Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30030098
Length (bp)2796
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase M60 domain-containing protein (SMED30030098) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30030098) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase M60 domain-containing protein (SMED30030098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30030098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030098

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30030098SMESG000011622.1 SmedASXL_018244SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30030098SMESG000011622.1 dd_Smed_v4_13298_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030098SMESG000011622.1 dd_Smed_v4_13298_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030098SMESG000011622.1 dd_Smed_v4_13298_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030098SMESG000011622.1 dd_Smed_v4_13298_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030098SMESG000011627.1 SMESG000011622.1 Contig24476newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030098SMESG000011622.1 dd_Smed_v6_13298_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30030098SMESG000011622.1 OX_Smed_1.0.10045ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 168.703 bits (426), Expect = 2.135e-42
Identity = 113/368 (30.71%), Postives = 185/368 (50.27%), Query Frame = 3
Query: 1542 GYYLEPGSTLMYKVDEMNGRWSM--SIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            G YL  G      + E      +   IGCHTD L   R +  R P +     +   E S    +GG L++   K ++   + +TI   VP P++ +  K ++++W++Q + N   W ++A DN+++ V +    NL      + +   WD +++    L +  +  +RPE  V D+  SAG+ HSGYPI  + +  + I N   +  +G WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  +P   + E       +R + IK +L + A   ++++WT     AL  Y Q+   FG+E F ++FA Y   +  PK ++ +MN W+   S  V +NL+P F  WG+PI  E+  S+ SL
Sbjct:  444 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKAR-KLSRAPVVTHQCWMDRTERSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKL-GKTSLEEWKRQMQENLAPWGELATDNIILTVPTT---NLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHE--ALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 799          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 168.703 bits (426), Expect = 2.135e-42
Identity = 113/368 (30.71%), Postives = 185/368 (50.27%), Query Frame = 3
Query: 1542 GYYLEPGSTLMYKVDEMNGRWSM--SIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            G YL  G      + E      +   IGCHTD L   R +  R P +     +   E S    +GG L++   K ++   + +TI   VP P++ +  K ++++W++Q + N   W ++A DN+++ V +    NL      + +   WD +++    L +  +  +RPE  V D+  SAG+ HSGYPI  + +  + I N   +  +G WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  +P   + E       +R + IK +L + A   ++++WT     AL  Y Q+   FG+E F ++FA Y   +  PK ++ +MN W+   S  V +NL+P F  WG+PI  E+  S+ SL
Sbjct:  444 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKAR-KLSRAPVVTHQCWMDRTERSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKL-GKTSLEEWKRQMQENLAPWGELATDNIILTVPTT---NLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHE--ALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 799          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2C (TRPM8 channel associated factor 2C [Source:HGNC Symbol;Acc:HGNC:53641])

HSP 1 Score: 166.777 bits (421), Expect = 4.457e-42
Identity = 121/401 (30.17%), Postives = 199/401 (49.63%), Query Frame = 3
Query: 1497 TFVIQSETANTKNPIGYYLE---PG------STLMYKVDEMNGRWSMS-----------IGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            T+   S    +K+PI   +    PG      ST +Y ++  N   S+S           IGCHTD L   R +  R P +     +   E S    +GG L++   K ++   + +TI   VP P++ +  K ++++W++Q + N   W ++A DN+++ V +    NL      + +   WD +++    L +  +  +RPE  V D+  SAG+ HSGYPI  + +  + I N   +  +G WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  +P   + E       +R + IK +L + A   ++++WT     AL  Y Q+   FG+E F ++FA Y   +  PK ++ +MN W+   S  V +NL+P F  WG+PI  E+  S+ SL
Sbjct:  308 TWTCSSSLYPSKHPITVEINGINPGNNDCWVSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKAR-KLSRAPVVTHQCWMDRTERSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKL-GKTSLEEWKRQMQENLAPWGELATDNIILTVPTT---NLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMDMRSRGVWGPIHELGHNQQWHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHE--ALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQQAFGWEPFTQLFAEYQTLSHLPKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 696          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 167.933 bits (424), Expect = 5.069e-42
Identity = 114/370 (30.81%), Postives = 188/370 (50.81%), Query Frame = 3
Query: 1563 STLMYKVDEMNGRWSMS-----------IGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            ST +Y ++  N   S+S           IGCHTD L   R +  R P +     +   E S    +GG L++   K ++   + +TI   VP P++ +  K ++++W++Q + N   W ++A DN+++ V +    NL      + +   WD +++    L +  +  +RPE  V D+  SAG+ HSGYPI  + +  + I N   +  +G WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  +P   + E       +R + IK +L + A   ++++WT     AL  Y Q+   FG+E F ++FA Y   +  PK ++ +MN W+   S  V +NL+P F  WG+PI  E+  S+ SL
Sbjct:  546 STGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKAR-KLSRAPVVTHQCWMDRTERSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKL-GKTSLEEWKRQMQENLAPWGELATDNIILTVPTT---NLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHE--ALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF1 (TRPM8 channel associated factor 1 [Source:HGNC Symbol;Acc:HGNC:22201])

HSP 1 Score: 159.844 bits (403), Expect = 1.924e-39
Identity = 104/343 (30.32%), Postives = 178/343 (51.90%), Query Frame = 3
Query: 1608 MSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL---QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            + IGCHTD L     + +R P + +N   ++    + +   GG L++   QN+K   S+ +T+   V  P++ +  +  +++W+++ + NPG W ++A DN+++ V +  +R L     + L+R  WD +++    L +  +  + P+  V D+  S G+ H+GYPI  + +  + + N  LI  KG WG  HE+G N Q  +W F   TTE T NL+C++ +  V  +P      + L+    R K ++ YL +  N   W +  + AL  Y Q+   FG+E F  +F  Y +    P  + DKMN W+ + S  V +NL P F  W +PI  E+  S+  L
Sbjct:  572 IQIGCHTDDLTRAS-KLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLG-SVPVTVKGAVHAPYYKL-GETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENP--EPLLRL-WDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIP-RSRANIALWPPV-REKRVRIYLSKGPNVKNWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYL 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 162.155 bits (409), Expect = 2.424e-40
Identity = 121/435 (27.82%), Postives = 196/435 (45.06%), Query Frame = 3
Query: 1338 CKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPI--GYYLEPG-STLMYKVDEMNGR-WSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWL--QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            C   P  +  D L+L I   ++K     ++   +        D    P   N    I + T   +  I  G YL PG  T +    E+ G+ W + +GC TD +  +     R P +H    +       ++ +GG ++L   +    + +++ +   V  P+F    + +V DW    R  P  WA++  +N+++  +S  IRNL      D +   WD +++    L +   K  R E  V D+  S G+ H+GYPI ++     G+ N+    K G WG  HE+GHN Q G W F   TTE T NL+ L+ + +V+ +    +         DR    K Y D   + + W    + AL  Y Q+   FG++ FK+VF+ Y D    P  ++ KMN +    S++V  NL P F  WG+PI    E ++  L
Sbjct:  480 CSNCPVESPKDHLMLHIGTEVYKVTPDPDALLPY-----IIKDRPNLPTLSNARVRITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSN-TLKRAPVVHARFPLDSEMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQTAVQAPYFK-SGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLD---RPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAYKCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAH--PAITPADRQARTKMYFDGGKDLNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 162.155 bits (409), Expect = 2.424e-40
Identity = 121/435 (27.82%), Postives = 196/435 (45.06%), Query Frame = 3
Query: 1338 CKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPI--GYYLEPG-STLMYKVDEMNGR-WSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWL--QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            C   P  +  D L+L I   ++K     ++   +        D    P   N    I + T   +  I  G YL PG  T +    E+ G+ W + +GC TD +  +     R P +H    +       ++ +GG ++L   +    + +++ +   V  P+F    + +V DW    R  P  WA++  +N+++  +S  IRNL      D +   WD +++    L +   K  R E  V D+  S G+ H+GYPI ++     G+ N+    K G WG  HE+GHN Q G W F   TTE T NL+ L+ + +V+ +    +         DR    K Y D   + + W    + AL  Y Q+   FG++ FK+VF+ Y D    P  ++ KMN +    S++V  NL P F  WG+PI    E ++  L
Sbjct:  480 CSNCPVESPKDHLMLHIGTEVYKVTPDPDALLPY-----IIKDRPNLPTLSNARVRITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSN-TLKRAPVVHARFPLDSEMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQTAVQAPYFK-SGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLD---RPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAYKCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAH--PAITPADRQARTKMYFDGGKDLNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 162.155 bits (409), Expect = 2.424e-40
Identity = 121/435 (27.82%), Postives = 196/435 (45.06%), Query Frame = 3
Query: 1338 CKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPI--GYYLEPG-STLMYKVDEMNGR-WSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWL--QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            C   P  +  D L+L I   ++K     ++   +        D    P   N    I + T   +  I  G YL PG  T +    E+ G+ W + +GC TD +  +     R P +H    +       ++ +GG ++L   +    + +++ +   V  P+F    + +V DW    R  P  WA++  +N+++  +S  IRNL      D +   WD +++    L +   K  R E  V D+  S G+ H+GYPI ++     G+ N+    K G WG  HE+GHN Q G W F   TTE T NL+ L+ + +V+ +    +         DR    K Y D   + + W    + AL  Y Q+   FG++ FK+VF+ Y D    P  ++ KMN +    S++V  NL P F  WG+PI    E ++  L
Sbjct:  480 CSNCPVESPKDHLMLHIGTEVYKVTPDPDALLPY-----IIKDRPNLPTLSNARVRITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSN-TLKRAPVVHARFPLDSEMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQTAVQAPYFK-SGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLD---RPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAYKCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAH--PAITPADRQARTKMYFDGGKDLNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.2 (si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-33])

HSP 1 Score: 156.762 bits (395), Expect = 1.026e-38
Identity = 116/388 (29.90%), Postives = 180/388 (46.39%), Query Frame = 3
Query: 1479 PKKENVTFVIQSETANTKNPI--GYYLEPG-STLMYKVDEMNG-RWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKAN--ESIKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            P   N    I + TA+++  I  G YL PG  T +    E+ G +W + +GC TD +  +     R P +H    +   +    + +GG ++      +  + +++ +   V  P+F    + +V DW  K R  P  WA++  +N+V+ + S  IRNL      D +   WD +++    L +   K +R E  V D+  SAG+ HSGYPI +       + N+    K   WG  HE+GHN Q   W F   TTE T NL+ ++ + KV  L    ++         R   IKKY     +   WT     AL  Y Q+   FG++ FK+VF+ Y D    P  ++ KMN +    S++V  NL P F  WG+PI    E  +  L
Sbjct:  518 PTVSNARVRITANTADSEEWISTGLYLSPGMKTYITIPPEIIGTKWQVQLGCQTDNIGGSN-VLKRAPVVHERFPLDSEKVQVCNLWGGLIYFVAPPESKVDGVEIVVQTAVQAPYFK-SGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDFIRNLE---RPDEVAKLWDAIMRSVSDLAATPAKFRRKERFVGDVQISAGFMHSGYPIMMLSSSASQLLNVKEAHKHDFWGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKV--LGVNKAKAHPCMTLESRQACIKKYFSGGKDLKNWTKAT--ALETYMQLQEKFGWDAFKKVFSLYHDMKDVPNDNAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHL 896          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.4 (si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-12])

HSP 1 Score: 153.68 bits (387), Expect = 9.592e-38
Identity = 112/388 (28.87%), Postives = 176/388 (45.36%), Query Frame = 3
Query: 1479 PKKENVTFVIQSETANTKNPI--GYYLEPG--STLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKAN--ESIKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            P   N    I + TA  +  I  G YL PG  + +    + +  +W + +GC TD +   +    R P +H    +   +    + +GG ++      +  + +++ +   V  P+F    + +V DW  K R  P  WA++  +N+V+ + S +IRNL      D +   WD +++    L +   K  R E  V D+  SAG+ HSGYPI +       + N+    K   WG  HE+GHN Q   W F   TTE T NL+ ++ + KV  +    +          R   IKKY     +   WT     AL  Y Q+   FG++ FK+VF+ Y D    P  ++ KMN +    S++V  NL P F  WG+PI    E  +  L
Sbjct:  522 PTVSNARVRITANTAGCEEWISTGLYLSPGMKTYITIPPEIIEKKWQVQLGCQTDDIGRLK-ILKRAPVVHEQFPLDSEKVQVCNLWGGLIYFVAPPKSKVDGVEIVVQTAVQAPYFK-SGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDLIRNLE---RPDEVAELWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMMLSSSASQLLNVKEAHKHDFWGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNRAKAHPCMTLE--SRQACIKKYFSGGKDLKNWTKAT--ALETYMQLQEKFGWDAFKKVFSLYHDMKDVPNDNAGKMNLYAKTFSKVVNHNLSPFFKTWGWPIQPNTEQELSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045101.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 158.303 bits (399), Expect = 5.721e-39
Identity = 112/369 (30.35%), Postives = 183/369 (49.59%), Query Frame = 3
Query: 1542 GYYLEPGST--LMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL-QNNKAN-ESIKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            G YL P  T  L++    +     + +GCH+D L  ++ E+YR P I V  I +  E    S + GG L++    ++N  +I + +    P P + ++ K ++  W +  R+ P  WA++  +N+++ V S  IR+L+     + +   WD ++     L ++     RPE  V D+  SAG+ H+GYP+ V+    + + N+S ++K+G WG  HE+GHN Q+  W F   TTE T NL+ +F    V  +P   +          R   I+ YL       N+++WT     AL  Y Q+   FG+E FK++F  Y   +     +  KMN W    S  V  NL+P F  WG+PI+ E    + +L
Sbjct:  533 GLYLSPKKTAVLVFPASAVQQGLQVQVGCHSDDLG-SKDEFYRAP-IVVRKISVHREKVQVSCYWGGLLYIIVKERSNLGTIPVQVYGAEPAPTY-IKGKTSLDSWLQSLRDLPPPWAELITENIILTVPSDAIRSLND---PEELLGFWDRMMVAITELAAIPTTFSRPERIVADVQISAGWMHAGYPVMVHLASVKYLTNLSCMQKEGLWGPIHELGHNQQQKVWEFPPHTTEATCNLWSVFVNETVVGVPRDKAN--SALEPASRAACIEAYLKTGPKLENWNVWT-----ALETYLQLQEGFGWEPFKQLFKDYQSMSGISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSAL 888          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000002244.1 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:100489234])

HSP 1 Score: 144.436 bits (363), Expect = 1.030e-34
Identity = 102/371 (27.49%), Postives = 181/371 (48.79%), Query Frame = 3
Query: 1542 GYYLEPGSTLM--YKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL--QNNKANESIKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLP---YYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSD--KMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            G YL P   ++  +    +   + + +GCH+D  + +  E      + V  I ++ +    S F GG L++  ++N    ++ + +    P P + ++ K ++  W    R  P  WA++  +N+++ V S  +R+L      + + + WD ++     L +   K  RPE  V D+  SAG+ H+GYPI    +  + + ++  +EK+G WG  HE+GHN Q+ QW F   TTE T NL+ ++ +  V  +P    +G+ +  +     R   IK YL   AN + W  + + AL  Y Q+    G++ F+ +   Y D ++   ++ +  KMN W    SR    NL+P F  WG+PID      + +L
Sbjct:  511 GLYLPPRKAVVIEFPASAVQQGFQVQVGCHSD--DPSAKETLNRAPVVVRRIHVDRQKVPVSSFWGGLLYIIVRSNSNFGTVPVRVYGAEPAPIY-IKGKTSLDSWLHSIRQLPAPWAELVTENIILTVPSDAVRSLKN---PEALLSLWDRIMAAIADLAAKPKKFPRPERIVADVQISAGWMHAGYPIMCDLESAKELTDLHHMEKEGIWGPIHELGHNQQKTQWEFPPHTTEATCNLWAVYVHETVLGIPRDRAHGNLQPNV-----RTSRIKSYLQNGANLEQW--DGWTALETYLQLQEGLGWDPFRRL---YRDPSISGMSNENTFKMNLWAEKFSRAAQTNLVPFFEAWGWPIDQSTRSKLSAL 865          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045059.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 144.436 bits (363), Expect = 1.410e-34
Identity = 107/372 (28.76%), Postives = 180/372 (48.39%), Query Frame = 3
Query: 1542 GYYLEPGST--LMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANES---IKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLP---YYGSEELKLYRDYDRIKDIKKYLDENANF---DIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            G YL P  T  L +    +     + +GC  D L+    ++ R P + V    ++ +  + S F G L     KAN +   I + +    P P + ++ K  +  W +  R  P  WA++  +N+++ V S  IR+LS     + + + WD ++     L ++     RPE  V D+  SAG+ H+GYPI  + +  + + ++++++  G WG  HE+GHN Q+  W F   TTE T NL+ ++ +  V  +P    +GS + +    Y     I++Y+   +N    D+WT     AL  Y Q+   FG+E FK++F  Y   +     +  KMN W    S  V  NL+P F  WG+PI+ E    + +L
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQGLKVQVGCQADDLSSAE-KYCRAPVV-VRKCHVDRQKVSVSCFWGGLLYIIVKANSNLGIIPVKVYGAEPAPVY-IKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSD---PEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHLESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACY-----IQEYVKNGSNLEQWDVWT-----ALETYLQLQEGFGWEPFKQLFKDYQSMSGISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSAL 888          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: suox (sulfite oxidase [Source:Xenbase;Acc:XB-GENE-985202])

HSP 1 Score: 143.665 bits (361), Expect = 1.870e-34
Identity = 105/367 (28.61%), Postives = 180/367 (49.05%), Query Frame = 3
Query: 1542 GYYLEP--GSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANES---IKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPY-YGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            G YL P   + L + V  +   + + +GC TD L+  +   +R P + V  I ++ +  A S   G L     +A+     I + +    P P + ++ + +   W    R  P  WA++  +N+++ V S  +R+L+     + + + WD ++     L ++     RPE  V D+ TSAG+ H+GYPI  +++  + + ++  ++K G WG  HE+GHN Q  +W F   TTE T NL+ ++ +  V  +P      +L+      R+K   +   +  N+++WT     AL  Y Q+   FG+E FK +F +  D N      + KMN W    S  +  NL+P F  WG+PIDS    S+ +L
Sbjct:  536 GLYLAPRKAAVLEFPVSVVQQGFWVQVGCQTDDLS-AKEMLHRAPVV-VRKIHVDCQKVAVSSLWGGLLYVIVRADSKLGPIPVRVYGAEPAPVY-IKGQTSPDSWLHSVRKLPAPWAELVTENIILTVPSDAVRSLTD---PESLLSYWDRIMGAIAELAAIE-TFPRPERFVADVQTSAGWMHAGYPIMCHEESVKELTDLRHMQKNGMWGPIHELGHNQQRKEWEFPPHTTEATCNLWSVYVHEMVLGIPRDQAHPDLQPEARRSRLKAYLQGGSKLKNWEVWT-----ALETYLQLQEGFGWEPFKSLFGH--DEN------TSKMNLWAEKFSWAMQTNLVPFFEAWGWPIDSVTRSSVSAL 882          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045084.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 143.28 bits (360), Expect = 2.549e-34
Identity = 106/372 (28.49%), Postives = 179/372 (48.12%), Query Frame = 3
Query: 1542 GYYLEPGST--LMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANES---IKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLP---YYGSEELKLYRDYDRIKDIKKYLDENANF---DIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            G YL P  T  L +    +     + +GC  D L+    ++ R P + V    ++ +  + S F G L     KAN +   I + +    P P + ++ K  +  W +  R  P  WA++  +N+++ V S  IR+LS     + + + WD ++     L ++     RPE  V D+  SAG+ H+GYPI  + +  + + ++++++  G WG  HE+GHN Q+  W F   TTE T NL+ ++ +  V  +P    +GS + +    Y     I++Y+   +N    D+WT     AL  Y Q+   FG+E FK +F  Y   +     +  KMN W    S  V  NL+P F  WG+PI+    + + +L
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQGLKVQVGCQADDLSSAE-KYCRAPVV-VRKCHVDRQKVSVSCFWGGLLYIIVKANSNLGIIPVKVYGAEPAPVY-IKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSD---PEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHLESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACY-----IQEYVKNGSNLEQWDVWT-----ALETYLQLQEGFGWEPFKRLFKDYQSMSGISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSAL 888          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf2 (TRPM8 channel-associated factor 2 [Source:MGI Symbol;Acc:MGI:2385258])

HSP 1 Score: 166.392 bits (420), Expect = 9.940e-42
Identity = 112/361 (31.02%), Postives = 186/361 (51.52%), Query Frame = 3
Query: 1542 GYYLEPGSTLMYKVDE--MNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEI 2597
            G YL  G +    V E   +    + IGCHTD L     + +R P +     +   + S    +GG L++   K  +   + +TITN VP P++ +  K ++++W+   + N G W ++A DN+++ V +  ++ L      + +   WD +++    L S  +  QRPE  V D+  SAG+ HSGYPI  + +  + + +++ I  KG WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  +P   ++     +  +R K IK++L + A   N+++WT     AL  Y Q+   FG+E F  +FA Y      P+ +  KMN W+ + S  V +NL+P F  WG+PI  ++
Sbjct:  549 GLYLLEGQSTEISVSEPAASAGLKVQIGCHTDDLTFAI-KLFRAPVVTYQCCMNRTQRSVSCLWGGLLYIIVPKGCQLGPVSVTITNAVPAPYYKL-GKTSLEEWKSCIQKNLGPWGELATDNVILTVPTASLKTLEN---PEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESVQELVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPR--AQAHPQLKPEEREKRIKEHLQKGAPLQNWNVWT-----ALETYLQLQEVFGWEPFITLFAEYQTIFYIPEDNECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDV 897          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 155.606 bits (392), Expect = 2.860e-38
Identity = 105/346 (30.35%), Postives = 177/346 (51.16%), Query Frame = 3
Query: 1608 MSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL---QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQR-NNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLE---PKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            + IGCHTD L     + +R P + +N   ++    + +   GG L++   QN+K   S+ LT+   V  PF+ + + +  ++W+++    PG W ++A DN+++ V +  +R L     + L+R  WD +++    L    +  + P+  V D+  S G+ H+GYPI  + +  + + N  LI  KG WG  HE+G N Q  +W F   TTE T NL+C++ +  V  +P      + L+    R K ++ YL +  +   W +  + AL  Y Q+   FG+E F  +F  Y +       P  + DKMN W+ + S+ V +NL P F  WG+PI  E+  S+  L
Sbjct:  572 IQIGCHTDDLTRAS-KLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLG-SVPLTVKGAVRAPFYKLGETSK-EEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENP--EPLLRL-WDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIP-RSRANIALWPPV-REKRVRIYLSKGPSVKHWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYL 906          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 155.606 bits (392), Expect = 2.860e-38
Identity = 105/346 (30.35%), Postives = 177/346 (51.16%), Query Frame = 3
Query: 1608 MSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL---QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQR-NNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLE---PKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            + IGCHTD L     + +R P + +N   ++    + +   GG L++   QN+K   S+ LT+   V  PF+ + + +  ++W+++    PG W ++A DN+++ V +  +R L     + L+R  WD +++    L    +  + P+  V D+  S G+ H+GYPI  + +  + + N  LI  KG WG  HE+G N Q  +W F   TTE T NL+C++ +  V  +P      + L+    R K ++ YL +  +   W +  + AL  Y Q+   FG+E F  +F  Y +       P  + DKMN W+ + S+ V +NL P F  WG+PI  E+  S+  L
Sbjct:  572 IQIGCHTDDLTRAS-KLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLG-SVPLTVKGAVRAPFYKLGETSK-EEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENP--EPLLRL-WDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIP-RSRANIALWPPV-REKRVRIYLSKGPSVKHWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYL 906          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 155.606 bits (392), Expect = 2.860e-38
Identity = 105/346 (30.35%), Postives = 177/346 (51.16%), Query Frame = 3
Query: 1608 MSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL---QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQR-NNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLE---PKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            + IGCHTD L     + +R P + +N   ++    + +   GG L++   QN+K   S+ LT+   V  PF+ + + +  ++W+++    PG W ++A DN+++ V +  +R L     + L+R  WD +++    L    +  + P+  V D+  S G+ H+GYPI  + +  + + N  LI  KG WG  HE+G N Q  +W F   TTE T NL+C++ +  V  +P      + L+    R K ++ YL +  +   W +  + AL  Y Q+   FG+E F  +F  Y +       P  + DKMN W+ + S+ V +NL P F  WG+PI  E+  S+  L
Sbjct:  572 IQIGCHTDDLTRAS-KLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLG-SVPLTVKGAVRAPFYKLGETSK-EEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENP--EPLLRL-WDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIP-RSRANIALWPPV-REKRVRIYLSKGPSVKHWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYL 906          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf3 (TRPM8 channel-associated factor 3 [Source:MGI Symbol;Acc:MGI:3042585])

HSP 1 Score: 155.221 bits (391), Expect = 4.009e-38
Identity = 115/384 (29.95%), Postives = 192/384 (50.00%), Query Frame = 3
Query: 1494 VTFVIQSETANTKNPIGYYLEPG--STLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQ-NNKANE-SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            +T  I ++  N+    G YL  G  + ++   +  + +  + IGCH D ++  R  ++R P +     +  ++ S    +GG L++   NK N+ ++ +TI   V  P+F +  K   ++W+    ++   W ++A DN+++ + +  ++ L   Y    +   WD +V+    L +  +  QR E  VLD   S G+ HSGYPI       EGI +   I   G WG+ HE+GHN Q+  WTF   TTE   NL+ ++ +  V  +P   +    L  +  R + IK +L++ A   N+ +WT     AL  Y Q+   FG+E F +VFA Y   +  P+ + DKMN W+   S  V +NL P F  WG+P+   +  S+ SL
Sbjct:  523 ITIKISTDNDNSWVSTGLYLPEGQVAQVLLPSEATHAKLKVLIGCHRDNISQAR-TYFRPPVMTYVYHLTSSQTSISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYFRL-GKTTQEEWKNLITHSKAPWGELATDNIILTIPTVNLKELQDPYP---LLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIVEGIISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVLNIPREQAHP-SLNPELRR-QRIKYHLNKGAPLSNWIMWT-----ALETYLQLQEGFGWEPFIQVFADYRTLSGLPQNNEDKMNLWVKKFSEAVHKNLAPFFEAWGWPVKYAVAKSLASL 894          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NFQ2|TCAF2_HUMAN (TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 2.434e-41
Identity = 114/370 (30.81%), Postives = 188/370 (50.81%), Query Frame = 3
Query: 1563 STLMYKVDEMNGRWSMS-----------IGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            ST +Y ++  N   S+S           IGCHTD L   R +  R P +     +   E S    +GG L++   K ++   + +TI   VP P++ +  K ++++W++Q + N   W ++A DN+++ V +    NL      + +   WD +++    L +  +  +RPE  V D+  SAG+ HSGYPI  + +  + I N   +  +G WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  +P   + E       +R + IK +L + A   ++++WT     AL  Y Q+   FG+E F ++FA Y   +  PK ++ +MN W+   S  V +NL+P F  WG+PI  E+  S+ SL
Sbjct:  546 STGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKAR-KLSRAPVVTHQCWMDRTERSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKL-GKTSLEEWKRQMQENLAPWGELATDNIILTVPTT---NLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHE--ALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 903          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q921K8|TCAF2_MOUSE (TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 6.953e-41
Identity = 112/361 (31.02%), Postives = 186/361 (51.52%), Query Frame = 3
Query: 1542 GYYLEPGSTLMYKVDE--MNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENA---NFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEI 2597
            G YL  G +    V E   +    + IGCHTD L     + +R P +     +   + S    +GG L++   K  +   + +TITN VP P++ +  K ++++W+   + N G W ++A DN+++ V +  ++ L      + +   WD +++    L S  +  QRPE  V D+  SAG+ HSGYPI  + +  + + +++ I  KG WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  +P   ++     +  +R K IK++L + A   N+++WT     AL  Y Q+   FG+E F  +FA Y      P+ +  KMN W+ + S  V +NL+P F  WG+PI  ++
Sbjct:  549 GLYLLEGQSTEISVSEPAASAGLKVQIGCHTDDLTFAI-KLFRAPVVTYQCCMNRTQRSVSCLWGGLLYIIVPKGCQLGPVSVTITNAVPAPYYKL-GKTSLEEWKSCIQKNLGPWGELATDNVILTVPTASLKTLEN---PEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESVQELVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPR--AQAHPQLKPEEREKRIKEHLQKGAPLQNWNVWT-----ALETYLQLQEVFGWEPFITLFAEYQTIFYIPEDNECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDV 897          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IG42|TCAF_DANRE (TRPM8 channel-associated factor homolog OS=Danio rerio OX=7955 GN=tcaf PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.478e-40
Identity = 122/435 (28.05%), Postives = 197/435 (45.29%), Query Frame = 3
Query: 1338 CKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPI--GYYLEPG-STLMYKVDEMNGR-WSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWL--QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            C   P  +  D L+L I   ++K     ++   +        D    P   N    I + T   +  I  G YL PG  T +    E+ G+ W + +GC TD +  +     R P +H    +       ++ +GG ++L   +    + +++ + N V  P+F    + +V DW    R  P  WA++  +N+++  +S  IRNL      D +   WD +++    L +   K  R E  V D+  S G+ H+GYPI ++     G+ N+    K G WG  HE+GHN Q G W F   TTE T NL+ L+ + +V+ +    +         DR    K Y D   + + W    + AL  Y Q+   FG++ FK+VF+ Y D    P  ++ KMN +    S++V  NL P F  WG+PI    E ++  L
Sbjct:  480 CSNCPVESPKDHLMLHIGTEVYKVTPDPDALLPY-----IIKDRPNLPTLSNARVRITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSN-TLKRAPVVHARFPLDSEMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQNAVQAPYFK-SGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLD---RPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAYKCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAH--PAITPADRQARTKMYFDGGKDLNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5PJN5|TCAF1_BOVIN (TRPM8 channel-associated factor 1 OS=Bos taurus OX=9913 GN=TCAF1 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.440e-39
Identity = 105/343 (30.61%), Postives = 178/343 (51.90%), Query Frame = 3
Query: 1608 MSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL---QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            + IGCHTD L     + +R P + +N   ++    + +   GG L++   Q++K   ++ +TI   V  P++ + +    ++W++Q + NPG W ++A DN+++ V +  +R L     + L+R  WD +++    L +  +  + P+  V D+  S G+ H+GYPI  + +  + + N  LI  KG WG  HE+G N Q  +W F   TTE T NL+C++ +  V  +P  G   + L+    R K ++ YL +  N   W +  + AL  Y Q+   FG+E F  +F  Y +    P  + DKMN W+ + S  V +NL P F  W +PI  E+  S+  L
Sbjct:  572 IQIGCHTDDLTRAS-KLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQSSKLG-TVPVTIKGAVRAPYYKLGETTQ-EEWKRQIQENPGPWGELATDNIILTVPTANLRTLENP--EPLLRL-WDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIP-RGRANIALWPPV-REKRVRIYLGKGPNVKNWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTDNVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYL 903          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y4C2|TCAF1_HUMAN (TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3)

HSP 1 Score: 159.844 bits (403), Expect = 9.540e-39
Identity = 104/343 (30.32%), Postives = 178/343 (51.90%), Query Frame = 3
Query: 1608 MSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPF-GGTLWL---QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            + IGCHTD L     + +R P + +N   ++    + +   GG L++   QN+K   S+ +T+   V  P++ +  +  +++W+++ + NPG W ++A DN+++ V +  +R L     + L+R  WD +++    L +  +  + P+  V D+  S G+ H+GYPI  + +  + + N  LI  KG WG  HE+G N Q  +W F   TTE T NL+C++ +  V  +P      + L+    R K ++ YL +  N   W +  + AL  Y Q+   FG+E F  +F  Y +    P  + DKMN W+ + S  V +NL P F  W +PI  E+  S+  L
Sbjct:  572 IQIGCHTDDLTRAS-KLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLG-SVPVTVKGAVHAPYYKL-GETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENP--EPLLRL-WDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIP-RSRANIALWPPV-REKRVRIYLSKGPNVKNWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYL 903          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S6KMG4 (Peptidase M60 domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 372/903 (41.20%), Postives = 539/903 (59.69%), Query Frame = 3
Query:   69 NILLHKPVKVSEDTEKSKXXXXXXXXXXXXXFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPXXXXXXXXXXXXXXAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFP-EDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIK 2774
            NILL+K + V+ D        +  N + C  F+ +  K   FDL K Y++ K+I+ N   ++ I  +FY+G EF  C+F   I+ Y  C  D  +   +  E+ C+     G+++ ++ G+    D      +C +E +G   +     TRP + S+   P+  ++F+    IR NV    +P YS+A+ +LN NC+PII+       FGVAC    GK R+  F K+ + +            +NL  W++        I S  +  + +F   +K G+++  DVW+   +DI    K + LNG +S+ ++ TFW   + EAR SYL+ LN+FNVDF   F +W  P      +  ++D+L+G+E++L RM  NH+YL+ K   L   M   P   ++NSK+  +L+ ++KKY  LL  ICPC    AT+ NDR L+  FG L K+QAL  S FK PC DLFPGDFV  P K  V   +   T +T NPIGYYLE GSTL Y +   +G W++S+GCHTD L D+   W RYP+I V  I I   G  +S FGG LWL N+    +I + ++N+V TPFFN+RD NA  +W ++R +PG+W+QIAGD++V C ESR ++N    Y+ DLMRN WD  V+M++ L + +WK QRP+ITVLD+M SAGYGHSGYP+ +Y  WF+ +FN + I   GSWGMCHE+GHN+Q+ +WTF+GTTEVTNNL CLF Y K++K+P YG++   L  D      I  YL+  A F  WTS P+ ALLIY+QM+ + G+ F+K++F YY  NN+ P TDS+KM T+MN+TS I  QN++ IF FWGFPID+ +   + +L C FP +DF   +S  R   +  KY  C+  S ++ D+S +     +R NFI+
Sbjct:   24 NILLNKTILVASDYPSYATNINDGNVKTCMWFESENKKMIAFDLGKTYKINKIIVRNGNYRATIEANFYIGNEFQACRFQTLIRTYGKC--DPLVQNNSTNELTCRDPSNVGRYLVLIKGNPFDYDPIERLYLCDIEVYGVESTNVAVPTRPVVDSSSLDPITKDFFKIAPIIRNNVPIATIPYYSSAVIYLNRNCEPIIYDNTTSLAFGVACES--GKGRMVAFAKSAYLRNMNLDPTQNQLRTNLLSWLTFGNPSPPTIISSQVKKMSDFYTLIKPGTVVYFDVWSSHPDDILNTWKALLLNGTVSMVVEITFWVSNTVEARNSYLQILNIFNVDFLNTFISWSSPINSEMPDSMFSDNLIGLEDILSRMLLNHDYLLSKASLLNGLMSKYPASMLNNSKLSVILIAIIKKYESLLKWICPCDVQKATDLNDRKLIRFFGELLKNQALAYSNFKAPCGDLFPGDFVASPPKVTVRLNLVGITPSTDNPIGYYLEAGSTLEYNIIVSSGSWAISVGCHTDNLPDSLAGWARYPSITVYRIPISGIGHIYSAFGGVLWLYNDVVGSNITIELSNVVVTPFFNLRDSNAASNWNERRYSPGIWSQIAGDSIVFCEESRRLKNFDSQYMVDLMRNIWDKAVRMEMVLTNTDWKIQRPQITVLDVMISAGYGHSGYPVELYQSWFDSVFNSTSIRTIGSWGMCHEVGHNLQKSKWTFYGTTEVTNNLQCLFVYAKLFKIPRYGTDLSSLGSD---TSTISAYLEGGAVFSQWTSNPWLALLIYSQMSQYLGWGFYKDLFEYYDTNNISPSTDSEKMITFMNITSIISQQNMISIFDFWGFPIDNNLSQQLSTLPCFFPADDFLVALSPKRKNYISNKYPQCNSKSSFYKDYSPDLFINGMRPNFIQ 919          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S6KMG0 (Peptidase M60 domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 363/911 (39.85%), Postives = 531/911 (58.29%), Query Frame = 3
Query:   60 GQENILLHKPVKVSEDTEKSKXXXXXXXXXXXXXFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPXXXXXXXXXXXXXXAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDW-EKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQ-WTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDN-NLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIKTKV 2783
             QENILL KP   ++  E  KN NDG+     +    K V + VFDL+ VY V+K+I+ N K +  +  + YVG E   C  H+QI+ YK+C++ V +     I VNC  SG  G++IA+V G F +          ++EA+G+LI       +P I S        N F   + +R N+  + V  YS     +NE C+PIIW      TF  AC   + + +   FGK  +F   ++  D     ++   W+S      N++ S+   ++ + R  +KDG I+D        +++ +E+K +   G+IS+  DH  +    ++   S  + +N+FN+     +  +      T  + D+ ++ L ++  L+++  N++YL++ G+ L+ +M  +P K + N+K+  +    +KKY+ L++ ICPCK DPAT+ +DR ++ IFG+  KSQ L +SK+K PCIDLFP DF + PK + V   +  E A T+ PIGYYL  G TL YK+    G+W +S+GCH+D L + R EWYRYP+I+ N + +  EG+ FSPFGG LWL N+  N SI + ++N+V TPFFN+ D++AV DW E QR + GLWAQIAG++MV C  S  +R   G YLK LM  +WD +V+ +     ++W+  RP  TVLDIMTS GY HSGYP+S YDDWF  IF+ + I++KGSWGMCHE+GHN QE   WT    +E TNN+FCLFN  K WKLPYYGS +  L  +YD   +IK YLD  A+  +W    +  L IY QMANHFGF FF + F YY ++  L+  +D +K + W NVTS I  QNL+PIF  W  PI  E+   +   +C  P+DF+ + S  R + +  KY  C   S ++ DF+ E+L    R NFIK K+
Sbjct:   27 AQENILLKKPAYANDYKEYIKNSNDGDKTTGMW-LRSKNVMYIVFDLQSVYNVEKVIITNGKYRGEVPFTIYVGDEMRICHLHRQIKNYKVCKSGV-IQNSNDISVNCAGSGVKGRYIAIVKGEFLTEKLVEELNFYEIEAYGQLIGAGPQFAKPTIPSQLVQKASRNDFPLARELRKNIPVMKVDGYSMGFVKINEKCEPIIWDVKWNLTFAFACYTDNKQGKALFFGKEWYFWYIMNDADKTEIRTSFVNWLSSGNKNPNYVNSENFKTISDVRGALKDGDILDFHTTVDYPDEVIEEIKSLLARGKISLVFDHDSFIAVDEKVTRSNDKIMNMFNIASDTTYFTFGSSGEYTIKDSDFTEEFLDLKVRLRKLVDNYDYLLENGQFLLNSMNKMPPKIIENAKLDDVSKDFLKKYDYLISYICPCKDDPATDVSDRSIISIFGLFAKSQGLAHSKYKLPCIDLFPMDFKSAPKLKQVVLEVFGEIAYTRIPIGYYLPAGETLKYKIQASTGKWGISVGCHSDILGEKRSEWYRYPDIYTNSVPLSEEGTIFSPFGGVLWLVNSNENASISIHLSNVVLTPFFNILDESAVSDWNENQRKHQGLWAQIAGEDMVFCERSDRLRQFDGQYLKSLME-SWDRVVRNNYVFAGLDWRKYRPSQTVLDIMTSVGYAHSGYPVSTYDDWFVNIFDSNYIKEKGSWGMCHELGHNQQEFHLWTMSTVSEATNNIFCLFNTAKEWKLPYYGSTKELLDGNYD---EIKSYLDGGADLAVWKESAYLELAIYVQMANHFGFGFFNKAFKYYLNHPELKADSDEEKYDLWANVTSTITNQNLMPIFDLWNIPIGDEMRKYLSKFQCFLPDDFFLKSSRSREEFILKKYPDCHRKSTFYEDFNPESLTQGHRPNFIKKKL 931          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V4A0M8 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_165593 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.273e-65
Identity = 157/480 (32.71%), Postives = 244/480 (50.83%), Query Frame = 3
Query: 1335 PCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGR-WSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEG-----IFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDEN-ANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLE--PKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKYKS-CDFNSKYF--SDFSEE 2738
            P +  P  +S  + L+ +   L K    VN     P I  FPGDF + P K +VT  + S   +  +P GYY++ G +L   V   NG+ W++ IG H+D L+  + E  R+PN+     + E      + FGG ++  +    +SI + + N++  P F++     ++ W  +R  PGLWA I  + ++I + S+ IRNL G     +M+  WD ++K    LK ++ ++ R +  V D+  SAGY HSGYP+  + D         + N   +  KGSWG+ HE GHNMQEG WTF GTTEVT N+F L   + +      G   +      +++ + K+YL  N  N+  W S+P  AL IYAQ+A+H G+  FKEVF  Y   N    P  ++D+++ W  + S +   NL  +  FW  P+  +    M   +   P+D    ++  RT ++ AKY S C     Y    DF+ E
Sbjct:  475 PSEHCPVKSSEGKALIGLCETLNK-MGKVNQIL--PGIANFPGDFESTPSKTSVTLTLSSYQEDV-HPTGYYVQAGDSLAVSVLSQNGKGWTVQIGAHSDCLS-GQSELKRWPNVVCCKPLNEQCTIVKATFGGLVYFTSPSNQQSITVQLDNVIQAPLFDLTLPTTIEQWNGRRQAPGLWADICSEFLIITLPSKSIRNLDGPV--SVMKK-WDEVLKAHFHLKGIDIRNHRKQWLVTDVQPSAGYMHSGYPVVTHLDVANPSHEFFLLNSHNLNTKGSWGVFHEFGHNMQEGVWTFPGTTEVTVNIFTLHAMDTL-----IGKRPIVHEWLQNQMSNAKRYLYHNDQNYSHWKSDPGIALFIYAQIAHHLGWGVFKEVFRRYGRMNPSSYPNKENDQIDLWYTLLSEVSQLNLASLVDFWKIPLSDKARREMSKFQPFLPDDDVMRMAPERTHMILAKYHSNCLRQPAYIVKDDFNTE 941          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3I0H4 (TRPM8 channel-associated factor 2-like OS=Lingula unguis OX=7574 GN=LOC106159184 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.806e-62
Identity = 145/475 (30.53%), Postives = 233/475 (49.05%), Query Frame = 3
Query: 1335 PCKFDPATNSNDRLLLEIFGILFK---SQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGR----WSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSG-TYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEG----------IFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSD-----KMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKY 2690
            P    PA  S  R  + + G+L++    QA      K P I +FPGDF + P  + V   + ++    +   GYY+  G  +   V    G     W + IG H D+L + +  W R+P++ V + +      + SP+GG L+  + + N  + + + N+V  PFF++     V+DW ++RN PGLWA++AG ++V  V S  +R +   T +  L    WD  V     L+  +   Q+ E  V D   SAGY H+GYPI  + D  +           +F+ S ++  G+WG+ HEIGHNMQ   WTF G  EVTNN+F L+ Y  V     + +  +K +    R + + + L    +   W  +PF AL +Y+Q+A+ FG+  FK VF  Y +N+++ + +S+     K++ W    S IV  NL P+  FWG P+ + +  ++       P D      + R   V   Y
Sbjct:  252 PSPKSPANTSAFRASVRVLGMLYRMTPPQAFC----KLPGIGVFPGDFSSKPPLQTVRLNLTTKH-RQRLSTGYYVPAGQPVKVTVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWPDVAVLEELKATTALS-SPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWAELAGRHIVFTVPSTSVREIDDPTTILAL----WDSAVAAQHDLRGTDRNLQKRERVVADEQPSAGYMHAGYPIVTHLDVVDPNFQYNGSDNFVFSESGMKSYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAWNNPTMKKF----RAEKLPRLLQSQPSLSDWKKDPFFALCVYSQLAHEFGWRSFKTVFRLY-ENSVKKEEESNQDDGAKIDMWFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNY 711          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3KG34 (TRPM8 channel-associated factor 2 OS=Lingula unguis OX=7574 GN=LOC106181552 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 2.601e-60
Identity = 144/475 (30.32%), Postives = 233/475 (49.05%), Query Frame = 3
Query: 1335 PCKFDPATNSNDRLLLEIFGILFK---SQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGR----WSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSG-TYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEG----------IFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSD-----KMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKY 2690
            P    PA  S  R  + + G+L++    QA      K P ID+FPGDF   P  + V   + ++    +   GYY+  G  +   V    G     W + IG H D+L + +  W R+P++ V + +      + SP+GG L+  + + N  + + + N+V  PFF++     V+DW ++RN PGLW ++AG ++V  V S  +R +   T +  L    WD  V     L+  +   Q+ E  V D   SAGY H+GYPI  + D  +           +F+ S ++  G+WG+ HEIGHNMQ   WTF G  EVTNN+F L+ Y  V     + +  +K +    R + + + L    + + W  +PF AL +Y+Q+A+ FG+  FK VF  Y +N+++ + +S+     K++ +    S IV  NL P+  FWG P+ + +  ++       P D      + R   V   Y
Sbjct:  252 PSPKSPANTSTLRANVRVLGMLYRMTPPQAFC----KLPGIDVFPGDFSFKPPLQTVRLNLTTK-HRQRLSTGYYVPAGQPVKVAVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWPDVAVLEELKATTALS-SPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWTELAGRHIVFTVPSTSVREIDDPTTILAL----WDSAVAAQHDLRGTDPNFQKRERVVADEQPSAGYMHAGYPIVTHLDVVDPNFQYNGSDNFVFSESGMKLYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAWNNPTMKKF----RAEKLPRLLQTQPSLNDWKKDPFFALCVYSQLAHEFGWGSFKTVFRLY-ENSVKKEEESNQDDGAKIDMYFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNY 711          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 139.813 bits (351), Expect = 2.071e-33
Identity = 116/437 (26.54%), Postives = 194/437 (44.39%), Query Frame = 3
Query: 1338 CKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPI--GYYLEPGSTLMYKVDE--MNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKAN--ESIKLTITNIVPTPFFNVRDKNAVKDWEKQ-RNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFH-GTTEVTNNLFCLFNYNKVWKLPYYGSEE-LKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVF-AYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            C   P  ++ D+LLL +   ++K     N     P I     D    P   N    + + T + +  I  G YL PG      V    M+  W + IGC TD L  +     R P +H    + ++    ++ +GG ++L        + +++ +   +  P++    + +V +W  + RN P  WA++  +N++I ++S +IR L                       +       R E  V D+  S G+ H+GYPI +       + N     K G WG  HE+GHN Q   W F   TTE T NL+ ++ + +V  +    + E +   R + R +       +   + +WT     AL  Y Q+ + FG++ FK+VF AY++ NN+ P  ++ KMN +    S++V  NL P F  WG+PI    E ++ SL
Sbjct:  481 CNSCPIESAKDKLLLHVGSEVYK--VCQNPDALLPFIIT---DIPNLPSVSNARIRVSANTGDGEEWISTGLYLSPGMRTFVAVPAEIMDKGWQLQIGCQTDHLG-HADVLRRAPVVHERFALDKDMLQVWNLWGGLIYLIAPPKCKLDGVEVIVQTAIKAPYYK-SGETSVANWMNEIRNAPAPWAELEFENIIITLQSEVIRQLD----------------------RPDEVAFPRKERFVADVQISHGFMHAGYPIMILSCSAPELVNPESARKFGIWGAIHELGHNQQRWAWEFPPNTTECTCNLWSVYVHEEVLGVNRASAHENMSPERRWGRAQSYAMGGRQLDQWSMWT-----ALETYMQLQDRFGWDAFKKVFTAYHTINNV-PGDNNGKMNLYAETFSKVVNMNLAPFFKAWGWPIQPSTEDALSSL 882          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051129.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5658439:5662219:-1 gene:ENSAMXG00000036822.1 transcript:ENSAMXT00000051129.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 7.002e-27
Identity = 70/198 (35.35%), Postives = 98/198 (49.49%), Query Frame = 3
Query: 2028 RPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            R E  V D+   AG+ HSGYPI ++      + N  +  K   WG  HE+GHN Q   W F   TTE T NL+ ++ +  V  L    ++         R   IKKY++   N   WT   + AL  Y Q+   FG++ FK+VFA Y D    P+ +  KMN +    S++V +NL P F  WG+PI    E  + SL
Sbjct:   16 RKERFVADVQILAGFMHSGYPIMMHTVSAPDLVNPYVSGKSDFWGPVHELGHNQQHSDWEFPPYTTECTCNLWSVYVHEVV--LGVKKADAHGQMTPQRRQNRIKKYIEGGRNLKDWTV--WTALETYMQLQEEFGWDAFKKVFAAYHDMTGVPQDNKGKMNLYAETFSKVVNRNLTPFFKAWGWPIQPSTEEQLCSL 209          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000976.1 (pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 gene:ENSPMAG00000000885.1 transcript:ENSPMAT00000000976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 1.514e-41
Identity = 114/390 (29.23%), Postives = 187/390 (47.95%), Query Frame = 3
Query: 1449 DLFPGDFVTPPKK--ENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMN-GRW-SMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENE---GS--AFSPFGGTLWL--QNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEK-QRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHG-TTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGF 2579
            D+FPG  + P  +  + VT  + S+   T    G Y  P   ++  +  +  GR   + +GCHTD L D++    R+P +  +  ++  E   G+    S +GG L+L      +   I++ +      P+F +  + +++ W++ +R+ P  W+++A D++++ V S   R L+    + LMR  WD +      L +    S RPE  V+D   S G+ H+GYPI V+      + N   +  +G WG  HE+GHN Q   W F   TTE TNNLF ++ + +V  L    +      R  +R + ++ ++D       WT   F  L  Y Q+   FG++ F  +F  Y      P T   KM+ W    SR VG+NL P F  WG+
Sbjct:  496 DIFPGRPLEPTYRGWQEVTIDVSSKEGLTWVSTGLYAPPAQRVLLDLPSLALGRGIQIQLGCHTDQLYDSK-TMKRHPEVTRSMPVVRGEMDRGAMEVASSWGGLLYLLVPEGVSLGKIRVRVRGAARAPYFKL-GETSLQHWQEFERHYPAPWSELACDSLILTVPSEAARGLADP--ERLMRL-WDRMTGAIAYLAAEPHPSARPERIVVDEQISHGWMHAGYPIMVHRASIPKLLNEQEMRAEGMWGPLHELGHNRQRPAWNFPPHTTEATNNLFAVYVHEEV--LGVARARAHPDLRPAERERRLRDHVDAGCPLAAWTV--FTCLETYLQLQEAFGWDPFVRLFGDYQRAASTPSTMEAKMSEWAERFSRCVGRNLAPFFSAWGW 876          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-210b2.3 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:101159605])

HSP 1 Score: 150.599 bits (379), Expect = 8.946e-37
Identity = 120/439 (27.33%), Postives = 193/439 (43.96%), Query Frame = 3
Query: 1332 CPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKN--PIGYYLEPG--STLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANE--SIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTF-HGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDY---DRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSL 2618
            CP K        D LLL +   ++K     N +     +     D    P   N    I  +TA  K     G YL PG  + +      +   W + IGC TD LN    E  R P +H    +       ++ +GG ++L      +   +++ +   VP P++      A + W   R  P  WA++  DN+++ V S  +R L      + +   W+ ++K    L +   K  R E  V D+  S G+ H+GYPI         + N+  ++  G WG  HE+GHN Q G W F   TTE T NL+ ++ + +V      G +  K + +    +R    + Y+ +  N + W  E + AL  Y Q+ + FG++ FK+VFA Y   +  P  +  KMN +    S+ VG +L   F  WG+PI +  E  + +L
Sbjct:  489 CPVKC-----PKDHLLLSVGAEVYK-----NCRDPDALLPYLIKDMPLLPVVYNQRINIDVKTAGEKEWLSTGLYLSPGMKTYISIPAQMVQKGWQIQIGCQTDQLNAE--ELKRPPRVHEQFAVTSEMMQVWNLWGGLIYLVAPPQADVHGVEVIVQMAVPAPYYKSGVTTA-EAWSLLRTAPSPWAELEFDNIILTVPSEAVRTLE---RPEELAQLWNKIMKAIADLAAKPEKFPRKERFVADVQISHGWMHAGYPIMGQKSAVNELVNVDHMKSCGLWGPIHELGHNQQRGCWEFPPNTTECTCNLWSVYVHEEV-----LGIDRAKAHPNMSLENRKSRARNYVTQGRNLNSW--EMWVALETYMQLQDKFGWDAFKKVFAAYLQMSQFPGDNPGKMNLYTETFSQTVGMDLTAFFKAWGWPIQASTEQKLSNL 904          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000011622.1 (SMESG000011622.1)

HSP 1 Score: 1811.58 bits (4691), Expect = 0.000e+0
Identity = 909/909 (100.00%), Postives = 909/909 (100.00%), Query Frame = 3
Query:   60 GQENILLHKPVKVSEDTEKSKXXXXXXXXXXXXXFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPXXXXXXXXXXXXXXAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIKTKVN 2786
            GQENILLHKPVKVSEDTEKSKNLNDGNNNENCFNFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPLLLLLVKKYNELLNAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIKTKVN
Sbjct:   17 GQENILLHKPVKVSEDTEKSKNLNDGNNNENCFNFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPLLLLLVKKYNELLNAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIKTKVN 925          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000011627.1 (SMESG000011627.1)

HSP 1 Score: 1498.8 bits (3879), Expect = 0.000e+0
Identity = 746/909 (82.07%), Postives = 799/909 (87.90%), Query Frame = 3
Query:   60 GQENILLHKPVKVSEDTEKSKXXXXXXXXXXXXXFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPXXXXXXXXXXXXXXAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIKTKVN 2786
            G+ENI+L KPV VSE   KSK LNDG+    CF F  K+VKWAVFDLEK +QVQK+ILWN KVK N  ISFYVGT F PCKFHKQI Q++LC N   ++ Q KIE+NCQ S  TGQ+ A+V+ S ++ D +   T+C++EAFG++IS+ +     EI S   PP+PPNYFEKIQ+IRLNV+SVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTY  FIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWL GQISINIDHTFWNEKSKEARESYLEFLNVF+VDFT  F N  K   VTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIR LL LLVKKY+ELLNAICPCKFDPA NSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDI+IENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRP++ VLDIMT  GYGHSGYPISVYDDWFEGIFNMSLIE+ GSWGMCHEIGHNMQ  +WTF GT EVTNNLFCLFNYNK+WK  Y    E   +++Y ++K +KKYLDENA FDIWTSEPFHALLIYAQMANHFGF FFKEVFAYYS NNL PKT+SDKM TWMNVTSRIVGQNLLPIFYFWGFPID EI   ++S  C FP D+Y  IS IR K+VE +YKSC   +KY+ D SE  LR + R NFI+ ++N
Sbjct:   21 GRENIILRKPVTVSEFQVKSKYLNDGDKKNYCFTFKSKSVKWAVFDLEKTFQVQKIILWNVKVKMNSLISFYVGTNFSPCKFHKQISQFQLC-NTALINSQEKIEINCQSSQETGQYFALVADSLQNEDSSIKLTLCEIEAFGRVISSERPSIHSEIFSIDLPPIPPNYFEKIQKIRLNVSSVIVPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYPTFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLKGQISINIDHTFWNEKSKEARESYLEFLNVFHVDFTSTFVNRKKSIRVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRSLLFLLVKKYSELLNAICPCKFDPAINSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIMIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPQLIVLDIMTYLGYGHSGYPISVYDDWFEGIFNMSLIERNGSWGMCHEIGHNMQNLRWTFKGTVEVTNNLFCLFNYNKIWKQAYNEYNESIFFQNYHKLKKVKKYLDENAKFDIWTSEPFHALLIYAQMANHFGFGFFKEVFAYYSANNLNPKTNSDKMKTWMNVTSRIVGQNLLPIFYFWGFPIDREIGNILESFPCFFPYDYYVNISTIRIKIVETRYKSCQKKAKYYKDISEGTLREEKRENFIQIRIN 928          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042174.1 (SMESG000042174.1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 373/909 (41.03%), Postives = 541/909 (59.52%), Query Frame = 3
Query:   66 ENILLHKPVKVSEDTEKSKXXXXXXXXXXXXXFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQST-FGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPXXXXXXXXXXXXXXAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKD----IKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFP-EDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIK 2774
            +NILL+K +  + D+       +  N + C  F+    K   FDL + Y + K+I+ N   ++    +FY+G EF  C F   I +Y  C  D  +   +  E+ C+     G+++ ++ G+    D      +C +E +G+  +     TRP + S    P+  +YF+    IR NV +  +P YS+A+ +LN NC+PII+  D++S  FGVAC    GK R+  F K+ + +   S      F +NL  W++        I S  +  + +F   +K G+++  DVW+   +DI    K + LNG +S+ ++ TFW   + +AR SYL+ LN+FNVDF   F +          +  +++DL+G+E+++ RM  NH+YLI K   +   +    +  + NSK+   L+ ++KKY +LL  ICPC    AT+ NDR L+   G + K+Q L  S FK PC DLFPGDFV  P K  V   +   T +T+NPIGYYLE GSTL Y V   +G W++S+GCHTD L D+ PEW RYP+I++  I I ++G  +S FGG LWL NN     I + ++N+V  PFFN+RD NA   W  +RN+PG+W+QIAGD++VIC ESR +++  G Y+ DLMRN WD +V+M++ L + NWK++RP+I VLD+M SAG+GHSGYPI +Y +WFE IFN S I   GSWGMCHEIGHNMQ+ +WTF GTTEVTNNL CLF + K +KLP YGS       D D I++    I  YL+  A F  W S+P+ ALLIY+QM+ + G+ FFK+VF +Y  N + P TDS KM T+MN++S I  QNL+ +F FWGFPID  +   +  L C FP +DF   +S IR   +  KY  C+  S ++ D+   +    +R NFI+
Sbjct:   25 KNILLNKKILAASDSRDHSTNINDGNVKTCVRFESNNKKMIAFDLGQTYMINKIIVRNGDYRATEETNFYIGNEFQACHFQSLINKYGKC--DPLVQNNSTNELTCKGPSNVGRYLVLIKGNPFDYDPIERLYLCDIEVYGEESTNVPVPTRPVVDSVSLVPITKDYFKIAPIIRKNVPTAPIPPYSSAVIYLNRNCEPIIY--DMKSLPFGVACES--GKGRMVAFAKSAYLRNMNSDATQHQFRTNLLSWLTFGNPSPPTIISSQVKKMSDFYTLIKPGTVVYFDVWSSHPDDILNTWKALLLNGTVSMVVEITFWVSNTVKARNSYLQILNIFNVDFRNSFTSSSSVVNTEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVIVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISDKGHIYSGFGGVLWLYNNALGSKITIELSNVVVAPFFNLRDSNAASKWNDRRNSPGIWSQIAGDSIVICEESRRLKDFDGQYMVDLMRNIWDTVVRMEMVLTATNWKTERPQIVVLDVMISAGFGHSGYPIELYQEWFESIFNSSAIRATGSWGMCHEIGHNMQKPKWTFQGTTEVTNNLLCLFVFEKFFKLPRYGS-------DIDHIRNDKSKITAYLEGGAEFSKWRSDPWLALLIYSQMSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSLSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQ 920          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042174.1 (SMESG000042174.1)

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 373/909 (41.03%), Postives = 541/909 (59.52%), Query Frame = 3
Query:   66 ENILLHKPVKVSEDTEKSKXXXXXXXXXXXXXFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQST-FGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPXXXXXXXXXXXXXXAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKD----IKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFP-EDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIK 2774
            +NILL+K +  + D+       +  N + C  F+    K   FDL + Y + K+I+ N   ++    +FY+G EF  C F   I +Y  C  D  +   +  E+ C+     G+++ ++ G+    D      +C +E +G+  +     TRP + S    P+  +YF+    IR NV +  +P YS+A+ +LN NC+PII+  D++S  FGVAC    GK R+  F K+ + +   S      F +NL  W++        I S  +  + +F   +K G+++  DVW+   +DI    K + LNG +S+ ++ TFW   + +AR SYL+ LN+FNVDF   F +          +  +++DL+G+E+++ RM  NH+YLI K   +   +    +  + NSK+   L+ ++KKY +LL  ICPC    AT+ NDR L+   G + K+Q L  S FK PC DLFPGDFV  P K  V   +   T +T+NPIGYYLE GSTL Y V   +G W++S+GCHTD L D+ PEW RYP+I++  I I ++G  +S FGG LWL NN     I + ++N+V  PFFN+RD NA   W  +RN+PG+W+QIAGD++VIC ESR +++  G Y+ DLMRN WD +V+M++ L + NWK++RP+I VLD+M SAG+GHSGYPI +Y +WFE IFN S I   GSWGMCHEIGHNMQ+ +WTF GTTEVTNNL CLF + K +KLP YGS       D D I++    I  YL+  A F  W S+P+ ALLIY+QM+ + G+ FFK+VF +Y  N + P TDS KM T+MN++S I  QNL+ +F FWGFPID  +   +  L C FP +DF   +S IR   +  KY  C+  S ++ D+   +    +R NFI+
Sbjct:   22 KNILLNKKILAASDSRDHSTNINDGNVKTCVRFESNNKKMIAFDLGQTYMINKIIVRNGDYRATEETNFYIGNEFQACHFQSLINKYGKC--DPLVQNNSTNELTCKGPSNVGRYLVLIKGNPFDYDPIERLYLCDIEVYGEESTNVPVPTRPVVDSVSLVPITKDYFKIAPIIRKNVPTAPIPPYSSAVIYLNRNCEPIIY--DMKSLPFGVACES--GKGRMVAFAKSAYLRNMNSDATQHQFRTNLLSWLTFGNPSPPTIISSQVKKMSDFYTLIKPGTVVYFDVWSSHPDDILNTWKALLLNGTVSMVVEITFWVSNTVKARNSYLQILNIFNVDFRNSFTSSSSVVNTEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVIVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISDKGHIYSGFGGVLWLYNNALGSKITIELSNVVVAPFFNLRDSNAASKWNDRRNSPGIWSQIAGDSIVICEESRRLKDFDGQYMVDLMRNIWDTVVRMEMVLTATNWKTERPQIVVLDVMISAGFGHSGYPIELYQEWFESIFNSSAIRATGSWGMCHEIGHNMQKPKWTFQGTTEVTNNLLCLFVFEKFFKLPRYGS-------DIDHIRNDKSKITAYLEGGAEFSKWRSDPWLALLIYSQMSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSLSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQ 917          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042170.1 (SMESG000042170.1)

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 370/909 (40.70%), Postives = 539/909 (59.30%), Query Frame = 3
Query:   66 ENILLHKPVKVSEDTEKSKXXXXXXXXXXXXXFDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHKQIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSFTICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVIVPSYSNAITFLNENCQPIIWTKDIQST-FGVACSKPDGKARLTVFGKNNFFKETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSIIDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFLNVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIKKGKDLIKTMKTIPNKFVSNSKIRPXXXXXXXXXXXXXXAICPCKFDPATNSNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQSETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWYRYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFFNVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLMRNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDWFEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYNKVWKLPYYGSEELKLYRDYDRIKD----IKKYLDENANFDIWTSEPFHALLIYAQMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPIFYFWGFPIDSEIEVSMKSLRCLFP-EDFYREISEIRTKVVEAKYKSCDFNSKYFSDFSEENLRFDIRTNFIK 2774
            +NILL+K +  + D+       +  N + C  F+    K   FDL ++Y + K+I+ N   ++    +FY+G EF  C+F   I +Y  C  D  +   +  E+ C+     G+++ ++ G+    D      +C +E +G+  +    +T P + S    P+  +YF+    IR NV    +P  S+A+ +LN NC+ II+  D++S  FGVAC    GK R+  F K+ + +   S    + F +NL  W++        I S  +  + +F   +K G+++  DVW    +DI    K + LNG +S+ ++ TFW   + EAR SYL+ LN+FNVDF   + +W         +  + DD +G+E+++ RM  NH+YLI K   +   +    +  ++NSK+   L+ ++KKY +LL  ICPC    AT+ NDR L+   G + K+QAL  S FK PC DLFPGDFV  P K  V   +   T +T+NPIGYYLE GSTL Y V   +G W++S+GCHTD L D+ PEW RYP+I++  I I ++G  +S FGG LWL NN     I + ++N+V  PFFN+RD NA   W  +RN+PG+W+QIAGD++VIC ESR +++  G Y+ DLMRN WD +V+M++ L + NWK++RP+I VLD+M SAG GHSGYPI +Y +WFE +FN S I   G+WGMCHEIGHNMQ+ +WTF GTTEVTNNL CLF + K +KLP YGS       D D I++    I  YL+  A F  W+S P+ ALLIY+QM+ + G+ FFK+VF +Y  N + P TDS KM T+MN++S I  QNL+ +F FWGFPID  +   +  L C FP +DF    S IR   +  KY  C+  S ++ D+   +    +R NFI+
Sbjct:   25 KNILLNKKILAASDSRDHSTNINDGNVKTCVRFESNNKKMIAFDLGQIYMINKIIVRNGDYRATEEANFYIGNEFQACQFQSLINKYGKC--DPLVQNNSTNELTCKGPSNVGRYLVLIKGNPFDYDPIERLYLCDIEVYGEESTNVPVQTIPVVDSVSLVPITKDYFKIAPIIRKNVPIAQIPPKSSAVIYLNRNCETIIY--DMKSLPFGVACES--GKGRMVAFAKSAYLRNMNSGATQDQFRTNLLSWLTFGNPNPPTIISNQVKKISDFYTLIKPGTVVYFDVWRAHPDDILNAWKALLLNGTVSMVVEITFWEWNTVEARNSYLQILNIFNVDFLNSYTSWSSVVNTEMPDSMFIDDFIGLEDLVHRMLLNHDYLISKAPLVGSLLAIFSSSMLNNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQALAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISDKGHIYSGFGGVLWLYNNALGSKITIELSNVVVAPFFNLRDSNAASKWNDRRNSPGIWSQIAGDSIVICEESRRLKDFDGQYMVDLMRNIWDTVVRMEMVLTATNWKTERPQIVVLDVMISAGSGHSGYPIELYQEWFESVFNSSAIRATGNWGMCHEIGHNMQKPKWTFQGTTEVTNNLLCLFVFEKFFKLPRYGS-------DIDHIRNDKSKITAYLEGGAEFSKWSSNPWLALLIYSQMSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQ 920          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCAF22.135e-4230.71TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF22.135e-4230.71TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF2C4.457e-4230.17TRPM8 channel associated factor 2C [Source:HGNC Sy... [more]
TCAF25.069e-4230.81TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF11.924e-3930.32TRPM8 channel associated factor 1 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1621932.424e-4027.82zgc:162193 [Source:NCBI gene;Acc:323315][more]
zgc:1621932.424e-4027.82zgc:162193 [Source:NCBI gene;Acc:323315][more]
zgc:1621932.424e-4027.82zgc:162193 [Source:NCBI gene;Acc:323315][more]
si:ch211-210b2.21.026e-3829.90si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-... [more]
si:ch211-210b2.49.592e-3828.87si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045101.15.721e-3930.35TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000002244.11.030e-3427.49TRPM8 channel-associated factor homolog [Source:NC... [more]
ENSXETT00000045059.11.410e-3428.76TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
suox1.870e-3428.61sulfite oxidase [Source:Xenbase;Acc:XB-GENE-985202... [more]
ENSXETT00000045084.12.549e-3428.49TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcaf29.940e-4231.02TRPM8 channel-associated factor 2 [Source:MGI Symb... [more]
Tcaf12.860e-3830.35TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf12.860e-3830.35TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf12.860e-3830.35TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf34.009e-3829.95TRPM8 channel-associated factor 3 [Source:MGI Symb... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6NFQ2|TCAF2_HUMAN2.434e-4130.81TRPM8 channel-associated factor 2 OS=Homo sapiens ... [more]
sp|Q921K8|TCAF2_MOUSE6.953e-4131.02TRPM8 channel-associated factor 2 OS=Mus musculus ... [more]
sp|A4IG42|TCAF_DANRE4.478e-4028.05TRPM8 channel-associated factor homolog OS=Danio r... [more]
sp|A5PJN5|TCAF1_BOVIN5.440e-3930.61TRPM8 channel-associated factor 1 OS=Bos taurus OX... [more]
sp|Q9Y4C2|TCAF1_HUMAN9.540e-3930.32TRPM8 channel-associated factor 1 OS=Homo sapiens ... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMG40.000e+041.20Peptidase M60 domain-containing protein OS=Schmidt... [more]
A0A1S6KMG00.000e+039.85Peptidase M60 domain-containing protein OS=Schmidt... [more]
V4A0M81.273e-6532.71Peptidase M60 domain-containing protein OS=Lottia ... [more]
A0A1S3I0H41.806e-6230.53TRPM8 channel-associated factor 2-like OS=Lingula ... [more]
A0A1S3KG342.601e-6030.32TRPM8 channel-associated factor 2 OS=Lingula ungui... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-210b2.32.071e-3326.54si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
ENSAMXT00000051129.17.002e-2735.35pep primary_assembly:Astyanax_mexicanus-2.0:1:5658... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000976.11.514e-4129.23pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 ... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-210b2.38.946e-3727.33TRPM8 channel-associated factor homolog [Source:NC... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011622.10.000e+0100.00SMESG000011622.1[more]
SMESG000011627.10.000e+082.07SMESG000011627.1[more]
SMESG000042174.10.000e+041.03SMESG000042174.1[more]
SMESG000042174.10.000e+041.03SMESG000042174.1[more]
SMESG000042170.10.000e+040.70SMESG000042170.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030098 ID=SMED30030098|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2796bp
CACAGATTTAAATGATTTTTATTTTGTTTTTATTAATAAATTTCAATTTA
TTGTGCAATGGTCAAGAAAACATTTTATTGCATAAGCCAGTAAAGGTCAG
TGAAGATACAGAAAAGTCCAAAAATTTAAATGACGGTAATAATAATGAAA
ATTGTTTTAACTTTGATAGAAAAACTGTGAAGTGGGCTGTATTTGATCTT
GAGAAAGTGTATCAAGTGCAAAAATTGATTTTATGGAATACAAAAGTTAA
AAGTAACATTTCAATTTCATTTTATGTTGGAACGGAATTCATGCCCTGCA
AATTCCATAAGCAAATCCAGCAATATAAATTGTGCCGAAATGATGTAACT
TTGTCGAAGCAAGCAAAAATTGAAGTCAATTGTCAAATTTCCGGTGCAAC
TGGCCAATTTATTGCTATGGTGTCGGGATCATTTGAAAGCAATGATCAAA
CAAACAGTTTTACTATCTGTCAGGTTGAAGCCTTTGGGAAACTGATTTCG
ACAAATAAAGCTAAAACTCGACCAGAAATTTCTTCTACACCTTGGCCACC
ATTGCCACCTAACTATTTTGAAAAAATTCAAAGGATTCGATTGAATGTGA
CTTCAGTAATTGTTCCTTCATACAGTAATGCAATTACATTCCTTAATGAA
AATTGTCAACCAATTATTTGGACAAAAGATATCCAATCAACCTTTGGAGT
CGCTTGCTCAAAACCAGATGGAAAAGCACGTTTGACTGTATTTGGTAAAA
ATAACTTTTTCAAAGAAACTTTATCAAGTAAAGACAGCGAACTGTTCGCA
TCAAACCTCAAAAGATGGATGTCTCCAAATCTCACTTATTCAAACTTTAT
TGAAAGCAAAACACTCAATTCAGTAGAAGAATTTAGAAAACAAGTCAAAG
ATGGAAGTATTATAGATTTGGATGTTTGGAATCCAATGAAAGAAGATATC
AAGAAGGAAGTGAAAAAGATGTGGTTAAATGGACAGATTTCGATCAACAT
TGATCACACATTTTGGAATGAGAAATCAAAAGAAGCAAGGGAATCATATT
TAGAATTTTTAAATGTTTTTAATGTTGACTTTACACCAGAATTTGCAAAT
TGGGATAAGCCGACTCTCGTAACATTTACAGAAAAAGACTATAACGATGA
CCTCCTTGGTGTTGAAGAAGTTCTGAAACGGATGACATATAACCATGAAT
ATCTAATAAAAAAGGGCAAAGACCTAATTAAAACAATGAAAACCATACCG
AATAAATTTGTTAGTAACAGCAAGATTCGACCACTATTACTTCTTTTAGT
AAAGAAATATAACGAATTACTGAATGCAATTTGTCCATGCAAATTTGATC
CAGCTACCAATTCAAATGATCGTCTTCTTCTTGAAATATTTGGAATTCTT
TTCAAAAGTCAAGCACTTGTGAATTCTAAATTTAAGTTTCCTTGCATCGA
CCTATTCCCAGGAGATTTCGTGACCCCTCCTAAAAAGGAAAATGTAACCT
TTGTCATTCAGAGTGAAACTGCAAACACAAAAAATCCTATTGGATACTAT
CTAGAACCCGGAAGCACCCTTATGTACAAGGTAGATGAAATGAACGGTAG
GTGGTCAATGTCAATTGGCTGCCATACCGATACCCTAAACGATAACAGAC
CAGAATGGTACCGATATCCAAATATCCATGTAAATGATATCATAATTGAA
AATGAAGGTAGCGCTTTCTCACCATTCGGCGGAACACTTTGGCTTCAAAA
CAATAAAGCTAATGAAAGTATAAAGTTAACTATTACCAATATTGTTCCAA
CTCCATTTTTCAATGTCCGTGATAAAAATGCGGTAAAGGATTGGGAGAAA
CAGAGGAACAATCCAGGTTTATGGGCTCAAATCGCTGGAGATAACATGGT
GATTTGTGTGGAATCAAGGATGATTAGAAATCTTAGTGGAACATATTTGA
AAGATTTGATGAGAAATAATTGGGATTTATTAGTTAAAATGGATCTTTCT
TTAAAATCGGTGAACTGGAAAAGTCAAAGACCAGAGATTACCGTTCTTGA
TATAATGACAAGTGCTGGCTACGGACATTCAGGTTATCCTATTTCTGTTT
ATGATGATTGGTTTGAGGGAATTTTCAACATGAGTCTCATTGAAAAAAAG
GGCAGTTGGGGAATGTGCCATGAAATCGGCCATAACATGCAAGAAGGTCA
ATGGACATTCCACGGAACTACAGAAGTAACGAATAATTTATTTTGCTTGT
TTAATTACAATAAAGTTTGGAAATTGCCTTATTACGGATCCGAGGAATTG
AAACTATATCGGGATTATGACAGAATCAAAGATATAAAAAAGTATTTAGA
TGAAAATGCTAACTTTGATATTTGGACTTCTGAACCATTTCACGCTCTTC
TTATCTATGCTCAAATGGCGAATCATTTCGGTTTTGAATTCTTCAAGGAA
GTCTTTGCATATTATTCGGACAACAATCTAGAGCCCAAAACCGATTCGGA
TAAAATGAATACTTGGATGAATGTAACAAGTAGAATAGTCGGACAGAATT
TGCTGCCGATATTTTATTTCTGGGGCTTCCCCATTGACAGTGAAATCGAG
GTTTCAATGAAGAGCTTGCGTTGTCTTTTTCCGGAAGATTTTTACAGAGA
AATAAGTGAGATCCGTACAAAAGTTGTTGAAGCAAAATATAAATCCTGTG
ATTTCAATTCCAAATATTTTAGTGATTTTTCAGAAGAAAATCTTCGGTTT
GACATCAGAACAAATTTCATTAAAACAAAAGTGAATTAGCAAATTG
back to top

protein sequence of SMED30030098-orf-1

>SMED30030098-orf-1 ID=SMED30030098-orf-1|Name=SMED30030098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=926bp
MIFILFLLINFNLLCNGQENILLHKPVKVSEDTEKSKNLNDGNNNENCFN
FDRKTVKWAVFDLEKVYQVQKLILWNTKVKSNISISFYVGTEFMPCKFHK
QIQQYKLCRNDVTLSKQAKIEVNCQISGATGQFIAMVSGSFESNDQTNSF
TICQVEAFGKLISTNKAKTRPEISSTPWPPLPPNYFEKIQRIRLNVTSVI
VPSYSNAITFLNENCQPIIWTKDIQSTFGVACSKPDGKARLTVFGKNNFF
KETLSSKDSELFASNLKRWMSPNLTYSNFIESKTLNSVEEFRKQVKDGSI
IDLDVWNPMKEDIKKEVKKMWLNGQISINIDHTFWNEKSKEARESYLEFL
NVFNVDFTPEFANWDKPTLVTFTEKDYNDDLLGVEEVLKRMTYNHEYLIK
KGKDLIKTMKTIPNKFVSNSKIRPLLLLLVKKYNELLNAICPCKFDPATN
SNDRLLLEIFGILFKSQALVNSKFKFPCIDLFPGDFVTPPKKENVTFVIQ
SETANTKNPIGYYLEPGSTLMYKVDEMNGRWSMSIGCHTDTLNDNRPEWY
RYPNIHVNDIIIENEGSAFSPFGGTLWLQNNKANESIKLTITNIVPTPFF
NVRDKNAVKDWEKQRNNPGLWAQIAGDNMVICVESRMIRNLSGTYLKDLM
RNNWDLLVKMDLSLKSVNWKSQRPEITVLDIMTSAGYGHSGYPISVYDDW
FEGIFNMSLIEKKGSWGMCHEIGHNMQEGQWTFHGTTEVTNNLFCLFNYN
KVWKLPYYGSEELKLYRDYDRIKDIKKYLDENANFDIWTSEPFHALLIYA
QMANHFGFEFFKEVFAYYSDNNLEPKTDSDKMNTWMNVTSRIVGQNLLPI
FYFWGFPIDSEIEVSMKSLRCLFPEDFYREISEIRTKVVEAKYKSCDFNS
KYFSDFSEENLRFDIRTNFIKTKVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035423M60-like_N
IPR042279Pep_M60_3
IPR031161Peptidase_M60_dom
IPR008979Galactose-bd-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031161Peptidase family M60 domainSMARTSM01276M60_like_2coord: 504..807
e-value: 2.7E-45
score: 166.5
IPR031161Peptidase family M60 domainPFAMPF13402Peptidase_M60coord: 595..855
e-value: 4.8E-44
score: 150.9
IPR031161Peptidase family M60 domainPROSITEPS51723PEPTIDASE_M60coord: 505..807
score: 54.472
IPR035423M60-like domain, N-terminalPFAMPF17291M60-like_Ncoord: 491..586
e-value: 8.3E-6
score: 25.7
IPR042279Peptidase M60, enhancin-like domain 3GENE3DG3DSA:1.10.390.30coord: 727..910
e-value: 9.3E-24
score: 86.1
NoneNo IPR availableGENE3DG3DSA:1.10.1740.210coord: 600..726
e-value: 2.2E-5
score: 26.8
NoneNo IPR availablePANTHERPTHR15730:SF5SI:CH211-210B2.2-RELATEDcoord: 392..865
NoneNo IPR availablePANTHERPTHR15730EXPERIMENTAL AUTOIMMUNE PROSTATITIS ANTIGEN 2-RELATEDcoord: 392..865
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.843
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 17..162
e-value: 3.6E-12
score: 48.4