature systemSMED30030115h1SMcG0010144 DN298916smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
nephridioporeSMED30030115h1SMcG0010144 DN298916smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30030115h1SMcG0010144 dd_Smed_v4_3817_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 290/476 (60.92%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPK-RYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP W    L++M +   ++   +   K R++ GFG RDYRQ
Sbjct:  122 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSW----LENMAYEHHYKGSSRGRSKSRFSGGFGARDYRQ 589          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 290/476 (60.92%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPK-RYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP W    L++M +   ++   +   K R++ GFG RDYRQ
Sbjct:  136 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSW----LENMAYEHHYKGSSRGRSKSRFSGGFGARDYRQ 603          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 290/476 (60.92%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPK-RYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP W    L++M +   ++   +   K R++ GFG RDYRQ
Sbjct:  136 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSW----LENMAYEHHYKGSSRGRSKSRFSGGFGARDYRQ 603          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 290/476 (60.92%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPK-RYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP W    L++M +   ++   +   K R++ GFG RDYRQ
Sbjct:  135 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSW----LENMAYEHHYKGSSRGRSKSRFSGGFGARDYRQ 602          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 290/476 (60.92%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPK-RYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP W    L++M +   ++   +   K R++ GFG RDYRQ
Sbjct:   97 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSW----LENMAYEHHYKGSSRGRSKSRFSGGFGARDYRQ 564          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: laf-1 (ATP-dependent RNA helicase laf-1 [Source:UniProtKB/Swiss-Prot;Acc:D0PV95])

HSP 1 Score: 457.603 bits (1176), Expect = 2.772e-153
Identity = 253/495 (51.11%), Postives = 337/495 (68.08%), Query Frame = 2
Query:   86 GYNVSRNKTQNKYPTDNFDNNERKSNGSXXXXXXXXXX----XXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPG----DSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISK-QINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNY-YIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDM 1540
            GYN     + N+    ++ NN+R+ NG    N     +    +   +KW  +   +  +E ELFS Q  G+NFD Y++IP+  TG D      Q I  F  L + + + +NI    Y +PTPVQK++IP +   RDLM+CAQTGSGKTAAFL+P++N I  +GP          G  +KQYP AL+L+PTREL+ QI+ E RKF+YR+ + S ++YGG +  K QI+ L  GC++L+ATPGRLID++ +  IG++  RYLVLDEADRMLDMGFEPQ+RQIVE + MP   +R T MFSATFPKEIQ LA DFL   Y+FLAVG VGS+S NI Q I ++EE  KR++L+ +L+      L L+FVETK+GA  L  +L ++++ V +IHGD KQ ERE  L  F+ G+ PILVATAVAARGLDIPNVK VIN+DLPSD++EYVHRIGRTGRVG++G + SFFND N N+ + L++++ EA QE+P WL     DM
Sbjct:   75 GYNNRDEGSDNRGSGRSY-NNDRRDNGGDGQNTRWNNLDAPPSRGTSKWENRGARDERIEQELFSGQLSGINFDKYEEIPVEATGDDVP----QPISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKNRNIARELMDLIVEANQELPDWLEGMSGDM 564          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: laf-1 (ATP-dependent RNA helicase laf-1 [Source:UniProtKB/Swiss-Prot;Acc:D0PV95])

HSP 1 Score: 457.218 bits (1175), Expect = 2.775e-152
Identity = 253/495 (51.11%), Postives = 337/495 (68.08%), Query Frame = 2
Query:   86 GYNVSRNKTQNKYPTDNFDNNERKSNGSXXXXXXXXXX----XXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPG----DSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISK-QINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNY-YIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDM 1540
            GYN     + N+    ++ NN+R+ NG    N     +    +   +KW  +   +  +E ELFS Q  G+NFD Y++IP+  TG D      Q I  F  L + + + +NI    Y +PTPVQK++IP +   RDLM+CAQTGSGKTAAFL+P++N I  +GP          G  +KQYP AL+L+PTREL+ QI+ E RKF+YR+ + S ++YGG +  K QI+ L  GC++L+ATPGRLID++ +  IG++  RYLVLDEADRMLDMGFEPQ+RQIVE + MP   +R T MFSATFPKEIQ LA DFL   Y+FLAVG VGS+S NI Q I ++EE  KR++L+ +L+      L L+FVETK+GA  L  +L ++++ V +IHGD KQ ERE  L  F+ G+ PILVATAVAARGLDIPNVK VIN+DLPSD++EYVHRIGRTGRVG++G + SFFND N N+ + L++++ EA QE+P WL     DM
Sbjct:  140 GYNNRDEGSDNRGSGRSY-NNDRRDNGGDGQNTRWNNLDAPPSRGTSKWENRGARDERIEQELFSGQLSGINFDKYEEIPVEATGDDVP----QPISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKNRNIARELMDLIVEANQELPDWLEGMSGDM 629          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 423.705 bits (1088), Expect = 5.901e-140
Identity = 232/434 (53.46%), Postives = 302/434 (69.59%), Query Frame = 2
Query:  251 ENELFSHQEPGVNFDDYDDIPILTTGPD----FDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPG---NYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGG-ADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFL-NYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            E+ LF   + G+NFD Y++IP+  +G       +H N  G FG         + +N++   Y KPTPVQK +IP +L  RDLM+CAQTGSGKTAAFL+PI+  I   GP   + P         YP AL+L+PTRELA QI++E  KFSY+S +++ ++YGG  +   Q+N L  G ++L+ATPGRLID++++  IGL   RYLVLDEADRMLDMGFEPQ+R+IV    MP    R T MFSATFPKEIQ LA DFL + YIFLAVG VGS+S NI Q + ++ E  KR++L++IL     E+LVL+FVETK+GA +L  FL ++     SIHGD KQ+ERE  L+ F++G  PILVATAVAARGLDIPNV+ VIN+DLP D +EYVHRIGRTGR G+LG + SFFND N  + + L N++ E+ QEVP WL++
Sbjct:   90 ESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAG-FG-------PAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIV-GQGMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIVESNQEVPEWLHQ 514          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 423.705 bits (1088), Expect = 5.901e-140
Identity = 232/434 (53.46%), Postives = 302/434 (69.59%), Query Frame = 2
Query:  251 ENELFSHQEPGVNFDDYDDIPILTTGPD----FDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPG---NYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGG-ADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFL-NYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            E+ LF   + G+NFD Y++IP+  +G       +H N  G FG         + +N++   Y KPTPVQK +IP +L  RDLM+CAQTGSGKTAAFL+PI+  I   GP   + P         YP AL+L+PTRELA QI++E  KFSY+S +++ ++YGG  +   Q+N L  G ++L+ATPGRLID++++  IGL   RYLVLDEADRMLDMGFEPQ+R+IV    MP    R T MFSATFPKEIQ LA DFL + YIFLAVG VGS+S NI Q + ++ E  KR++L++IL     E+LVL+FVETK+GA +L  FL ++     SIHGD KQ+ERE  L+ F++G  PILVATAVAARGLDIPNV+ VIN+DLP D +EYVHRIGRTGR G+LG + SFFND N  + + L N++ E+ QEVP WL++
Sbjct:   90 ESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAG-FG-------PAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIV-GQGMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIVESNQEVPEWLHQ 514          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 423.705 bits (1088), Expect = 5.901e-140
Identity = 232/434 (53.46%), Postives = 302/434 (69.59%), Query Frame = 2
Query:  251 ENELFSHQEPGVNFDDYDDIPILTTGPD----FDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPG---NYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGG-ADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFL-NYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            E+ LF   + G+NFD Y++IP+  +G       +H N  G FG         + +N++   Y KPTPVQK +IP +L  RDLM+CAQTGSGKTAAFL+PI+  I   GP   + P         YP AL+L+PTRELA QI++E  KFSY+S +++ ++YGG  +   Q+N L  G ++L+ATPGRLID++++  IGL   RYLVLDEADRMLDMGFEPQ+R+IV    MP    R T MFSATFPKEIQ LA DFL + YIFLAVG VGS+S NI Q + ++ E  KR++L++IL     E+LVL+FVETK+GA +L  FL ++     SIHGD KQ+ERE  L+ F++G  PILVATAVAARGLDIPNV+ VIN+DLP D +EYVHRIGRTGR G+LG + SFFND N  + + L N++ E+ QEVP WL++
Sbjct:   90 ESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAG-FG-------PAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIV-GQGMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIVESNQEVPEWLHQ 514          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: bel (gene:FBgn0263231 transcript:FBtr0334319)

HSP 1 Score: 508.064 bits (1307), Expect = 1.330e-170
Identity = 267/445 (60.00%), Postives = 335/445 (75.28%), Query Frame = 2
Query:  239 NRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEG---PGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLE--PE----DLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKH 1546
            +  LE ELF     G+NFD Y+DIP+  TG +   +    I  F+ +++T+I+R+N++L  Y KPTPVQK AIPII+  RDLMACAQTGSGKTAAFL+PILN +Y  G   P  S    +  KQYP+ L+LAPTRELA QI+EE +KF+YRS++R  V+YGG + S+Q+  L RGC+L+VATPGRL DM+ R K+GL+ IR+LVLDEADRMLDMGFEPQ+R+IVE  +MP  G RQTLMFSATFPK+IQ LA+DFL+ YIFLAVG VGS+S NITQ I ++ E  KR++LL +L+ +   PE     L LIFVETKKGA  LE FL Q + PVTSIHGDR Q ERE AL+CF++G  PILVATAVAARGLDIP+VK VINFDLPSD+EEYVHRIGRTGR+G+LG + SFFN+ N N+   L+ +L E +QE+P ++ +   D  H
Sbjct:  258 DERLEVELFGVGNTGINFDKYEDIPVEATGQNVPPN----ITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSATFPKQIQELASDFLSNYIFLAVGRVGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDSLTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKNRNICSDLLELLIETKQEIPSFMEDMSSDRGH 698          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: bel (gene:FBgn0263231 transcript:FBtr0081888)

HSP 1 Score: 507.679 bits (1306), Expect = 1.370e-170
Identity = 267/445 (60.00%), Postives = 335/445 (75.28%), Query Frame = 2
Query:  239 NRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEG---PGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLE--PE----DLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKH 1546
            +  LE ELF     G+NFD Y+DIP+  TG +   +    I  F+ +++T+I+R+N++L  Y KPTPVQK AIPII+  RDLMACAQTGSGKTAAFL+PILN +Y  G   P  S    +  KQYP+ L+LAPTRELA QI+EE +KF+YRS++R  V+YGG + S+Q+  L RGC+L+VATPGRL DM+ R K+GL+ IR+LVLDEADRMLDMGFEPQ+R+IVE  +MP  G RQTLMFSATFPK+IQ LA+DFL+ YIFLAVG VGS+S NITQ I ++ E  KR++LL +L+ +   PE     L LIFVETKKGA  LE FL Q + PVTSIHGDR Q ERE AL+CF++G  PILVATAVAARGLDIP+VK VINFDLPSD+EEYVHRIGRTGR+G+LG + SFFN+ N N+   L+ +L E +QE+P ++ +   D  H
Sbjct:  258 DERLEVELFGVGNTGINFDKYEDIPVEATGQNVPPN----ITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSATFPKQIQELASDFLSNYIFLAVGRVGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDSLTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKNRNICSDLLELLIETKQEIPSFMEDMSSDRGH 698          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445187)

HSP 1 Score: 376.711 bits (966), Expect = 1.350e-121
Identity = 201/423 (47.52%), Postives = 286/423 (67.61%), Query Frame = 2
Query:  257 ELFSHQ-EPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKG-LINVLEEAQQEVPVWL 1519
            E+FS     G++F  Y++IP+  TG D      Q I  F    +  I+ DN++   Y  PTP+QK +IP+I   RDLMACAQTGSGKTAAFL+PIL+ +  +       P   E   P  +I++PTRELA QI+ E RKF++ S ++  +VYGG     Q   ++RGC++++ATPGRL+D + R  I  +  R++VLDEADRMLDMGF   +R+I+    M    + QTLMFSATFP+EIQ +A +FL  Y+F+A+GIVG +  ++ Q I+ + ++ KR+ L++IL+  E  D  ++FVETK+GA  L +FL +++FP TSIHGDR Q +RE AL+ FKNGS+ +L+AT+VA+RGLDI N+K VIN+D+PS I++YVHRIGRTGRVG+ G + SFF+      +   L+ +LE + Q VP +L
Sbjct:  213 EIFSSGIASGIHFSKYNNIPVKVTGSDVP----QPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLED-------PHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRP--EHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILS--EQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFL 620          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445185)

HSP 1 Score: 376.711 bits (966), Expect = 1.350e-121
Identity = 201/423 (47.52%), Postives = 286/423 (67.61%), Query Frame = 2
Query:  257 ELFSHQ-EPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKG-LINVLEEAQQEVPVWL 1519
            E+FS     G++F  Y++IP+  TG D      Q I  F    +  I+ DN++   Y  PTP+QK +IP+I   RDLMACAQTGSGKTAAFL+PIL+ +  +       P   E   P  +I++PTRELA QI+ E RKF++ S ++  +VYGG     Q   ++RGC++++ATPGRL+D + R  I  +  R++VLDEADRMLDMGF   +R+I+    M    + QTLMFSATFP+EIQ +A +FL  Y+F+A+GIVG +  ++ Q I+ + ++ KR+ L++IL+  E  D  ++FVETK+GA  L +FL +++FP TSIHGDR Q +RE AL+ FKNGS+ +L+AT+VA+RGLDI N+K VIN+D+PS I++YVHRIGRTGRVG+ G + SFF+      +   L+ +LE + Q VP +L
Sbjct:  213 EIFSSGIASGIHFSKYNNIPVKVTGSDVP----QPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLED-------PHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRP--EHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILS--EQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFL 620          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445186)

HSP 1 Score: 376.711 bits (966), Expect = 1.350e-121
Identity = 201/423 (47.52%), Postives = 286/423 (67.61%), Query Frame = 2
Query:  257 ELFSHQ-EPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKG-LINVLEEAQQEVPVWL 1519
            E+FS     G++F  Y++IP+  TG D      Q I  F    +  I+ DN++   Y  PTP+QK +IP+I   RDLMACAQTGSGKTAAFL+PIL+ +  +       P   E   P  +I++PTRELA QI+ E RKF++ S ++  +VYGG     Q   ++RGC++++ATPGRL+D + R  I  +  R++VLDEADRMLDMGF   +R+I+    M    + QTLMFSATFP+EIQ +A +FL  Y+F+A+GIVG +  ++ Q I+ + ++ KR+ L++IL+  E  D  ++FVETK+GA  L +FL +++FP TSIHGDR Q +RE AL+ FKNGS+ +L+AT+VA+RGLDI N+K VIN+D+PS I++YVHRIGRTGRVG+ G + SFF+      +   L+ +LE + Q VP +L
Sbjct:  213 EIFSSGIASGIHFSKYNNIPVKVTGSDVP----QPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLED-------PHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRP--EHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILS--EQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFL 620          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx3xa (DEAD-box helicase 3 X-linked a [Source:ZFIN;Acc:ZDB-GENE-030131-1565])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 293/481 (60.91%), Postives = 358/481 (74.43%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQG-IFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS---------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W   MP N  LE+ELFS    G+NF+ YDDIP+  TG      N  G I  F  + M +I+  NI+L  Y +PTPVQK+AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY EGPG++         Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL + +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PI+VATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SF+ND N N+ K L+++L EA+QEVP W    L+++ +  Q ++  +  PKR++ GFG RDYRQ
Sbjct:  179 WSKPMPPNERLEHELFSASNTGINFEKYDDIPVEATGT-----NSPGHIESFHDVDMGEIIMGNITLSRYTRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSEGPGEALQATKASTQQENGKYVRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGSRQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEENDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSW----LENLAYEHQHKSTNRGRPKRFSGGFGARDYRQ 650          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 294/479 (61.38%), Postives = 355/479 (74.11%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W   +P N  LE+ELFS    G+NF+ YDDIP+  TG    H+  Q I  F  L+M +I+  NI+L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPG++        Q  G Y   KQYP++L+LAPTRELA QIY+E RKFSYRS VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ K L+++L EA+QEVP W    L+ + +  Q ++  +   KR++ GFG RDYRQ
Sbjct:  164 WSKPLPPNERLEHELFSGSNTGINFEKYDDIPVEATG----HNGPQPIDRFHDLEMGEIIMGNINLSRYTRPTPVQKHAIPIIKSKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQAAKNSAQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFSYRSHVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGLRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEENDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNGNITKDLLDILVEAKQEVPSW----LESLAYEHQHKSSSRGRSKRFSGGFGARDYRQ 634          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 420.624 bits (1080), Expect = 4.214e-138
Identity = 233/472 (49.36%), Postives = 303/472 (64.19%), Query Frame = 2
Query:  254 NELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNY-YIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXX-XXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPNPQPFQT 1663
            + +FSH   G+NFD YDDI +  +G     +  + I  FE   +   +  N+S   Y KPTPVQK  IPII   RDLMACAQTGSGKTAAFL+PIL     +G   S+     E Q P A+I+APTREL  QIY E RKF+Y + VR  VVYGG +    I  + +GCN+L ATPGRL D++ R KIGL  +RYLVLDEADRMLDMGFEP++R++V    MP   +RQTLMFSAT+P++IQ +AADFL   YIFLAVG+VG +  ++ Q I  ++++ KR+ LL++L +    +  ++FVETK+ A  +  FL Q     TSIHGDR+Q ERE AL  F+ G  P+LVAT+VAARGLDI  V+ V+NFD+PS I+EYVHRIGRTGR G+ G +VSFFN +++  + + L+ VL  AQQ VP WL E          F  + K+       F   D R+    +   P P QT
Sbjct:  216 SSIFSHYATGINFDKYDDILVDVSG----SNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFS---EIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVASPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELL-RATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEVAFSAHGTTGFNPRGKV-------FASTDSRKGGSFKSDEPPPSQT 672          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 420.624 bits (1080), Expect = 4.338e-138
Identity = 233/472 (49.36%), Postives = 303/472 (64.19%), Query Frame = 2
Query:  254 NELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNY-YIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXX-XXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPNPQPFQT 1663
            + +FSH   G+NFD YDDI +  +G     +  + I  FE   +   +  N+S   Y KPTPVQK  IPII   RDLMACAQTGSGKTAAFL+PIL     +G   S+     E Q P A+I+APTREL  QIY E RKF+Y + VR  VVYGG +    I  + +GCN+L ATPGRL D++ R KIGL  +RYLVLDEADRMLDMGFEP++R++V    MP   +RQTLMFSAT+P++IQ +AADFL   YIFLAVG+VG +  ++ Q I  ++++ KR+ LL++L +    +  ++FVETK+ A  +  FL Q     TSIHGDR+Q ERE AL  F+ G  P+LVAT+VAARGLDI  V+ V+NFD+PS I+EYVHRIGRTGR G+ G +VSFFN +++  + + L+ VL  AQQ VP WL E          F  + K+       F   D R+    +   P P QT
Sbjct:  217 SSIFSHYATGINFDKYDDILVDVSG----SNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFS---EIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVASPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELL-RATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEVAFSAHGTTGFNPRGKV-------FASTDSRKGGSFKSDEPPPSQT 673          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 421.009 bits (1081), Expect = 4.963e-138
Identity = 233/472 (49.36%), Postives = 303/472 (64.19%), Query Frame = 2
Query:  254 NELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNY-YIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXX-XXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPNPQPFQT 1663
            + +FSH   G+NFD YDDI +  +G     +  + I  FE   +   +  N+S   Y KPTPVQK  IPII   RDLMACAQTGSGKTAAFL+PIL     +G   S+     E Q P A+I+APTREL  QIY E RKF+Y + VR  VVYGG +    I  + +GCN+L ATPGRL D++ R KIGL  +RYLVLDEADRMLDMGFEP++R++V    MP   +RQTLMFSAT+P++IQ +AADFL   YIFLAVG+VG +  ++ Q I  ++++ KR+ LL++L +    +  ++FVETK+ A  +  FL Q     TSIHGDR+Q ERE AL  F+ G  P+LVAT+VAARGLDI  V+ V+NFD+PS I+EYVHRIGRTGR G+ G +VSFFN +++  + + L+ VL  AQQ VP WL E          F  + K+       F   D R+    +   P P QT
Sbjct:  228 SSIFSHYATGINFDKYDDILVDVSG----SNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFS---EIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVASPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELL-RATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEVAFSAHGTTGFNPRGKV-------FASTDSRKGGSFKSDEPPPSQT 684          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 289/474 (60.97%), Postives = 350/474 (73.84%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +  N  +E ELFS    G+NF+ YDDIP+  TG    ++    I  F+ + M +I+  NI L  Y +PTPVQK AIPII+++RDLMACAQTGSGKTAAFL+PIL+ IY +GPGD+    +  G Y   KQ+P++L+LAPTRELA QIYEE RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL     +  H    R + K   +   GFG RDYRQ
Sbjct:  131 WSKPLAPNDRVEQELFSGSNTGINFEKYDDIPVEATG----NNCPPHIESFQDVTMGEIIMGNIQLSRYTRPTPVQKHAIPIIIEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLDEYIFLAVGRVGSTSENITQKVVWVEEMDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNINITKDLLDLLVEAKQEVPSWLENMAYEQHHKSSTRGRSK--SRFSGGFGARDYRQ 598          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 289/474 (60.97%), Postives = 350/474 (73.84%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +  N  +E ELFS    G+NF+ YDDIP+  TG    ++    I  F+ + M +I+  NI L  Y +PTPVQK AIPII+++RDLMACAQTGSGKTAAFL+PIL+ IY +GPGD+    +  G Y   KQ+P++L+LAPTRELA QIYEE RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL     +  H    R + K   +   GFG RDYRQ
Sbjct:  199 WSKPLAPNDRVEQELFSGSNTGINFEKYDDIPVEATG----NNCPPHIESFQDVTMGEIIMGNIQLSRYTRPTPVQKHAIPIIIEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLDEYIFLAVGRVGSTSENITQKVVWVEEMDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNINITKDLLDLLVEAKQEVPSWLENMAYEQHHKSSTRGRSK--SRFSGGFGARDYRQ 666          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 289/474 (60.97%), Postives = 350/474 (73.84%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +  N  +E ELFS    G+NF+ YDDIP+  TG    ++    I  F+ + M +I+  NI L  Y +PTPVQK AIPII+++RDLMACAQTGSGKTAAFL+PIL+ IY +GPGD+    +  G Y   KQ+P++L+LAPTRELA QIYEE RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL     +  H    R + K   +   GFG RDYRQ
Sbjct:  202 WSKPLAPNDRVEQELFSGSNTGINFEKYDDIPVEATG----NNCPPHIESFQDVTMGEIIMGNIQLSRYTRPTPVQKHAIPIIIEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLDEYIFLAVGRVGSTSENITQKVVWVEEMDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNINITKDLLDLLVEAKQEVPSWLENMAYEQHHKSSTRGRSK--SRFSGGFGARDYRQ 669          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 289/474 (60.97%), Postives = 350/474 (73.84%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +  N  +E ELFS    G+NF+ YDDIP+  TG    ++    I  F+ + M +I+  NI L  Y +PTPVQK AIPII+++RDLMACAQTGSGKTAAFL+PIL+ IY +GPGD+    +  G Y   KQ+P++L+LAPTRELA QIYEE RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL     +  H    R + K   +   GFG RDYRQ
Sbjct:  133 WSKPLAPNDRVEQELFSGSNTGINFEKYDDIPVEATG----NNCPPHIESFQDVTMGEIIMGNIQLSRYTRPTPVQKHAIPIIIEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLDEYIFLAVGRVGSTSENITQKVVWVEEMDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNINITKDLLDLLVEAKQEVPSWLENMAYEQHHKSSTRGRSK--SRFSGGFGARDYRQ 600          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 289/474 (60.97%), Postives = 350/474 (73.84%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +  N  +E ELFS    G+NF+ YDDIP+  TG    ++    I  F+ + M +I+  NI L  Y +PTPVQK AIPII+++RDLMACAQTGSGKTAAFL+PIL+ IY +GPGD+    +  G Y   KQ+P++L+LAPTRELA QIYEE RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL     +  H    R + K   +   GFG RDYRQ
Sbjct:  104 WSKPLAPNDRVEQELFSGSNTGINFEKYDDIPVEATG----NNCPPHIESFQDVTMGEIIMGNIQLSRYTRPTPVQKHAIPIIIEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLDEYIFLAVGRVGSTSENITQKVVWVEEMDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNINITKDLLDLLVEAKQEVPSWLENMAYEQHHKSSTRGRSK--SRFSGGFGARDYRQ 571          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx3y (DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked [Source:MGI Symbol;Acc:MGI:1349406])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 290/475 (61.05%), Postives = 351/475 (73.89%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQT 1624
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGAD  +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LENFL Q  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL     +  +    R + K   +   GFG RDYRQ+
Sbjct:  135 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIENFSDIEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADTVQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEELDKRSFLLDLLNATGKDSLTLVFVETKKGADSLENFLFQERYACTSIHGDRSQKDREEALHQFRSGRKPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNLNITKDLLDLLVEAKQEVPSWLESMAYEHHYKGSSRGRSK--SRFSGGFGARDYRQS 603          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: D1Pas1 (DNA segment, Chr 1, Pasteur Institute 1 [Source:MGI Symbol;Acc:MGI:91842])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 291/475 (61.26%), Postives = 354/475 (74.53%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L+L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL E +    H K     +  +  R++ GFG RDYRQ
Sbjct:  135 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEADKRSFLLDLLNATGKDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWL-ENMAFEHHYKG--GSRGRSKSRFSGGFGARDYRQ 602          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx3x (DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked [Source:MGI Symbol;Acc:MGI:103064])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 289/474 (60.97%), Postives = 351/474 (74.05%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGA+I +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL E +    H K     +  + +   GFG RDYRQ
Sbjct:  136 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWL-ENMAFEHHYKGSSRGRSKSSRFSGGFGARDYRQ 604          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 416.001 bits (1068), Expect = 4.742e-136
Identity = 217/424 (51.18%), Postives = 293/424 (69.10%), Query Frame = 2
Query:  260 LFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFL-NYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXX-XXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            +F+H + G+NFD YD I +  +G    HD    I  FE   + + + +NI+   Y K TPVQK++IPI+L  RDLMACAQTGSGKTAAFL+PIL  +  +G   S+     E Q P  +I+APTREL  QIY E RKFS+ + VR+ V+YGG      +  + +GCN+L ATPGRL+D++ ++KIGL+ ++YLVLDEADRMLDMGF P++++++    MP    RQTL+FSATFP+EIQ LA DFL + Y+F+AVG VG +  ++ Q I  + ++ KR  L++IL  +  E   ++FVETKK A  +  FL Q     TSIHGDR+Q ERE AL  F+ G  P+LVAT+VAARGLDI NV+ VINFDLPS I+EYVHRIGRTGR G+ G ++S F  D++ ++ + L+ VL +AQQ+VP WL E
Sbjct:  231 IFAHYQTGINFDKYDTILVEVSG----HDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFK---ELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIGDE-RTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEE 646          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 415.616 bits (1067), Expect = 1.392e-135
Identity = 217/424 (51.18%), Postives = 293/424 (69.10%), Query Frame = 2
Query:  260 LFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFL-NYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXX-XXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            +F+H + G+NFD YD I +  +G    HD    I  FE   + + + +NI+   Y K TPVQK++IPI+L  RDLMACAQTGSGKTAAFL+PIL  +  +G   S+     E Q P  +I+APTREL  QIY E RKFS+ + VR+ V+YGG      +  + +GCN+L ATPGRL+D++ ++KIGL+ ++YLVLDEADRMLDMGF P++++++    MP    RQTL+FSATFP+EIQ LA DFL + Y+F+AVG VG +  ++ Q I  + ++ KR  L++IL  +  E   ++FVETKK A  +  FL Q     TSIHGDR+Q ERE AL  F+ G  P+LVAT+VAARGLDI NV+ VINFDLPS I+EYVHRIGRTGR G+ G ++S F  D++ ++ + L+ VL +AQQ+VP WL E
Sbjct:  257 IFAHYQTGINFDKYDTILVEVSG----HDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFK---ELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIGDE-RTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEE 672          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|Q62095|DDX3Y_MOUSE (ATP-dependent RNA helicase DDX3Y OS=Mus musculus OX=10090 GN=Ddx3y PE=1 SV=2)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 290/475 (61.05%), Postives = 351/475 (73.89%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQT 1624
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGAD  +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LENFL Q  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL     +  +    R + K   +   GFG RDYRQ+
Sbjct:  135 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIENFSDIEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADTVQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEELDKRSFLLDLLNATGKDSLTLVFVETKKGADSLENFLFQERYACTSIHGDRSQKDREEALHQFRSGRKPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNLNITKDLLDLLVEAKQEVPSWLESMAYEHHYKGSSRGRSK--SRFSGGFGARDYRQS 603          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|P16381|DDX3L_MOUSE (Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus OX=10090 GN=D1Pas1 PE=1 SV=1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 291/475 (61.26%), Postives = 354/475 (74.53%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L+L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL E +    H K     +  +  R++ GFG RDYRQ
Sbjct:  135 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEADKRSFLLDLLNATGKDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWL-ENMAFEHHYKG--GSRGRSKSRFSGGFGARDYRQ 602          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|Q5RF43|DDX3Y_PONAB (ATP-dependent RNA helicase DDX3Y OS=Pongo abelii OX=9601 GN=DDX3Y PE=2 SV=1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 287/475 (60.42%), Postives = 351/475 (73.89%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG +        I  F  + M +I+  NI L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++E+  KR+ LL +L     + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NV+ VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP W    L++M +   ++   +   KR++ GFG RDYRQ
Sbjct:  134 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPH----IENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDLLGATGRDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSW----LENMAYEHHYKGGSRGRSKRFSGGFGARDYRQ 600          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|O15523|DDX3Y_HUMAN (ATP-dependent RNA helicase DDX3Y OS=Homo sapiens OX=9606 GN=DDX3Y PE=1 SV=2)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 288/474 (60.76%), Postives = 347/474 (73.21%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG +        I  F  + M +I+  NI L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++E+  KR+ LL IL     + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NV+ VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL E +    H K     +  + +   GFG RDYRQ
Sbjct:  134 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPH----IENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSWL-ENMAYEHHYKGGSRGRSKSNRFSGGFGARDYRQ 602          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|O00571|DDX3X_HUMAN (ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 290/474 (61.18%), Postives = 351/474 (74.05%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS----QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W   +P +  LE ELFS    G+NF+ YDDIP+  TG    ++    I  F  ++M +I+  NI L  Y +PTPVQK AIPII ++RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++    +  G Y   KQYP++L+LAPTRELA QIYEE RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL F +YLVLDEADRMLDMGFEPQ+R+IVE   MP  G R T+MFSATFPKEIQ LA DFL+ YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL    +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFN+ N+N+ K L+++L EA+QEVP WL E +    H K     +  + +   GFG RDYRQ
Sbjct:  136 WSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATG----NNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWL-ENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQ 604          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: O97031 (DjVLGA OS=Dugesia japonica OX=6161 GN=DjvlgA PE=2 SV=1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 302/505 (59.80%), Postives = 371/505 (73.47%), Query Frame = 2
Query:   26 NMAQRNKDSYNDSNRPQWNRGYNVSRNKTQNKYPTDNFDNNER---KSNGSXXXXXXXXXXXXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKL 1531
            + ++  KD  N +N     R Y+  R+  +    T+ FDN++    +SN S +              W  Q P N  LE ELF  Q  G+NFD YD+IP+ TTGP + HD Y G+  F  LK+  I+  NISL  Y +PTPVQ++A+PII+QRRDLMACAQTGSGKTAAFLIP+L+M+Y +GPG+S     Y+K+YPVALILAPTRELA QIY+E RKFSYRS VR CVVYGG DI  Q+ ++S+GCN+LVATPGRL DML+R KIGL  IRYLVLDEADRMLDMGFEPQ+R+IVE ++MP  G RQTLMFSATFP+EIQ LA+DFL  Y+FL VG VGS+S NITQ I Y++E  KR+HLL IL  ++ + L+L+FVETK+GA  LE FL      V SIHGDR Q +RE AL+ F+ GS PILVAT VAARGLDIPNVK VIN+DLP+DIEEYVHRIGRTGRVG+LGE++SF+ D N NV K L+++L EA Q VP WL +K+
Sbjct:  107 DWSRNQKDKMNRTNSSDSTRPYSTQRS-FEGPSRTNRFDNDDSFYSRSNFSSIAEA----------SWDAQQPQNLRLEKELFIGQNSGINFDQYDNIPVNTTGPQWSHDGYTGVTSFLELKLHPIVSHNISLTQYTRPTPVQRYAVPIIMQRRDLMACAQTGSGKTAAFLIPLLSMMYQDGPGNSLSHSGYKKEYPVALILAPTRELAVQIYDEARKFSYRSLVRPCVVYGGRDIRGQLQDISQGCNMLVATPGRLSDMLERCKIGLDCIRYLVLDEADRMLDMGFEPQIRKIVEQTNMPPPGQRQTLMFSATFPREIQMLASDFLKDYLFLRVGKVGSTSQNITQRIVYVDENEKRDHLLDILTDIDSDSLILVFVETKRGADALEGFLHTEGSCVASIHGDRSQSDRELALQSFREGSTPILVATRVAARGLDIPNVKFVINYDLPTDIEEYVHRIGRTGRVGNLGEAISFYTDKNNNVAKELVDILLEANQIVPDWLRDKI 600          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: C1LFN9 (ATP-dependent RNA helicase DDX3X OS=Schistosoma japonicum OX=6182 GN=EWB00_003418 PE=2 SV=1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 305/527 (57.87%), Postives = 367/527 (69.64%), Query Frame = 2
Query:   80 NRGYNVSRNKTQNKYPTDNFDNNERKSNG--SXXXXXXXXXXXXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS---QIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPN 1645
            NRG  V     Q+      F+ N +   G  +   N      N+    W  Q+P N   E ELF     G+NF+ YD+IP+  TGPDF +DN   I  F  L + KI+RDN+ L NY +PTPVQK AIPII   RDLMACAQTGSGKTAAFLIPILN +  +GPGDS    I  N  KQ+PVALILAPTRELA QI+++ RKFSYRS +R CV+YGGAD+  Q+  LS+GCN+LVATPGRL D+L+R ++GL + R+LVLDEADRMLDMGFEPQ+R+IVE   +P  G+RQTLMFSATFP EIQ LA DFL+ YIFL VG VGS+S NITQ I ++EE  KR+ L+ +L   E   L L+FVETK+GA  LEN+L  + F V SIHGDR Q +RE AL CF++G  P+LVATAVAARGLDIPNVK VIN+DLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ +GL+ +LEEA Q VP WL     D +      + Q+    R  GFG RDYRQT P R  N
Sbjct:   78 NRGAKVGGEWQQSDSRWSTFNGNTQSRGGYPTSGTNVPRRTWNSPTEDWTQQLPRNERTEQELFKKVSAGINFNQYDNIPVNATGPDF-NDNASTISSFTELSLHKIVRDNVELANYERPTPVQKHAIPIIASGRDLMACAQTGSGKTAAFLIPILNNMIKQGPGDSICATIDSNRRKQFPVALILAPTRELASQIFDDARKFSYRSSIRPCVLYGGADMRTQLMELSKGCNVLVATPGRLSDVLERGRVGLDYCRFLVLDEADRMLDMGFEPQIRRIVEQDALPPSGERQTLMFSATFPHEIQILAKDFLSSYIFLTVGRVGSTSENITQTILWVEENAKRDALIDLLANSEAGTLTLVFVETKRGADALENYLYSQKFQVASIHGDRTQEDRELALSCFRSGRTPVLVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNRNLARGLVELLEEANQAVPPWLKALTGDGRPT----SFQRPRSNRRGGFGARDYRQT-PSRGGN 598          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: G4LVC7 (DEAD box ATP-dependent RNA helicase, putative OS=Schistosoma mansoni OX=6183 GN=Smp_033710 PE=3 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 303/527 (57.50%), Postives = 372/527 (70.59%), Query Frame = 2
Query:   80 NRGYNVS--RNKTQNKYPTDNFDNNERKSNGSXXXXXXXXXXXXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS---QIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPN 1645
            NRG  V   R ++ +++ + N +   R  + +  +N      N+    W  Q+P N   E ELF     G+NF+ YD+IP+  TGP+F+ D+   I  F  L + KI+RDN+ L NY +PTPVQK AIPII   RDLMACAQTGSGKTAAFLIPILN +  +GPGDS    I  N  KQ+PVALILAPTRELA QI+++ RKFSYRS +R CV+YGGAD+  Q+  LS GCNLLVATPGRL D+L+R ++GL + R+LVLDEADRMLDMGFEPQ+R+IVE   +P  G+RQTLMFSATFP EIQ LA DFLN YIFL VG VGS+S NITQ I ++EE  KR+ L+ +L   E   L+L+FVET++GA  LEN+L  + F V SIHGDR Q +RE AL CF++G  P+LVATAVAARGLDIPNVK VIN+DLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ +GL+ +LEEA Q +P WL     D +      N Q+    R  GFG RDYRQT P R  N
Sbjct:   78 NRGSKVGNERQQSDSRWSSFNMNIQSRGGHSTLGSNVPRRSWNSFTEDWTQQLPRNERTEQELFKKVSAGINFNQYDNIPVNATGPNFN-DSASTISSFTELSLHKIVRDNVELANYERPTPVQKHAIPIIASGRDLMACAQTGSGKTAAFLIPILNNMIKQGPGDSISATINNNRRKQFPVALILAPTRELASQIFDDARKFSYRSLIRPCVLYGGADMRTQLMELSEGCNLLVATPGRLSDVLERGRVGLDYCRFLVLDEADRMLDMGFEPQIRRIVEQDALPPSGERQTLMFSATFPNEIQILAKDFLNNYIFLTVGRVGSTSENITQTILWVEENAKRDTLIDLLAHSEAGTLILVFVETRRGADALENYLYSQKFQVASIHGDRTQEDRELALSCFRSGRTPVLVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNRNLARGLVELLEEANQAIPPWLKAITGDGRPT----NIQRPRNNRRGGFGARDYRQT-PSRGAN 598          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: A0A183N373 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS22748 PE=3 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 302/527 (57.31%), Postives = 370/527 (70.21%), Query Frame = 2
Query:   80 NRGYNVS--RNKTQNKYPTDNFDNNERKSNGSXXXXXXXXXXXXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS---QIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPN 1645
            NRG  V   R ++ +++ + N +   R  + +  +N      N     W  Q+P N   E ELF     G+NF+ YD+IP+  TGP+F+ D+   I  F  L + KI+RDN+ L NY +PTPVQK AIPII   RDLMACAQTGSGKTAAFLIPILN +  +GPGDS    I  N  KQ+PVALILAPTRELA QI+++ RKFSYRS +R CV+YGGAD+  Q+  LS GCNLLVATPGRL D+L+R ++GL   RYLVLDEADRMLDMGFEPQ+R+IVE    P  G+RQTLMFSATFP EIQ LA DFL+ YIFL VG VGS+S NITQ I ++EE  KR+ L+ +L   E   L L+FVET++GA  LEN+L  + F V SIHGDR Q +RE AL CF++G  P+LVATAVAARGLDIPNVK VIN+DLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ +GL+ +LEEA Q++P WL     D++      + Q+    R  GFG RDYRQT P R  N
Sbjct:   79 NRGSKVGNERQQSDSRWSSFNVNTQSRGGHSTLGSNVPRRSWNAPTEDWTQQLPRNERTEQELFKKASAGINFNQYDNIPVNATGPNFN-DSASTISSFTELSLHKIVRDNVELANYERPTPVQKHAIPIIASGRDLMACAQTGSGKTAAFLIPILNNMIKQGPGDSICATINSNRRKQFPVALILAPTRELASQIFDDARKFSYRSLIRPCVLYGGADMRTQLMELSEGCNLLVATPGRLSDVLERGRVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDAFPPSGERQTLMFSATFPNEIQILAKDFLSNYIFLTVGRVGSTSENITQTILWVEENAKRDTLIDLLAHSEAGTLTLVFVETRRGANALENYLYSQKFQVASIHGDRTQEDRELALSCFRSGRTPVLVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNRNLARGLVELLEEANQDIPPWLKAITGDVRPT----SFQRPRNNRRGGFGARDYRQT-PSRGAN 599          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: A0A074ZVP2 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_11931 PE=3 SV=1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 299/522 (57.28%), Postives = 366/522 (70.11%), Query Frame = 2
Query:   80 NRGYNVSRNKTQNKYPTDNFDNNERKSNGSX-----XXXXXXXXXXXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS---QIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            NRG    R + +N++   NF+  +  S GS        +      N     W  Q+P N  LE ELF     G+NFD YD+IP+  TGPDF+ D    I  F  L + +I+R N+ L  Y++PTPVQK AIPII   RDLMACAQTGSGKTAAFLIPILN +  EGPGDS    +  N  KQ+PV LILAPTRELA QI+++ RKF+YRS +R CV+YGGAD+  Q+  +S+GCNLLVATPGRL D+++R +IGL   R+LVLDEADRMLDMGFEPQ+R+IVE  ++P  G RQTLMFSATFP EIQ LA DFL+ YIFLAVG VGS+S NITQ I ++EE  KR+ L+ +L+  +P  L L+FVETK+GA  LE++L  + F V SIHGDR Q +RE AL+CF+ G  PILVATAVAARGLDIPNVK VIN+DLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ +GL+ +LEE  Q VP WL   + D +     R + K    R  GFG RDYRQ
Sbjct:  171 NRGSTFDRGQNENRW--SNFNGGQYNSRGSGPGSYGSRSGGRSWGNETTEDWSKQLPPNERLEQELFKKISTGINFDQYDNIPVSATGPDFN-DEASAISSFSDLALHRIIRSNVELAQYNRPTPVQKHAIPIIASGRDLMACAQTGSGKTAAFLIPILNRMIEEGPGDSLNAALETNRRKQFPVGLILAPTRELASQIFDDARKFAYRSCIRPCVLYGGADMRAQLIEVSKGCNLLVATPGRLTDVIERGRIGLDHCRFLVLDEADRMLDMGFEPQIRRIVEQDNLPPSGTRQTLMFSATFPHEIQVLAKDFLSRYIFLAVGRVGSTSENITQSILWVEESTKRDALVDLLSSSDPGVLTLVFVETKRGADSLEDYLFAQKFQVASIHGDRSQDDRELALECFRTGRTPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRVGNLGIATSFFNDKNRNLARGLVELLEEVNQSVPSWLRALVTDSRQSGFPRTRNK---GRGGGFGARDYRQ 686          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 288/474 (60.76%), Postives = 353/474 (74.47%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGN----YEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQT 1624
            W   +  N  LE ELF+    G+NF+ YDDIP+  TG    H++   I  F  ++M +I+  NI+L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPG++    N      KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ K L+++L EA+QEVP W    L+ + +  Q ++  +   KR++ GFG RDYRQT
Sbjct:   94 WSKPLAPNERLEQELFAGSNTGINFEKYDDIPVEATG----HNSPPHIDSFHDVEMGEIIMGNIALSRYTRPTPVQKHAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQAENGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGLRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALNQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSW----LESLAYEHQHKSSSRGRSKRFSGGFGARDYRQT 559          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 290/480 (60.42%), Postives = 353/480 (73.54%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQG-IFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W    P N  +E+ELFS    G+NF+ YDDIP+  TG     +N  G I  F  + M +I+  NI+L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPG++        Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PI+VATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SF+ND N N+ K L+++L EA+QEVP W    L+ +    Q +N  +   KR++ GFG RDYRQ
Sbjct:  224 WSKPTPPNERVEHELFSASNTGINFEKYDDIPVEATG-----NNCPGPIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSW----LESLAFEHQHKNSNRGRSKRFSGGFGARDYRQ 694          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 290/480 (60.42%), Postives = 353/480 (73.54%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQG-IFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W    P N  +E+ELFS    G+NF+ YDDIP+  TG     +N  G I  F  + M +I+  NI+L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPG++        Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PI+VATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SF+ND N N+ K L+++L EA+QEVP W    L+ +    Q +N  +   KR++ GFG RDYRQ
Sbjct:  253 WSKPTPPNERVEHELFSASNTGINFEKYDDIPVEATG-----NNCPGPIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSW----LESLAFEHQHKNSNRGRSKRFSGGFGARDYRQ 723          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 292/497 (58.75%), Postives = 354/497 (71.23%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQG-IFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKL------------EPE-----DLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W    P N  +E+ELFS    G+NF+ YDDIP+  TG     +N  G I  F  + M +I+  NI+L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPG++        Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN               PE      L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PI+VATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SF+ND N N+ K L+++L EA+QEVP W    L+ +    Q +N  +   KR++ GFG RDYRQ
Sbjct:  180 WSKPTPPNERVEHELFSASNTGINFEKYDDIPVEATG-----NNCPGPIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATVIPSEVQENATETPERPGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSW----LESLAFEHQHKNSNRGRSKRFSGGFGARDYRQ 667          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 292/497 (58.75%), Postives = 354/497 (71.23%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQG-IFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKL------------EPE-----DLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYN-GFGGRDYRQ 1621
            W    P N  +E+ELFS    G+NF+ YDDIP+  TG     +N  G I  F  + M +I+  NI+L  Y +PTPVQK AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPG++        Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN               PE      L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PI+VATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SF+ND N N+ K L+++L EA+QEVP W    L+ +    Q +N  +   KR++ GFG RDYRQ
Sbjct:  200 WSKPTPPNERVEHELFSASNTGINFEKYDDIPVEATG-----NNCPGPIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATVIPSEVQENATETPERPGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSW----LESLAFEHQHKNSNRGRSKRFSGGFGARDYRQ 687          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 286/478 (59.83%), Postives = 345/478 (72.18%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPG---------DSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRY-NGFGGRDYRQ 1621
            W   +P N  +E ELF+    G+NF+ YDDIP+  TG    +D    I  F  L++ +I+  +++L  Y +PTPVQK+AIPII  +RDLMACAQTGSGKTAAFL+PIL+ IY  GPG            +     KQYP++L+LAPTRELA QIY+E RKF+YRS VR CVVYGGADI  Q+  L +GC+LLVATPGRL+DM++R K+GL   RYLVLDEADRMLDMGFEPQ+R+IVE   MP  GDRQTLMFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +LN    + L L+FVETKKGA  L+ FL    +  TSIHGDR Q +RE AL  F+ G  PILVATAVAARGLDIPNVK VINFDLPSDIEEYVHRIGRTGRVG+LG++ SF+N+ N N+ + L+++L EA QEVP WL E +      K  R +    PKR+  GFGGRDYRQ
Sbjct:   15 WTKPLPRNDRIEKELFAGSNTGINFEKYDDIPVEATG----NDCPPHIESFHELELGEIIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNENMTRELLHLLVEAHQEVPSWL-ETMAQEHRSKPARGR----PKRFAGGFGGRDYRQ 483          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 290.426 bits (742), Expect = 2.636e-86
Identity = 166/406 (40.89%), Postives = 245/406 (60.34%), Query Frame = 2
Query:  419 NYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIR---YLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKM---TPKRYNGFGGRDYR 1618
            NY KPTP+Q  AIP I+  RDL+  A+TGSGKT  FL+P+   +  + P +       E + P+ +I+ PTRELA QI +E RKF+ +  +R   VYGG  IS+QI  L RG  ++V TPGR+IDML  +   +   R   Y+VLDEADRM DMGFEPQ+ +I+E S      DRQT+MFSATFP+ ++ LA   LN  + + VG       ++ QH+  IEE  K   LL++L   + +  V++FV+ ++ A  L   LM+  +P  S+HG   Q +R++ +  FK+G   ++VAT+VAARGLD+ ++ +V+N+D P+  E+YVHR+GRTGR G+ G S +F           +I  LE +   +P  L E+L       +FR +QK    T ++ +GF G+ ++
Sbjct:  388 NYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQRPLE-------EGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSR----PDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFITSEQERYSGDIIKALELSGTPLPPDL-ERL-----WTEFREKQKAEGKTMRKSSGFSGKGFK 776          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 266.929 bits (681), Expect = 1.182e-79
Identity = 158/366 (43.17%), Postives = 213/366 (58.20%), Query Frame = 2
Query:  395 MRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVE---------DSDMPYVGD-------------RQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNK-LEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLG 1423
            +R+ I    Y  PTP+Q+ AIPI LQ RD++  A+TGSGKTAAFLIP+L  I    P   +I      Q P A+ILAPTRELA QI EE  KF     +R+  V GG     Q   L  GC +++ATPGRLID+L+   + L    Y+VLDEADRM+DMGFEP +++I+E         D+D     D             RQT+MF+AT P  ++ LA  +L     + +G VG     + Q +F + E  KR  LL++L++  EP   ++IFV  KKG   L   L +  F   ++HG + Q +RE AL   K G+  ILVAT VA RG+DI +V +V+N+D+  +IE+Y HRIGRTGR G  G
Sbjct:  331 IREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITT-LPKIDRIEDT--DQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIGSVGKPIERVEQRVFIMGESEKRKKLLELLSRGFEPP--IIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSG 691          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 262.307 bits (669), Expect = 8.511e-78
Identity = 163/426 (38.26%), Postives = 226/426 (53.05%), Query Frame = 2
Query:  356 GIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEG---PGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHI-FYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            G FGF+   +  I +       + +PTP+Q   IPI L  RD++  A+TGSGKTA+F+ P+L  I  +    PGD           P+ LI  PTREL  QI  E ++F     + S  VYGG  + +Q   L  G  ++V TPGRLID +K+    LQ + YLV DEADRM DMGFE Q+R I          DRQT+++SATF   ++ LA D L   I +  G +G ++ ++TQ +  +     K N L   L +      VLIFV  K  + +L N L Q  F V  +HGD  Q ER   +  FK   +PI+VAT VAARGLDIP++K V+N+D+  DI+ + HR+GRTGR G  G + +     ++N    L+  LE A Q V   L +        ++ R +     K   G GG  YR+
Sbjct:  252 GHFGFDEQLLNLIRKSE-----FTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKPGDG----------PIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANH----VRPDRQTMLYSATFRMRVEKLARDILIDPIRVVQGDIGEANEDVTQRVEIFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKDMNFAGDLVRNLEGANQHVHKELMDLAMQNPWFRKTRFKGGRGRKLNVGGGGLGYRE 658          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.698 bits (548), Expect = 1.129e-63
Identity = 127/349 (36.39%), Postives = 204/349 (58.45%), Query Frame = 2
Query:  383 MTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDK-IGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGE 1426
            +T+++ +    L + +PT +Q  AIP+ LQ +D++  A+TGSGKT AF +PIL  + ++ P           Q   AL+L PTRELA QI E+         ++S VV GG D+  Q   L++  ++++ATPGRL+D L+  K   ++ ++YLV+DEADR+L+M FE ++ +I++   +P   +R+T +FSAT  K++Q L    L   +  +V     +   + Q+  +I    K ++L+ ILN+L     + IF  T    +++   L    F    +HG   Q +R  +L  FK  +  IL+AT VA+RGLDIP+V +VINFD+P+  ++Y+HR+GRT R G  G+
Sbjct:    2 VTEVLCEACEQLGWKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQAL-LDAP-----------QRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRALKYLVMDEADRILNMDFETEVDKILKV--IPK--ERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFIPAKFKDSYLVYILNELAGNSFI-IFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGK 333          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 485.723 bits (1249), Expect = 2.528e-165
Identity = 265/474 (55.91%), Postives = 332/474 (70.04%), Query Frame = 2
Query:  233 PFNRHLENELFS-HQEP-----GVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYE-----KQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            P N  LE ELF  H +P     G+ FD+YD+IP+  +G D      + I  F    + +++ +NI L ++ KPTPVQK++IPI+ + RDLMACAQTGSGKT  FL P+   ++  GP  S +P   +     K YP AL+LAPTRELA QI+EE RKF+YRS VR CVVYGGA I  Q+  + RGC+LLVATPGRL D+L+R K+ L  I+YLVLDEADRMLDMGFEPQ+R IVE+ DMP V +RQTLMFSATFP +IQHLA DFL+ YIFL+VG VGS+S NITQ I Y+++  K++ LL +L+  E + L LIFVETK+ A QL +FL+ ++F  T+IHGDR Q ERE AL  FK     ILVATAVAARGLDIPNV  VIN+DLPSDI++YVHRIGRTGR G+ G + SFFN NN N+VKGL+ +L EA QEVP +L +  +      + R        R N  G RDYR+
Sbjct:  109 PKNAKLEAELFGVHDDPDYHSSGIKFDNYDNIPVDASGKDVP----EPILDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGP--SPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLDLLSA-EHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILNEANQEVPTFLSDLSRQNSRGGRTRGGGGFFNSRNN--GSRDYRK 573          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 475.707 bits (1223), Expect = 1.458e-161
Identity = 250/456 (54.82%), Postives = 322/456 (70.61%), Query Frame = 2
Query:  272 QEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPG---DSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFG---GRDYRQ 1621
            Q  G+NFD+YDDIP+  +G D      + I  F    +  ++ +NI L  + KPTPVQK+++PI+   RDLMACAQTGSGKT  FL P+L+  +  GP    +SQ      K YP A+I+APTRELA QI++E +KF+YRS V++CVVYGG+ I  Q+  + RGC+LLVATPGRL D+L+R KI L  ++YLVLDEADRMLDMGFEPQ+R IVED DM  VG+RQTLMFSATFP +IQHLA DFL+ YIFL+VG VGS+S NITQ + Y+E   K++ LL +L+    + L LIFVETK+ A QL +FL+ ++F  T+IHGDR Q ERE AL  F++G+  +LVATAVAARGLDIPNV  VIN+DLPSD+++YVHRIGRTGR G+ G + +FFN  N N+VKGL  +L EA QEVP +L + +      +        +  R  GFG    RDYR+
Sbjct:  116 QSSGINFDNYDDIPVDASGKDVP----EPITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSA-STDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSENSNIVKGLHEILTEANQEVPSFLKDAMMSAPGSR--------SNSRRGGFGRNNNRDYRK 558          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 317.39 bits (812), Expect = 5.149e-101
Identity = 178/396 (44.95%), Postives = 250/396 (63.13%), Query Frame = 2
Query:  341 HDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVE---GPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVG-SSSHNITQHIFYIEEFRKRNHLLQILNKLEPED--LVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVP 1510
            HD  + I  F+       + + +    + KPT +Q    P+ L  RD++  A TGSGKT ++ +P +  I  +    PGD           P+ L+LAPTRELA QI  E  KF + S++R+  VYGG   S+QI +LSRG  +++ATPGRLIDML+  K  L+ + YLVLDEADRMLDMGFEPQ+R+IV D   P   DRQTLM+SAT+PKE++ LAAD+LN  I + VG +  S+SHNITQ +  + +F KR+ L + L     ++    LIF  TK+    +  +L +  +P  +IHGD+ Q ER+  L+ F+NG  PI+VAT VAARG+D+  +  VIN+D+P +IE+YVHRIGRTGR G  G ++SFF + N  +   LI+++ EA Q +P
Sbjct:  106 HDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDG----------PIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIV-DQIRP---DRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGLGAKLISIMREANQNIP 487          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 266.159 bits (679), Expect = 1.211e-81
Identity = 157/390 (40.26%), Postives = 232/390 (59.49%), Query Frame = 2
Query:  359 IFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHN--ITQHIFYIEEFRKRNHLLQILNKL----EPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVP 1510
            +  F+ L +   ++  IS   + KPTP+Q  A P +L  +D++  A+TGSGKT AF +P +          S +  + +K+    L+++PTRELA QIY+ +   + +  ++ C VYGG    +Q   L +   ++VATPGRL+D+L+   + L  + YLVLDEADRML+ GFE  ++ I+ ++D      RQTLMF+AT+PKE++ LA+ F+N  I +++G     + N  ITQ +  ++   K   LL++L K     +  + VLIF   KK A ++E  L    + V +IHGD  Q +R  AL  FK+G   +L+AT VAARGLDIPNVK VIN   P  +E+YVHRIGRTGR G  G + + F +   ++  GL+NVL  A Q VP
Sbjct:  113 LLSFDYLSLDSSIQAEIS--KFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAI----------SHLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKK-SQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETD---ASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVP 486          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: RRP3 (Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity [Source:SGD;Acc:S000001107])

HSP 1 Score: 233.802 bits (595), Expect = 8.426e-70
Identity = 136/338 (40.24%), Postives = 196/338 (57.99%), Query Frame = 2
Query:  416 LNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDK-IGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGE 1426
            LNY KPTP+Q  AIP  L+  D++  AQTGSGKTAAF IPILN ++            ++++   A ILAPTRELA QI E          VRS  + GG ++  Q  +L R  ++++ATPGRL+D L+  K   L+ +++LV+DEADR+LDM F P L +I++   +    +R T +FSAT   +I  L    L   +  AV     +   + Q +  +    K  +L+ +LN+   + ++ IF  TK  A +L       +F  T++HGD  Q +R  +L  FK G   ILVAT VAARGLDIP+V +V+N+D+P D + Y+HR+GRT R G  G+
Sbjct:   99 LNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRLW------------HDQEPYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILK---IIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFIGKTMI-IFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGK 420          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: PL10 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM49])

HSP 1 Score: 526.939 bits (1356), Expect = 3.607e-180
Identity = 279/471 (59.24%), Postives = 338/471 (71.76%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPG---DSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQ 1621
            W    P N  +E +LF+    G+NF+ YDDIP+  TG     +  + I  FE + + +I+  N+ L  Y KPTPVQK+AIPI+  +RDLMACAQTGSGKTAAFLIPIL+ IY+EGP    D +  G   +QYP+ L+LAPTRELA QI++E RKFSYRS  R CVVYGGADI  Q+  L R C+LLVATPGRL+DM+ R ++GL  IR+LVLDEADRMLDMGFEPQ+R+IV+   MP  G RQTLMFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + +++EF KR+ LL +LN   P+ L L+FVETKKGA  LE FL +  +  TSIHGDR Q ERE AL+ F+ G  PILVATAVAARGLDIPNVK VINFDLP+DIEEYVHRIGRTGRVGH G + SFFN  N NV K L+++LEE++QE+P WL     +     + R ++         F  RDYRQ
Sbjct:  148 WSKLQPKNERVERDLFASHNTGINFEKYDDIPVEATG----QECPKNIELFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILSRIYMEGPPAPPDIKHAGR-RRQYPICLVLAPTRELAVQIFDEARKFSYRSLCRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRMLDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQMLARDFLENYIFLAVGKVGSTSENITQKVVWVDEFDKRSFLLDLLNASGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIHGDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNHKNKNVAKELMDILEESKQEIPSWLESMAYEASSGSRNRGRRHGG--GGGAFSSRDYRQ 611          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: VAS1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG3])

HSP 1 Score: 350.132 bits (897), Expect = 1.156e-115
Identity = 185/349 (53.01%), Postives = 241/349 (69.05%), Query Frame = 2
Query:  485 MACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNY-YIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXX-XXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            MACAQTGSGKTAA+++P+L  +  +G        N   + P+AL +APTRELA QIY E RKFS  + ++ CV YGG  +  Q + L RGC+ LV TPGRL D + R+KI L  I++L+LDEADRMLD+GF P + +++E+S+M     RQTLMFSATFP EIQHLA  FL   Y+FLAVG VG ++ +ITQH+  +    KR+ L +IL+     D  L+FVE K+ A  L  +L Q +FP TSI  DR Q ERE AL+ F++G   ILVAT+VAARGLDIPNVK VIN+DLP DIEEYVHR+GRTGR+G+ G++ + +    +  + + L+ VL EA QEVP WL E
Sbjct:    1 MACAQTGSGKTAAYMLPVLTSLIKQGL-------NAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCYGGVSVPYQASQLERGCHFLVGTPGRLQDFVSREKIYLGSIQHLILDEADRMLDLGFGPDIHKLIEESNMTAKESRQTLMFSATFPDEIQHLAGSFLKPDYLFLAVGRVGGTNLDITQHVITVNGSEKRDKLHEILSA-TGTDRTLVFVELKRVADFLAAWLSQNNFPTTSISSDRCQSEREAALRDFRDGRANILVATSVAARGLDIPNVKHVINYDLPQDIEEYVHRVGRTGRIGNEGKATAFYEVGRDDRLARSLVKVLSEALQEVPAWLDE 341          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: EDO27708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H9])

HSP 1 Score: 316.62 bits (810), Expect = 2.742e-99
Identity = 194/443 (43.79%), Postives = 262/443 (59.14%), Query Frame = 2
Query:  224 YQMPFNRHLENELF-SHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGA-----DISKQINNLSRGCNLL--VATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXX-XXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            Y  P     E E+F S  + G+NF+ YD I +L +G    ++  + I  FE   + +   +N+    Y KPTPVQK++IPI++  RD+MACAQTGSGKT  F    +  I++             +Q    L LA  + +    Y  I   SY S +   VV   +     + +    N    C ++  +   G +  + +   + L+ +++L+LDEADRMLDMGFEP +R+IVE   MP   +RQTLMFSATFP+EIQ LA DFLN Y+FL VG VG ++ +I Q +  + +  KR+ L QIL      D  L+FVE+K+ A  L  FL    FP TSIHGDR Q ERE AL  F+ G  P+L+AT VAARGLDI +VK VINFDLPSDI+EYVHRIGRTGR+G+ G++ + F    +  V +GL+ VL EA QEVP WL E
Sbjct:  179 YVPPTPTEDEEEMFRSTIQQGINFEKYDQIEVLVSG----NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKTYWFSKYCIATIFIS------------RQRQTFLNLAQFKCVLVISYPSIIH-SYFSGLSELVVIVMSAPFLHNTASTCGNKRTACMVISFLNFSGFISLIEQNSTVSLKGLQFLILDEADRMLDMGFEPAIRRIVESMGMPDKSERQTLMFSATFPEEIQRLAGDFLNDYLFLTVGRVGGTTSDIEQTVIEVTDNEKRDRLTQILGDA---DRTLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDIDEYVHRIGRTGRIGNKGKATTFFLRGRDDKVARGLVKVLSEANQEVPEWLEE 601          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: VAS2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU5])

HSP 1 Score: 299.671 bits (766), Expect = 3.366e-97
Identity = 154/286 (53.85%), Postives = 195/286 (68.18%), Query Frame = 2
Query:  518 AAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIE 1375
            AAFL+P++  +   G   S      E Q P A+ +APTRELA QIY E RKF++ + +R  V YGG  +S Q+  L  GCNLLV TPGRL D +++ K+ L+ +++L+LDEADRMLDMGFEP +R+IVE   MP   +RQTLMFSATFP+EIQ LA DFLN Y+FL VG VG ++ +I Q +  + +  KR+ L QIL      D  L+FVE+K+ A  L  FL    FP TSIHGDR Q ERE AL  F+ G  P+L+AT VAARGLDI +VK VINFDLPSDI+
Sbjct:    4 AAFLLPVMTSMMNAGLTSSSFS---ETQTPQAMCIAPTRELANQIYLEARKFAHGTMLRPVVCYGGVSVSHQLRQLQSGCNLLVGTPGRLTDFIEKGKVSLKGLQFLILDEADRMLDMGFEPAIRRIVESMGMPDKSERQTLMFSATFPEEIQRLAGDFLNDYLFLTVGRVGGTTSDIEQTVIEVTDNEKRDRLTQILGD-AGTDRTLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDID 285          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 296.975 bits (759), Expect = 6.422e-94
Identity = 173/368 (47.01%), Postives = 230/368 (62.50%), Query Frame = 2
Query:  422 YHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIP---ILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVG-SSSHNITQHIFYIEEFRKRNHLLQILNKL--EPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEV 1507
            + +PT +Q    P+ L  R+L+  AQTGSGKT +F++P    +N   +  PGD           P+ L+L PTRELA Q+ E         ++RS  +YGGA    QI  L RG  + +ATPGRLIDML+  K  L+   YLVLDEADRMLDMGFEPQ+R I+ D   P   DRQTLM+SAT+PKE+Q LA DFL+ Y+ + VG +G +++H I Q +   E+  K + LL++L ++  E E+  LIF ETK+ A +L   L    +P   IHGD+ Q ER+  L  F+ G  PILVAT VA+RGLDI ++K VINFD P+  E+YVHRIGRT R    G S +FF  NN    K L++VL+EA+Q V
Sbjct:   78 FTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPLLQPGDG----------PIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTII-DQIRP---DRQTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLIFTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFFTVNNAKQAKELVSVLQEAKQHV 431          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 289/479 (60.33%), Postives = 348/479 (72.65%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQT 1624
            W      N  LE ELFS    G+NF+ YDDIP+  TG +        I  F  + M +I+  NI+L  Y +PTPVQK+AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPGD+        Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI  L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++E+  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ K L+++L EA+QEVP WL     + +H    R +++ +     GFG RDYRQT
Sbjct:  153 WSKPTAPNERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPH----IESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRFS----GGFGARDYRQT 623          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 289/479 (60.33%), Postives = 348/479 (72.65%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQT 1624
            W      N  LE ELFS    G+NF+ YDDIP+  TG +        I  F  + M +I+  NI+L  Y +PTPVQK+AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPGD+        Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI  L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++E+  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ K L+++L EA+QEVP WL     + +H    R +++ +     GFG RDYRQT
Sbjct:  189 WSKPTAPNERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPH----IESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRFS----GGFGARDYRQT 659          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ENSORLT00000037340.1 (ATP-dependent RNA helicase DDX3X [Source:NCBI gene;Acc:101161371])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 292/496 (58.87%), Postives = 352/496 (70.97%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILN-----------------KLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQT 1624
            W      N  LE+ELFS    G+NF+ YDDIP+  TG +  H     I  F+ + M +I+  N++L  Y +PTPVQK+AIPII  +RDLMACAQTGSGKTAAFL+PIL+ IY +GPG++           G Y   KQYP+AL+LAPTRELA QIY+E RKFSYRS+VR CVVYGGADI +QI +L RGC+LLVATPGRL+DM++R KIGL +  YL+LDEADRMLDMGFEPQ+R+IVE   MP+ G RQTLMFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++EE  KR+ LL +L+                 K   + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ K L+++L EA+QEVP WL     + +H    R + K   +   GFG RDYRQT
Sbjct:  187 WSKPTQRNERLEHELFSGSNTGINFEKYDDIPVEATGQNCPHH----IESFQDIDMGEIIMGNVALTRYTRPTPVQKYAIPIIKSKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALNAAKASGTDNGKYGRRKQYPIALVLAPTRELALQIYDEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLILDEADRMLDMGFEPQIRRIVEQDTMPHKGIRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLSATVIPTEVQDGCGDGVEKPGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALSQFRSGKCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNGNITKDLLDILVEAKQEVPSWLESLAYEHQHKSTSRGRSK---RFAGGFGARDYRQT 675          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 285/464 (61.42%), Postives = 345/464 (74.35%), Query Frame = 2
Query:  245 HLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGN----YEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQT 1624
            HL+ ELFS    G+NF+ YDDIP+  TG +        I  F  + M +I+  NI+L  Y +PTPVQK+AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPGD+    N      KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI  L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++E+  KR+ LL +LN    + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ K L+++L EA+QEVP WL     + +H    R +++ +     GFG RDYRQT
Sbjct:  115 HLQ-ELFSGGNTGINFEKYDDIPVEATGSNCPPH----IESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQADNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRFS----GGFGARDYRQT 569          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 290/496 (58.47%), Postives = 350/496 (70.56%), Query Frame = 2
Query:  218 WLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDS--------QIPGNY--EKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILN-----------------KLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQT 1624
            W      N  LE ELFS    G+NF+ YDDIP+  TG +        I  F  + M +I+  NI+L  Y +PTPVQK+AIPII  +RDLMACAQTGSGKTAAFL+P+L+ IY +GPGD+        Q  G Y   KQYP++L+LAPTRELA QIY+E RKF+YRS+VR CVVYGGADI +QI  L RGC+LLVATPGRL+DM++R KIGL +  YLVLDEADRMLDMGFEPQ+R+IVE   MP  G RQT+MFSATFPKEIQ LA DFL  YIFLAVG VGS+S NITQ + ++E+  KR+ LL +LN                 K+  + L L+FVETKKGA  LE+FL +  +  TSIHGDR Q +RE AL  F++G  PILVATAVAARGLDI NVK VINFDLPSDIEEYVHRIGRTGRVG+LG + SFFND N N+ K L+++L EA+QEVP WL     + +H    R +++ +     GFG RDYRQT
Sbjct:  136 WSKPTAPNERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPH----IESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATVIPSEVQESITESTEKIGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRFS----GGFGARDYRQT 623          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000064743.1 (SMESG000064743.1)

HSP 1 Score: 1070.84 bits (2768), Expect = 0.000e+0
Identity = 547/548 (99.82%), Postives = 547/548 (99.82%), Query Frame = 2
Query:   29 MAQRNKDSYNDSNRPQWNRGYNVSRNKTQNKYPTDNFDNNERKSNGSXXXXXXXXXXXXXXXKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPNPQPFQTSYY 1672
            MAQRNKDSYNDSNRPQWNRGYNVSRNKTQNKYP DNFDNNERKSNGSYVNNNYEYQVNNNQNKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGESVSFFNDNNVNVVKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPNPQPFQTSYY
Sbjct:    1 MAQRNKDSYNDSNRPQWNRGYNVSRNKTQNKYPKDNFDNNERKSNGSYVNNNYEYQVNNNQNKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGESVSFFNDNNVNVVKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPNPQPFQTSYY 548          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000019837.1 (SMESG000019837.1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 292/441 (66.21%), Postives = 350/441 (79.37%), Query Frame = 2
Query:  215 KWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKD 1537
             W  Q P N  LE ELF     G+NFD YD+IP+ TTGP + HD Y G+  F  LK+  I+  NI L  Y +PTPVQ++A+PII+QRRDLMACAQTGSGKTAAFLIP+LNM+Y +GPG+S     Y+K+YPVALILAPTRELA QIYEE RKFSYRS VR CVVYGGADI  Q+++LS+GCN+LVATPGRL DML+R +IGL  IRYLVLDEADRMLDMGFEPQ+R+IVE ++MP  G+RQTLMFSATFPKEIQ LA+DFL  Y+FL VG VGS+S NITQ I Y++E  KR+HLL IL  ++ E L+L+FVETK+GA  LE FL    F V SIHGDR Q +RE AL+CF++G  PILVATAVAARGLDIPNVK VIN+DLP+DIEEYVHRIGRTGRVG+LGE++SF+ D N NV + L+++L EA Q VP WL +K+ +
Sbjct:  160 SWDIQQPANPKLEKELFVGHNSGINFDQYDNIPVNTTGPQWQHDKYTGVTSFSELKLHPIIAHNIGLTQYSRPTPVQRYAVPIIVQRRDLMACAQTGSGKTAAFLIPLLNMMYNDGPGNSLSRTGYKKEYPVALILAPTRELALQIYEEARKFSYRSLVRPCVVYGGADIRNQLHDLSQGCNMLVATPGRLSDMLERCRIGLDCIRYLVLDEADRMLDMGFEPQIRKIVEQTNMPPPGNRQTLMFSATFPKEIQMLASDFLQDYLFLRVGKVGSTSQNITQRIVYVDENEKRDHLLDILADIDSESLILVFVETKRGADALEGFLHGEGFRVASIHGDRSQSDRELALQCFRDGRTPILVATAVAARGLDIPNVKFVINYDLPTDIEEYVHRIGRTGRVGNLGEAISFYTDKNNNVARELVDILLEANQTVPDWLRDKIGE 600          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000013025.1 (SMESG000013025.1)

HSP 1 Score: 505.368 bits (1300), Expect = 9.969e-170
Identity = 264/451 (58.54%), Postives = 327/451 (72.51%), Query Frame = 2
Query:  281 GVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQ-YPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYEKLKDMKHIKQF-RNQQKMTPKRY-NG-FGGRDYRQ 1621
             +NFD YD IP+  TGPD+   N +    F+ LK+  I+R+NI L +Y +PTP+QK AIP IL+ RD+MACAQTGSGKTAAFLIPI+N +  +       P  Y K  YP  LILAPTRELA QI  E +KFS  +Q+RSCVVYGGAD   QI  +  GC+LLVATPGRL+D ++++KI L+  +Y+VLDEADRMLDMGFEPQ+R+I+E+S+MP   +RQTLMFSATFPKEIQ LAADFL  YIF+ VG VGS+S +I Q I Y+ +  K N+L  I N   P  L+LIFVETKKGA  L  FL+ + +PV+SIHGDR Q ERE AL  F+NG  PILVATAVAARGLDIPNVK VIN+DLPSDIEEYVHRIGRTGR+G+ G + SF+ D N N+   L+++L+EA Q VP WL     ++K       N ++   +R+ NG FGGRDYRQ
Sbjct:  161 AINFDKYDAIPVSVTGPDYSAINVEN---FDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLS----PQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQKLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 604          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000067941.1 (SMESG000067941.1)

HSP 1 Score: 339.347 bits (869), Expect = 1.787e-104
Identity = 192/423 (45.39%), Postives = 272/423 (64.30%), Query Frame = 2
Query:  269 HQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNL-SRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDM-GFEPQLRQIVEDSDMPYVGDRQTL---MFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXX-XXXXXXXXXXKGLINVLEEAQQEVPVWL 1519
            H   G+NFD+YD IP+  TG D        +  F  L + + +  N+  L Y K TPVQK+AIPII  +RDLMACAQTGSGKTAAFLIPI+  +   G   ++ P +    +P ALI+APTREL  QI+   R     S ++   +YGG +++K   N+ + GC++LVATPGRLI  L+   + L+++++ VLDEADRMLD  GF   + +I  +++  + GD +++   MFSATFP EIQ LA + L  Y+FLAVG+VGS++ ++ Q I   ++  K N  ++ + K  P++  LIFVE+K+ A  +   L    F  T+IHGDR+Q +RE AL  FK+G +  +VAT VAARGLDIP V  VIN D+P  I+ YVHRIGRTGR G++G ++S F    ++ + +GL++ L+EA QE P WL
Sbjct:  477 HVNSGINFDNYDKIPVEVTGDDV----PPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG---TESPAS-AVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEAN--FSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWL 888          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000033908.1 (SMESG000033908.1)

HSP 1 Score: 303.908 bits (777), Expect = 1.033e-94
Identity = 172/393 (43.77%), Postives = 242/393 (61.58%), Query Frame = 2
Query:  359 IFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGP---GDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVG-SSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGEXXXXXXXXXXXXXKGLINVLEEAQQEVPVWLYE 1525
            IF F  + +++ +   I    +++PTP+Q   +P+ L  R+L+  A+TGSGKTA++LIP +  +  + P   GD           P+ LI+ PTRELA Q+      F     +RS  VYGGA+   QI  L  G  ++VATPGRLID+LK     L    Y+VLDEADRMLDMGFEPQ+R+I          DRQTLM+SAT+PKE+Q LA DFL  YI + +G     ++ NI Q +  ++E+ K   LL++++K  P D +++F ETKK A  + +FL  + F V ++HGD+ Q +RE  L  F+  +L ILVAT VA+RGLD+ ++K+VIN+D P   E+Y+HRIGRTGR G  G S +FFN  N    + L+ V+EEA Q V   LY+
Sbjct:  138 IFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDG----------PICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRSGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQ----DRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKT-PRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYD 515          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX3X0.000e+060.92DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X0.000e+060.92DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X0.000e+060.92DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X0.000e+060.92DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X0.000e+060.92DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
laf-12.772e-15351.11ATP-dependent RNA helicase laf-1 [Source:UniProtK... [more]
laf-12.775e-15251.11ATP-dependent RNA helicase laf-1 [Source:UniProtK... [more]
vbh-15.901e-14053.46Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-15.901e-14053.46Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-15.901e-14053.46Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bel1.330e-17060.00gene:FBgn0263231 transcript:FBtr0334319[more]
bel1.370e-17060.00gene:FBgn0263231 transcript:FBtr0081888[more]
vas1.350e-12147.52gene:FBgn0283442 transcript:FBtr0445187[more]
vas1.350e-12147.52gene:FBgn0283442 transcript:FBtr0445185[more]
vas1.350e-12147.52gene:FBgn0283442 transcript:FBtr0445186[more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3xa0.000e+060.91DEAD-box helicase 3 X-linked a [Source:ZFIN;Acc:ZD... [more]
ddx3xb0.000e+061.38DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
ddx44.214e-13849.36DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx44.338e-13849.36DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx44.963e-13849.36DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3x0.000e+060.97DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x0.000e+060.97DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x0.000e+060.97DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x0.000e+060.97DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x0.000e+060.97DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx3y0.000e+061.05DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked... [more]
D1Pas10.000e+061.26DNA segment, Chr 1, Pasteur Institute 1 [Source:MG... [more]
Ddx3x0.000e+060.97DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-... [more]
Ddx44.742e-13651.18DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx41.392e-13551.18DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62095|DDX3Y_MOUSE0.000e+061.05ATP-dependent RNA helicase DDX3Y OS=Mus musculus O... [more]
sp|P16381|DDX3L_MOUSE0.000e+061.26Putative ATP-dependent RNA helicase Pl10 OS=Mus mu... [more]
sp|Q5RF43|DDX3Y_PONAB0.000e+060.42ATP-dependent RNA helicase DDX3Y OS=Pongo abelii O... [more]
sp|O15523|DDX3Y_HUMAN0.000e+060.76ATP-dependent RNA helicase DDX3Y OS=Homo sapiens O... [more]
sp|O00571|DDX3X_HUMAN0.000e+061.18ATP-dependent RNA helicase DDX3X OS=Homo sapiens O... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
O970310.000e+059.80DjVLGA OS=Dugesia japonica OX=6161 GN=DjvlgA PE=2 ... [more]
C1LFN90.000e+057.87ATP-dependent RNA helicase DDX3X OS=Schistosoma ja... [more]
G4LVC70.000e+057.50DEAD box ATP-dependent RNA helicase, putative OS=S... [more]
A0A183N3730.000e+057.31Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A074ZVP20.000e+057.28Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3xb0.000e+060.76DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
ddx3xa0.000e+060.42DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa0.000e+060.42DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa0.000e+058.75DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa0.000e+058.75DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003898.10.000e+059.83pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx462.636e-8640.89DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx231.182e-7943.17DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx428.511e-7838.26DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ENSPMAT00000000216.11.129e-6336.39pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP12.528e-16555.91Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED11.458e-16154.82ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP25.149e-10144.95ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP31.211e-8140.26RNA-Dependent ATPase, member of DExD/H-box family;... [more]
RRP38.426e-7040.24Protein involved in rRNA processing; required for ... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
PL103.607e-18059.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS11.156e-11553.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277082.742e-9943.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS23.366e-9753.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380616.422e-9447.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3xa0.000e+060.33DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa0.000e+060.33DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ENSORLT00000037340.10.000e+058.87ATP-dependent RNA helicase DDX3X [Source:NCBI gene... [more]
ddx3xa0.000e+061.42DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa0.000e+058.47DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064743.10.000e+099.82SMESG000064743.1[more]
SMESG000019837.10.000e+066.21SMESG000019837.1[more]
SMESG000013025.19.969e-17058.54SMESG000013025.1[more]
SMESG000067941.11.787e-10445.39SMESG000067941.1[more]
SMESG000033908.11.033e-9443.77SMESG000033908.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030115 ID=SMED30030115|Name=ATP-dependent RNA helicase DDX3X|organism=Schmidtea mediterranea sexual|type=transcript|length=1982bp
GTTTTTTACAATTTTTGGTTAAGATAACATGGCTCAACGAAATAAGGATT
CATATAATGATTCAAACCGTCCACAATGGAATCGCGGATATAATGTTTCT
AGAAACAAAACTCAAAATAAGTATCCTACAGATAATTTTGATAATAATGA
AAGAAAGAGTAATGGGTCATATGTAAACAATAATTATGAATATCAAGTAA
ATAATAATCAAAATAAATGGTTATATCAAATGCCTTTTAATCGGCATTTG
GAAAATGAATTATTTAGCCATCAAGAACCCGGTGTTAATTTTGATGATTA
TGATGATATTCCAATTTTGACAACTGGTCCAGATTTTGATCATGATAATT
ATCAAGGAATTTTCGGGTTTGAAGGATTAAAAATGACAAAAATAATGCGT
GATAATATATCTTTGCTCAATTATCATAAACCAACTCCAGTACAAAAGTT
TGCCATTCCAATTATTTTACAGAGGCGGGATTTAATGGCTTGTGCTCAAA
CTGGTTCCGGAAAAACTGCAGCATTTCTGATTCCTATTTTAAATATGATT
TATGTCGAGGGACCTGGAGATTCACAAATTCCGGGCAATTATGAAAAGCA
ATACCCAGTTGCATTAATCCTTGCACCGACTCGTGAATTAGCTTGTCAAA
TTTATGAAGAAATTCGAAAGTTTTCCTATAGATCTCAAGTTCGTTCTTGT
GTAGTTTATGGTGGCGCTGATATAAGCAAGCAAATAAATAATTTGTCAAG
AGGCTGTAATTTACTTGTCGCGACTCCTGGTAGACTAATCGATATGCTAA
AAAGAGATAAAATTGGATTACAATTTATCAGATATCTTGTGCTGGATGAA
GCGGACAGGATGCTGGATATGGGGTTTGAACCTCAACTTCGACAAATTGT
TGAAGACTCTGATATGCCTTATGTTGGTGATCGGCAGACTTTAATGTTTT
CTGCAACTTTTCCTAAAGAGATTCAGCATTTAGCTGCAGATTTTTTGAAT
TATTATATATTTCTCGCGGTTGGTATTGTTGGGAGCTCTAGTCATAATAT
CACGCAACACATATTTTACATTGAAGAATTTAGAAAGAGGAATCATTTGC
TTCAAATTCTAAATAAATTAGAACCTGAAGATTTGGTATTAATTTTTGTT
GAAACTAAAAAAGGAGCACGCCAACTAGAAAATTTTCTTATGCAAAGAGA
TTTTCCTGTTACTAGTATACATGGAGATCGAAAACAAGTTGAAAGAGAAA
CTGCCTTAAAATGTTTTAAAAATGGATCTTTGCCTATTCTAGTTGCTACC
GCTGTAGCCGCGCGTGGATTGGACATTCCAAATGTCAAATTGGTCATAAA
TTTTGATTTACCTTCGGATATAGAAGAATATGTTCACAGAATCGGTCGAA
CTGGTCGCGTTGGCCATCTTGGAGAATCGGTATCATTTTTCAATGATAAC
AATGTAAATGTTGTCAAAGGACTTATTAACGTTTTGGAAGAGGCACAACA
GGAAGTACCTGTTTGGTTATATGAGAAATTAAAAGATATGAAGCATATCA
AACAATTTAGAAACCAGCAGAAAATGACGCCAAAGAGATACAATGGTTTT
GGTGGGCGAGATTATCGCCAGACATTCCCACCTAGAGATCCCAATCCTCA
GCCATTTCAAACTAGTTATTATTAGCGAAAAATTCGCATTCCATTGAGGA
ATAGTGAATGTATCATTTGTTAATTTAGGCGTATGCCTTTATTTGTGTGT
GTCTTTCACATGAAGAGGCAGGATATAAAATCATTTTTGCAGATGATGCT
ACTATATATTTTGTATTGATTCTAATTGCAGCGATGTTTTATTGAATTGT
TAACTTTATTTGTCTTGGTTTTATCCTGGTTTACATGCACTCTCTGAAAA
TGTTAATTATTGGTTTTAATTCCTATTTAATTTTAATTAAATTATATCTA
TTATTATAATGGTTTTTTAGATTTATGGCAAT
back to top

protein sequence of SMED30030115-orf-1

>SMED30030115-orf-1 ID=SMED30030115-orf-1|Name=SMED30030115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=549bp
MAQRNKDSYNDSNRPQWNRGYNVSRNKTQNKYPTDNFDNNERKSNGSYVN
NNYEYQVNNNQNKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTG
PDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRR
DLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAP
TRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATP
GRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVG
DRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEE
FRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGD
RKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEE
YVHRIGRTGRVGHLGESVSFFNDNNVNVVKGLINVLEEAQQEVPVWLYEK
LKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPPRDPNPQPFQTSYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0000428musculature system
PLANA:0002032epidermal cell
PLANA:0002060nephridiopore
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 381..462
e-value: 1.5E-34
score: 130.8
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 353..462
e-value: 1.6E-30
score: 105.7
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 356..501
score: 23.186
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 131..344
e-value: 6.9E-63
score: 224.9
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 143..329
score: 32.754
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 69..331
e-value: 3.8E-78
score: 264.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 332..506
e-value: 8.1E-57
score: 193.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..30
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 525..548
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..47
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 57..532
NoneNo IPR availablePANTHERPTHR24031:SF584ATP-DEPENDENT RNA HELICASE DDX3Ycoord: 57..532
NoneNo IPR availableCDDcd18051DEADc_DDX3coord: 88..336
e-value: 2.4155E-158
score: 449.49
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 341..471
e-value: 8.87502E-59
score: 189.641
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 136..317
e-value: 4.0E-50
score: 170.0
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 271..279
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 112..140
score: 8.394
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 193..479