coiled-coil domain-containing protein 87 isoform X1

Overview
Namecoiled-coil domain-containing protein 87 isoform X1
Smed IDSMED30030095
Length (bp)2870
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein 87 isoform X1 (SMED30030095) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 87 isoform X1 (SMED30030095) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein 87 isoform X1 (SMED30030095) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 87 isoform X1 (SMED30030095) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030095

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030095h1SMcG0012295 SmedASXL_014921SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030095h1SMcG0012295 dd_Smed_v4_12480_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030095h1SMcG0012295 dd_Smed_v4_12480_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030095h1SMcG0012295 dd_Smed_v4_12480_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030095h1SMcG0012295 dd_Smed_v4_12480_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030095h1SMcG0012295 dd_Smed_v4_12480_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030095h1SMcG0012295 dd_Smed_v6_12480_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030095h1SMcG0012295 dd_Smed_v4_12480_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Human
Match: CCDC87 (coiled-coil domain containing 87 [Source:HGNC Symbol;Acc:HGNC:25579])

HSP 1 Score: 121.709 bits (304), Expect = 1.857e-27
Identity = 60/162 (37.04%), Postives = 105/162 (64.81%), Query Frame = 1
Query: 2317 DEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGA 2802
             E  K+ ++Q  LE++W+ L++P+  ++DM IKYS++  L+ + +++N W++A   +  RE+ L+ LE FE  AS+PNRFF K    SS   +EE+++R  L+ K++     + + + +++  F + + F+GRPY DKM  D+ EMLYWLQ++R+ R +  A
Sbjct:  672 GEPHKILSLQKHLEQLWSVLEVPDKDQVDMTIKYSSKARLRQLPSLVNAWERALKPIQLREALLARLEWFEGQASNPNRFFKKTNLSSS-HFLEENQVRSHLHRKLNLMESSLVSLLEEIELIFGEPVIFKGRPYLDKMKSDKVEMLYWLQQQRRVRHLVSA 832          

HSP 2 Score: 59.6918 bits (143), Expect = 2.324e-8
Identity = 48/174 (27.59%), Postives = 93/174 (53.45%), Query Frame = 1
Query:  925 FLKISTSNPSLDNINLRNEGLNRKIQNIKKKNDEKENLGKYNIRPP----IVEQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDL 1431
             L + T +P+  +   R E L + ++N++    E+E  G+++ +PP    +  QP T+  K  N  V   A +R ++R       +   G ++N L  E+ P+ ++++D + F G   +++YKE+M  VS D+L + + PL++    K +    ++S  L+ E K+ +IIN +L
Sbjct:  381 LLGVVTRHPAAGH---RLEELEKMLRNLQ----EEEASGQWDPQPPKSFPLHPQPVTITLKLRNEVVVQAAAVRVSDRNFLDSFHIEGAGALYNHLAGELDPKAIEKMDIDNFVGSTTREVYKELMSHVSSDHLHFDQGPLVEPAADKDW-STFLSSAFLRQE-KQPQIINPEL 545          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Zebrafish
Match: ccdc87 (coiled-coil domain containing 87 [Source:ZFIN;Acc:ZDB-GENE-041210-118])

HSP 1 Score: 165.236 bits (417), Expect = 1.170e-41
Identity = 106/326 (32.52%), Postives = 164/326 (50.31%), Query Frame = 1
Query: 1744 KFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHTPLFVKRRNDLRQSDISENPI--LSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGR 2715
            + E+ ++R  K  +D   + Y+ W   W+     +DYL Y+S Q SD+L V+FH YDSD + ++     L      ++L+  ER  ++   ++S    LR  K  FV G WN +TI +GGLGR P+L   +  E ++                                               E P   L D E  +L+     LE++WN L +P   RLDMAIKYS+  +   ++  +  W++AT L+ +RE  LS LE FEK ASDPNRFF  G+ GSS+AR+EE+  R++LN +IS    ++S  + Q+ + F D ++++ R
Sbjct:  471 RIERNVNR--KRPEDVTTRAYRAWFQWWRCQLSLDDYLDYISNQDSDYLPVLFHLYDSDDDGEEAERHKL------DQLQKAERRRKQQERIDS----LRRCKQEFVPGFWNINTIEMGGLGREPELDERKFEEDVE----------------------------------------------GEGPASGLLDTEQLQLR-----LERVWNALHLPEGQRLDMAIKYSSYEHRDHLQEAIAAWEQATCLIQKRELLLSRLEDFEKEASDPNRFFQPGFPGSSMARMEEATQREKLNSQISVVDEELSQIIGQITTRFHDNISYKVR 733          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Xenopus
Match: miga2 (mitoguardin 2 [Source:Xenbase;Acc:XB-GENE-996689])

HSP 1 Score: 191.045 bits (484), Expect = 1.768e-49
Identity = 129/426 (30.28%), Postives = 205/426 (48.12%), Query Frame = 1
Query: 1504 LENSSTSDLDLKQYVAMSLNEL-SHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPSFSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHTPLFVKRRNDLRQSDISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEER 2778
            +E+SS   LD    V   L E+   LIN     + +     +     VS   +    + + +R    R I  + D   P        S  P  +   + +    WL  WK +  ++DY+ YL  Q  D+L VIFH Y+SD+E+D          +++EK +    +++R       + ELR  K  +  G+WN +++++GGLG+ P     E + +                 SAY +  +A+  + H P                       E+ +L                      DMAIKYS       +   +NHW+K T+L+ +RE  L+ELE FE+TASDPNRFF KGY G+S+AR++ESK R++L+ ++S    KV   +H +K +++D+++F+GRPY +K+ WD+TEMLYWLQ+ R
Sbjct:  528 IESSSVKRLDQSLSVGSELEEVYGELINNISTDHLKFDQDLLTEPHAVSLDFSKCVSSATLTRRKKQRVINKQLDSLAPYNS-----SGQPLPLDKEVSRTSDSWLVWWKSSISSDDYMTYLHSQHPDYLKVIFHLYNSDSEDDG------QIALMKEKERQKREQDKR-------LAELRELKEKYTPGMWNINSVMLGGLGKEPVDEGMEHDIM----------------ESAYQKKINAIWNALHIP-----------------------EEQRL----------------------DMAIKYSFSEYRDILPQAINHWEKVTELIKKREKLLAELEMFERTASDPNRFFQKGYDGTSMARMKESKEREKLHTQLSNIERKVLEVLHLIKKSYNDKVSFKGRPYNEKLQWDKTEMLYWLQQGR 874          

HSP 2 Score: 58.9214 bits (141), Expect = 3.857e-8
Identity = 41/150 (27.33%), Postives = 76/150 (50.67%), Query Frame = 1
Query:  991 RKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQ---KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDL 1431
            RK++++ K  +E++   K   R      P          N  +   AD++ +ER   +   LS Y PV+N+ + E+    VK+LD +L  G E++++Y E++  +S D+L + +D L +     +     ++S TL +  K+ R+IN  L
Sbjct:  453 RKMEDLLKDLNERQKQVKEPRRTQACLHPQACSIDVSIPNRPILRRADVQASERVFINHTDLSPYPPVYNDFLSEIESSSVKRLDQSLSVGSELEEVYGELINNISTDHLKFDQDLLTEPHAVSLDFSKCVSSATL-TRRKKQRVINKQL 601          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Xenopus
Match: miga2 (mitoguardin 2 [Source:Xenbase;Acc:XB-GENE-996689])

HSP 1 Score: 164.081 bits (414), Expect = 5.958e-41
Identity = 74/147 (50.34%), Postives = 107/147 (72.79%), Query Frame = 1
Query: 2338 AIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEER 2778
            A Q ++  IWN L +P   RLDMAIKYS       +   +NHW+K T+L+ +RE  L+ELE FE+TASDPNRFF KGY G+S+AR++ESK R++L+ ++S    KV   +H +K +++D+++F+GRPY +K+ WD+TEMLYWLQ+ R
Sbjct:  657 AYQKKINAIWNALHIPEEQRLDMAIKYSFSEYRDILPQAINHWEKVTELIKKREKLLAELEMFERTASDPNRFFQKGYDGTSMARMKESKEREKLHTQLSNIERKVLEVLHLIKKSYNDKVSFKGRPYNEKLQWDKTEMLYWLQQGR 803          

HSP 2 Score: 58.5362 bits (140), Expect = 4.745e-8
Identity = 41/150 (27.33%), Postives = 76/150 (50.67%), Query Frame = 1
Query:  991 RKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQ---KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDL 1431
            RK++++ K  +E++   K   R      P          N  +   AD++ +ER   +   LS Y PV+N+ + E+    VK+LD +L  G E++++Y E++  +S D+L + +D L +     +     ++S TL +  K+ R+IN  L
Sbjct:  453 RKMEDLLKDLNERQKQVKEPRRTQACLHPQACSIDVSIPNRPILRRADVQASERVFINHTDLSPYPPVYNDFLSEIESSSVKRLDQSLSVGSELEEVYGELINNISTDHLKFDQDLLTEPHAVSLDFSKCVSSATL-TRRKKQRVINKQL 601          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Mouse
Match: Ccdc87 (coiled-coil domain containing 87 [Source:MGI Symbol;Acc:MGI:3026882])

HSP 1 Score: 113.62 bits (283), Expect = 4.079e-25
Identity = 59/155 (38.06%), Postives = 95/155 (61.29%), Query Frame = 1
Query: 2341 IQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLAR-IEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGA 2802
            +Q RL+++W  L++P   RLDM IKYS+   L+ +  ++  W++    + +RES L  LE FE+ ASDPNRFF K      + R +EE++ R  L  K++     + + + +++S F + +TF+GR Y  KM  D+ EMLYWLQ++R+ R +  A
Sbjct:  675 LQQRLKRLWVMLEVPEQNRLDMVIKYSSNARLQQLPALIKAWEQVLKPIQKRESLLGRLEWFEQQASDPNRFFQKP--DLLMNRLLEENRFRSYLQRKLNRMESNLVSLLERIESVFGEPVTFKGRSYLKKMKQDKVEMLYWLQQQRRIRNLTQA 827          

HSP 2 Score: 57.3806 bits (137), Expect = 9.016e-8
Identity = 33/115 (28.70%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  994 KIQNIKKKNDEKENLGKYNIRPPIV----EQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVE 1323
            K+Q + K   E+E  GK++++PP +     QP TV  K ++  +  VA ++ +ER  +    +   G ++N L  E+  + ++++D++   G    ++YKE+M  VS  +LS+ E
Sbjct:  398 KLQQMIKSLQEEEASGKWDLQPPRIIPLHPQPVTVALKVHDQVIVQVATVQLSERYFNDSFHVEGAGVLYNHLTGELDGKAIEEMDADRLVGNTTGEVYKELMSRVSVSHLSFEE 512          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. UniProt/SwissProt
Match: sp|Q9NVE4|CCD87_HUMAN (Coiled-coil domain-containing protein 87 OS=Homo sapiens OX=9606 GN=CCDC87 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 8.916e-27
Identity = 60/162 (37.04%), Postives = 105/162 (64.81%), Query Frame = 1
Query: 2317 DEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGA 2802
             E  K+ ++Q  LE++W+ L++P+  ++DM IKYS++  L+ + +++N W++A   +  RE+ L+ LE FE  AS+PNRFF K    SS   +EE+++R  L+ K++     + + + +++  F + + F+GRPY DKM  D+ EMLYWLQ++R+ R +  A
Sbjct:  672 GEPHKILSLQKHLEQLWSVLEVPDKDQVDMTIKYSSKARLRQLPSLVNAWERALKPIQLREALLARLEWFEGQASNPNRFFKKTNLSSS-HFLEENQVRSHLHRKLNLMESSLVSLLEEIELIFGEPVIFKGRPYLDKMKSDKVEMLYWLQQQRRVRHLVSA 832          

HSP 2 Score: 59.6918 bits (143), Expect = 1.116e-7
Identity = 48/174 (27.59%), Postives = 93/174 (53.45%), Query Frame = 1
Query:  925 FLKISTSNPSLDNINLRNEGLNRKIQNIKKKNDEKENLGKYNIRPP----IVEQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDL 1431
             L + T +P+  +   R E L + ++N++    E+E  G+++ +PP    +  QP T+  K  N  V   A +R ++R       +   G ++N L  E+ P+ ++++D + F G   +++YKE+M  VS D+L + + PL++    K +    ++S  L+ E K+ +IIN +L
Sbjct:  381 LLGVVTRHPAAGH---RLEELEKMLRNLQ----EEEASGQWDPQPPKSFPLHPQPVTITLKLRNEVVVQAAAVRVSDRNFLDSFHIEGAGALYNHLAGELDPKAIEKMDIDNFVGSTTREVYKELMSHVSSDHLHFDQGPLVEPAADKDW-STFLSSAFLRQE-KQPQIINPEL 545          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. UniProt/SwissProt
Match: sp|Q8CDL9|CCD87_MOUSE (Coiled-coil domain-containing protein 87 OS=Mus musculus OX=10090 GN=Ccdc87 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 2.853e-24
Identity = 59/155 (38.06%), Postives = 95/155 (61.29%), Query Frame = 1
Query: 2341 IQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLAR-IEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGA 2802
            +Q RL+++W  L++P   RLDM IKYS+   L+ +  ++  W++    + +RES L  LE FE+ ASDPNRFF K      + R +EE++ R  L  K++     + + + +++S F + +TF+GR Y  KM  D+ EMLYWLQ++R+ R +  A
Sbjct:  675 LQQRLKRLWVMLEVPEQNRLDMVIKYSSNARLQQLPALIKAWEQVLKPIQKRESLLGRLEWFEQQASDPNRFFQKP--DLLMNRLLEENRFRSYLQRKLNRMESNLVSLLERIESVFGEPVTFKGRSYLKKMKQDKVEMLYWLQQQRRIRNLTQA 827          

HSP 2 Score: 57.3806 bits (137), Expect = 6.307e-7
Identity = 33/115 (28.70%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  994 KIQNIKKKNDEKENLGKYNIRPPIV----EQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVE 1323
            K+Q + K   E+E  GK++++PP +     QP TV  K ++  +  VA ++ +ER  +    +   G ++N L  E+  + ++++D++   G    ++YKE+M  VS  +LS+ E
Sbjct:  398 KLQQMIKSLQEEEASGKWDLQPPRIIPLHPQPVTVALKVHDQVIVQVATVQLSERYFNDSFHVEGAGVLYNHLTGELDGKAIEEMDADRLVGNTTGEVYKELMSRVSVSHLSFEE 512          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. TrEMBL
Match: W4YZ43 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 7.378e-98
Identity = 262/847 (30.93%), Postives = 430/847 (50.77%), Query Frame = 1
Query:  373 DQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDI----------RHKLHIPTLRR----HIYRNISDNIHIDIPXXXXXXXXXXXXX-QFLLEIYDKKRR-LPENTPHKSIQEKSLLKEFNLNQG-----NSGIIKDQEPEKMSVDFNIKDIGVGQITLNSKKNHDDLLQLIANNDTNEKEKEFFLKISTSNPSLDNINLRNEGLNRKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSY-----VEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEW-EQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPSFSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPE-IIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKL-TNNERNELLKTKPALQDPSDR-FSKMSAYSRAQSAVSP--------SKHTPLFVKRRNDLRQSDISENPILSDDEDTKLK-AIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCV 2793
            ++N+EL+  + + I++ C+ LF+ Y  K     D+ +FS  +N+ R+K Q+S D           +    +P  R     H+Y +I + I +D P    +     +   ++ L+  D+++    E  P  +   +  L             +S  IK Q+ EK+S   + K     +    +    +DL  L+   D NE++++                 R   + R++++   + D KE      IR P   QP+TV  K  N      +D+R +ER S  +++L+ Y  V+NEL DEV    +K+LD+NLFRG+E+K++Y+E++KT+  D++++     VE    DY   K     ++AS TL +  K DR++N DL     SPW ++   R EW + P +   N++ +  +  Q   +  N L   +  G   +G++L   +NS      + A  A                   +  P+            +M DR  + Y  WL  WK T   EDY+KY+S Q +DFL  ++H YDSD E+D        PE I   KL   ER+ ER    E K+ EL+ +K+ ++ G WN  ++++GGLG+ P++  + + +E L T  ALQ  + R  S+  + + +++ ++P        S+H+ L   R      S  S        + TK K   QS+LE IWN+L+MP+++RLDMAIKYS++ ++  +E  +  W  A ++++QRE+ L+ LE FE+ ASDP+RFF KG+RGSS+AR+EE+K R  L   +S    KV   +  +   F D +T++GRPY +KM  D TEMLYWLQ+ER++R +
Sbjct:   23 EENKELQRRITVHIVTVCQQLFQHYVEKAKMLTDRNVFSGIANMSRLKAQVSLDANKLKLEESGHQRDFRLPRPRSLPEFHLYESIYEEIGLDPPPKSGRPRSSHRHRPKYNLQESDQEQEEKSEAQPTAATASRPTLSRPGAATSKPRPDSSSYIK-QDLEKLSTYRSAKT----ERKKEALPEEEDLPPLLQAVDHNERQEQ-----------------RRVAMKRQMRDTAAEADRKEQEETIKIREPTHPQPATVTTKMPNKSTVRTSDVRVSERVSQTQVTLNLYKTVFNELTDEVDGSTIKKLDANLFRGQEIKEVYEEILKTLPTDHMTFDMDGFVETAASDYSLHKA---PLLASTTL-NRGKADRVLNPDLVHNEQSPWGIE---RDEWCKSPIF---NATFARQNPAQPPQVKSNSL---LQGGTSFFGDTLGYGLNSTGGGGGAGANGAYGAGGGMGGGGAGGGGGGGFGRPM------------MMDDRNTRAYASWLQWWKSTISCEDYIKYVSSQETDFLGAVYHLYDSDTESDTGK----VPEKISSSKL---ERQKER----EEKLDELKIQKNEYIPGQWNVGSVMLGGLGKDPEVEIDLDDSESLSTD-ALQGLTRRTHSRAVSRNASRNTLTPRGGTTPRQSQHS-LLQSRVTYRTPSRASLTSRAETGQPTKQKQTTQSKLEHIWNSLQMPDNLRLDMAIKYSSDDHIPLLEDAIYAWQLAVNVIVQRENILTSLESFERFASDPDRFFQKGHRGSSVARLEEAKQRSALYAALSAVETKVKKKVKLIDKKFHDTVTYQGRPYLEKMKLDCTEMLYWLQQERRERAI 809          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. TrEMBL
Match: A0A1S3HV34 (coiled-coil domain-containing protein 87 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106158452 PE=4 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 2.791e-90
Identity = 207/639 (32.39%), Postives = 329/639 (51.49%), Query Frame = 1
Query:  985 LNRKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPS-----FSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERAS--IVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYS------------RAQSAVSPSKHTPLFVKRRND--LRQSDISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGATNYLTIS*LRL 2835
            L+R+++ +++K   ++      ++ P   QP+TV  K  N  V   +D+R +ER     I+L  + PV+N+L DE+    VK LD NLF GEE+K++Y+E+MKTV   +L   +D L+      V +  ++AS TL S+ K +RIIN +L+     PW                       +LD++++              G   +  ++ S  N           +A  P      F  +      +    Y  P++        +P  + +R+ + Y  WL  WK T  T+DY+KYLS Q SD++ VI H Y+SD E D+           +E  ++  +E + A+    E KI E+R +K+ F  G+WN +TI++GGLGR P+L   E+ +    +  ++ P    S +S  S            R +S +S    + L  + R    ++ S        S    + +   Q RLE++W+ LKMP++ +LDMAIKYS+E  +  +E  +  W+K+TDL+L RE ++++LE+FE+ ASDPNRFF KGYRGSS+AR+ E+K R  L +KI E    V  A+  ++  + D +T+ GRPY +K+ WDR EMLYWLQEER+ + +     Y     LR+
Sbjct:  444 LDRQLKQLEEKQQIEKEKDNVPLQEPTHPQPATVSSKLPNKMVVRTSDVRVSERVCMTSITLQKHNPVYNDLTDEIDQATVKNLDKNLFLGEEIKEVYREIMKTVPSTHLDVEQDELVVPSADSVNLSSVLASSTL-SKKKNERIINSELRSRQEPPW----------------------GELDVREWAKTQRPTTPPTDTKGNTYFDPTVPSKAN-----------LAGPPRPGAHLFEGLGMDLGGLGDDSYRAPVQD-------MPAAVMERMSRSYASWLQWWKSTINTDDYMKYLSTQESDYMGVICHFYNSDDEGDE-----------DETARLKSKEAKEAAKRAREEKIKEMRVQKTEFQPGMWNVNTIMLGGLGRDPELEEEEKEKEKPAEETVEKPKKSISLISKKSKEVSQDSLDQPPRDKSRLSDRGASRLATQSRGGETVKSSVTGMKTPASGVPPSTVGTPQDRLERVWSALKMPDNKKLDMAIKYSSEEYIGLLEESIEAWEKSTDLILLREGFIAKLEKFERLASDPNRFFEKGYRGSSVARLGEAKQRSYLYKKIEELDSLVKKAVLNVRDKYQDVITYAGRPYLEKLKWDRIEMLYWLQEERRQQALEQEQMYRDAVGLRM 1030          

HSP 2 Score: 92.4337 bits (228), Expect = 3.481e-15
Identity = 63/179 (35.20%), Postives = 104/179 (58.10%), Query Frame = 1
Query:   58 EIISNFEKIAGKLTLFTGDEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSI--LSEEDQXXXXXXXXXXXXXXWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNI 588
            EI   +E + G L++F    P   +   ET Q+ ERP+TP++ EI   P         ++RR++ AK  +  L+ E+Q SL G+L GE++ IW D+   VD P  TP+QN+EL+  + + I++ C+ LF+ +  K    N + +FS  +N+ R+K QL+ D    L+I T+RR+I  ++
Sbjct:   44 EIKDRYEGVMGPLSIF-APYPHEDEPPPETIQM-ERPVTPIDEEIKAPPSDFNVLRKYIRRRVA-AKPEVQHLTIEEQQSLAGVLVGEVNGIWRDIRRQVDDPFLTPEQNKELQRRITVHIVTVCEKLFKHFLEKAQILNKRGVFSGPANMSRLKAQLALDADKYLNILTIRRYIVGDL 219          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. TrEMBL
Match: A0A1S3HXV1 (coiled-coil domain-containing protein 87 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106158452 PE=4 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 3.428e-90
Identity = 207/639 (32.39%), Postives = 329/639 (51.49%), Query Frame = 1
Query:  985 LNRKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPS-----FSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERAS--IVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYS------------RAQSAVSPSKHTPLFVKRRND--LRQSDISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGATNYLTIS*LRL 2835
            L+R+++ +++K   ++      ++ P   QP+TV  K  N  V   +D+R +ER     I+L  + PV+N+L DE+    VK LD NLF GEE+K++Y+E+MKTV   +L   +D L+      V +  ++AS TL S+ K +RIIN +L+     PW                       +LD++++              G   +  ++ S  N           +A  P      F  +      +    Y  P++        +P  + +R+ + Y  WL  WK T  T+DY+KYLS Q SD++ VI H Y+SD E D+           +E  ++  +E + A+    E KI E+R +K+ F  G+WN +TI++GGLGR P+L   E+ +    +  ++ P    S +S  S            R +S +S    + L  + R    ++ S        S    + +   Q RLE++W+ LKMP++ +LDMAIKYS+E  +  +E  +  W+K+TDL+L RE ++++LE+FE+ ASDPNRFF KGYRGSS+AR+ E+K R  L +KI E    V  A+  ++  + D +T+ GRPY +K+ WDR EMLYWLQEER+ + +     Y     LR+
Sbjct:  449 LDRQLKQLEEKQQIEKEKDNVPLQEPTHPQPATVSSKLPNKMVVRTSDVRVSERVCMTSITLQKHNPVYNDLTDEIDQATVKNLDKNLFLGEEIKEVYREIMKTVPSTHLDVEQDELVVPSADSVNLSSVLASSTL-SKKKNERIINSELRSRQEPPW----------------------GELDVREWAKTQRPTTPPTDTKGNTYFDPTVPSKAN-----------LAGPPRPGAHLFEGLGMDLGGLGDDSYRAPVQD-------MPAAVMERMSRSYASWLQWWKSTINTDDYMKYLSTQESDYMGVICHFYNSDDEGDE-----------DETARLKSKEAKEAAKRAREEKIKEMRVQKTEFQPGMWNVNTIMLGGLGRDPELEEEEKEKEKPAEETVEKPKKSISLISKKSKEVSQDSLDQPPRDKSRLSDRGASRLATQSRGGETVKSSVTGMKTPASGVPPSTVGTPQDRLERVWSALKMPDNKKLDMAIKYSSEEYIGLLEESIEAWEKSTDLILLREGFIAKLEKFERLASDPNRFFEKGYRGSSVARLGEAKQRSYLYKKIEELDSLVKKAVLNVRDKYQDVITYAGRPYLEKLKWDRIEMLYWLQEERRQQALEQEQMYRDAVGLRM 1035          

HSP 2 Score: 92.4337 bits (228), Expect = 3.374e-15
Identity = 63/179 (35.20%), Postives = 104/179 (58.10%), Query Frame = 1
Query:   58 EIISNFEKIAGKLTLFTGDEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSI--LSEEDQXXXXXXXXXXXXXXWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNI 588
            EI   +E + G L++F    P   +   ET Q+ ERP+TP++ EI   P         ++RR++ AK  +  L+ E+Q SL G+L GE++ IW D+   VD P  TP+QN+EL+  + + I++ C+ LF+ +  K    N + +FS  +N+ R+K QL+ D    L+I T+RR+I  ++
Sbjct:   44 EIKDRYEGVMGPLSIF-APYPHEDEPPPETIQM-ERPVTPIDEEIKAPPSDFNVLRKYIRRRVA-AKPEVQHLTIEEQQSLAGVLVGEVNGIWRDIRRQVDDPFLTPEQNKELQRRITVHIVTVCEKLFKHFLEKAQILNKRGVFSGPANMSRLKAQLALDADKYLNILTIRRYIVGDL 219          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. TrEMBL
Match: A0A1S3HWH4 (coiled-coil domain-containing protein 87 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106158452 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 9.909e-88
Identity = 209/639 (32.71%), Postives = 332/639 (51.96%), Query Frame = 1
Query:  985 LNRKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQ-KFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPS-----FSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERAS--IVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYS------------RAQSAVSPSKHTPLFVKRRND--LRQSDISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGATNYLTIS*LRL 2835
            L+R+++ +++K   ++      ++ P   QP+TV  K  N  V   +D+R +ER     I+L  + PV+N+L DE+    VK LD NLF GEE+K++Y+E+MKTV   +L   +D L+      V +  ++AS TL S+ K +RIIN              S+LR+  E P          +LD++++        +     G   +  ++ S  N           +A  P      F  +      +    Y  P++        +P  + +R+ + Y  WL  WK T  T+DY+KYLS Q SD++ VI H Y+SD E D+           +E  ++  +E + A+    E KI E+R +K+ F  G+WN +TI++GGLGR P+L   E+ +    +  ++ P    S +S  S            R +S +S    + L  + R    ++ S        S    + +   Q RLE++W+ LKMP++ +LDMAIKYS+E  +  +E  +  W+K+TDL+L RE ++++LE+FE+ ASDPNRFF KGYRGSS+AR+ E+K R  L +KI E    V  A+  ++  + D +T+ GRPY +K+ WDR EMLYWLQEER+ + +     Y     LR+
Sbjct:  449 LDRQLKQLEEKQQIEKEKDNVPLQEPTHPQPATVSSKLPNKMVVRTSDVRVSERVCMTSITLQKHNPVYNDLTDEIDQATVKNLDKNLFLGEEIKEVYREIMKTVPSTHLDVEQDELVVPSADSVNLSSVLASSTL-SKKKNERIIN--------------SELRSRQEPP--------WGELDVREWAKTPTTPPTD--TKGNTYFDPTVPSKAN-----------LAGPPRPGAHLFEGLGMDLGGLGDDSYRAPVQD-------MPAAVMERMSRSYASWLQWWKSTINTDDYMKYLSTQESDYMGVICHFYNSDDEGDE-----------DETARLKSKEAKEAAKRAREEKIKEMRVQKTEFQPGMWNVNTIMLGGLGRDPELEEEEKEKEKPAEETVEKPKKSISLISKKSKEVSQDSLDQPPRDKSRLSDRGASRLATQSRGGETVKSSVTGMKTPASGVPPSTVGTPQDRLERVWSALKMPDNKKLDMAIKYSSEEYIGLLEESIEAWEKSTDLILLREGFIAKLEKFERLASDPNRFFEKGYRGSSVARLGEAKQRSYLYKKIEELDSLVKKAVLNVRDKYQDVITYAGRPYLEKLKWDRIEMLYWLQEERRQQALEQEQMYRDAVGLRM 1033          

HSP 2 Score: 92.4337 bits (228), Expect = 3.229e-15
Identity = 63/179 (35.20%), Postives = 104/179 (58.10%), Query Frame = 1
Query:   58 EIISNFEKIAGKLTLFTGDEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSI--LSEEDQXXXXXXXXXXXXXXWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNI 588
            EI   +E + G L++F    P   +   ET Q+ ERP+TP++ EI   P         ++RR++ AK  +  L+ E+Q SL G+L GE++ IW D+   VD P  TP+QN+EL+  + + I++ C+ LF+ +  K    N + +FS  +N+ R+K QL+ D    L+I T+RR+I  ++
Sbjct:   44 EIKDRYEGVMGPLSIF-APYPHEDEPPPETIQM-ERPVTPIDEEIKAPPSDFNVLRKYIRRRVA-AKPEVQHLTIEEQQSLAGVLVGEVNGIWRDIRRQVDDPFLTPEQNKELQRRITVHIVTVCEKLFKHFLEKAQILNKRGVFSGPANMSRLKAQLALDADKYLNILTIRRYIVGDL 219          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. TrEMBL
Match: A0A1I8JG13 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 4.706e-85
Identity = 193/571 (33.80%), Postives = 299/571 (52.36%), Query Frame = 1
Query: 1117 VADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPSFSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHT--PLFVKRRND-------LRQS-------DISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERK 2781
            ++D RP ER+    + L++Y P+WN+L  ++  + VK+LDS LF+G+EV+++Y+E++KTV + +L +  D LI+ C  ++ +  ++AS +L     R+R+IN+ L+K    PW    +   +W +P            D K  V +S            G +   ++  V +  D     A  A   +  R  P     A R Y + +  F++ +  +PK +Q+R ++ Y+ WL+LW+     EDY +YL+ Q +D+L ++FH YDS+ + D+ +        IE + +  ER  +R +  + ++  L  EK+ F  G WN   I +GGLGR P+L        +    A    +      +  + AQ      K T  PL  K+R+        LRQ+         S+ P LS          Q RLE IW+ L+ P+ +RLDM IKYS    L  +E  L  W+     +L+RES L+ELE FE+ ASDP RF A+G+RGSS AR+EES  R+EL  ++S     V   +  L++   D  TF GRPY+DKM WD+ EMLYWLQEER+
Sbjct:  504 MSDARPPERRCLGRVPLAAYSPIWNDLAGDIDADTVKELDSGLFKGQEVREVYEEILKTVDQSHLDFTSDELIEPCVDELSLTGVLASSSLYRR-NRERVINERLRKLDKPPWAGTGREPRDWAKPGVFAPG------DKKGVVNLS------------GIHDNFVAKEVTAEADAVRQRA-AARQETAPR--PGSRAPAPR-YAMQMGDFQRNVLEMPKAVQERALRSYQSWLALWREELSPEDYKRYLATQETDYLGLVFHMYDSEDDEDEEA--------IERQRQEAER-RQRDAERQKRLDALLAEKNEFSPGFWNTRAIFMGGLGRDPELPEEAEAAEVAAAAAAAAAAAEAEAEADVAAAQQQQKGGKSTAPPLVFKKRHTSGTAPILLRQATAKSAQKSASKAPALSP---------QERLEAIWSALQFPDRLRLDMVIKYS---KLPDLEAALAQWELTVAAILRRESILAELEAFERAASDPARFRARGHRGSSQARLEESAKREELLARLSGADEAVKAPLEVLETRHGDVATFRGRPYSDKMRWDKIEMLYWLQEERR 1030          

HSP 2 Score: 101.679 bits (252), Expect = 4.714e-18
Identity = 63/183 (34.43%), Postives = 103/183 (56.28%), Query Frame = 1
Query:   58 EIISNFEKIAGKLTLFTGDEPKSKKQ--NTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISI-AKNSILSEEDQXXXXXXXXXXXXXXWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNISDN 597
            +I  + EK+ G LTL + DE    +         LLERP+TPL+ EI +AP  L+    L++RRI   + +  LS + Q  + GIL  E++  W D+   +DYP F   +N EL   + + I++ C +LF  Y+      + +++FSSE+N  R+K+QLS D R  L++  +RR+I  ++ + 
Sbjct:   20 QIDQHHEKVLGDLTLMSQDENDESESVSGVLATSLLERPVTPLQDEIQEAPTQLEVLQELIRRRIQPDSSHQTLSVDQQREMAGILISEVNACWRDIRQQIDYPFFNEVENHELNRRIAVHIVTVCIALFRRYSESADELSKRQVFSSEANHARMKIQLSMDARKFLNVLIIRRYICDDMKET 202          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Cavefish
Match: ENSAMXT00000016929.2 (coiled-coil domain containing 87 [Source:NCBI gene;Acc:103027477])

HSP 1 Score: 167.162 bits (422), Expect = 3.738e-42
Identity = 91/254 (35.83%), Postives = 135/254 (53.15%), Query Frame = 1
Query: 2020 ESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHTPLFVKRRNDLRQSDISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERK 2781
            + KI  L+ +K  +  G WN +T+L+GGL + P                                           P   K  ++       E P+   +E  +   I +RLE+IW  L +P   RLDMAIKYST  +   +E  ++ W++A  L+ QRE  LS LE FE+ ASDP+RFF  G+ GSS AR++E+K+R++L  +I+     +S  +  +  TF+D +T++GRPY +KM WDRTEMLYWLQ+ER+
Sbjct:  571 QEKIDALKRQKEAYQSGFWNANTVLMGGLWKEP------------------------------------------VPDEAKETDEGVLHVGPEVPVAKSEEGEQ---IHARLERIWMILCLPEMQRLDMAIKYSTRAHRGEMEEAISAWEQAAQLIQQREYLLSHLEMFERVASDPSRFFQTGHHGSSAARMKEAKLREKLECQIAAVDKVLSKTVRHISETFNDTVTYKGRPYKEKMRWDRTEMLYWLQQERR 779          

HSP 2 Score: 60.077 bits (144), Expect = 1.117e-8
Identity = 52/183 (28.42%), Postives = 87/183 (47.54%), Query Frame = 1
Query:   52 NNEIISNFEKIAGKLTLF----------TGDEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSILSEEDQXXXXXXXXXXXXXXWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDI-----RHKLHI 555
             NEI + F+ I G L+LF          TG   + ++++TE++            EI   P SL EF   L+ RI+    + +S EDQ +L  ++  E+SLIW DL  L   PL T ++N+EL    + +++  C+ L+  Y  +L     + +FS   N   +   ++ D+      H +H 
Sbjct:   30 TNEIQTYFQDILGSLSLFDNTANNDMTKTG---RVQEESTESSSF---------KEIISVPSSLTEFCQQLRNRIAQHSLNNISPEDQETLASVMMAELSLIWQDLRGLPPDPLLTSEENKELSSHTYTKVLCICEELYLHYFQQLKMLEGRTVFSHHVNRSCLAANMAVDLSSVLNAHSIHC 200          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Nematostella
Match: EDO46117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR76])

HSP 1 Score: 217.624 bits (553), Expect = 5.479e-61
Identity = 135/345 (39.13%), Postives = 206/345 (59.71%), Query Frame = 1
Query: 1798 KQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDF-SEEDLYPEIIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKT--KPALQD----PSDRFSKMSAYSRAQSAVSPSK--------HTPLFVKRRNDLRQSDISENPILSDDEDTKLKAI--QSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERK 2781
            K Y  WL+ W+ T  ++DYLKYLS Q +D+LSVIFH YDS+ ++D+   E +  P+ I+  L + ERE         K+ EL+ +K++F  G WN ++IL+GGLG+ P +   E +ELL     P L         R S +S  S+   ++S  K        H+   + ++  + +S+ S + +    E + + +I  Q RLE++W  L MP+  RLDMAIKYS E     +E  L  W+ A +++L+RES +++LE FE+ ASDPNRFF +G  G++L+RI ESK R+  ++++ +    V  A+  +K  F D +TF+GRPY DK+  DRTEMLYWL +ER+
Sbjct:  204 KSYNSWLAWWRSTVTSDDYLKYLSTQENDYLSVIFHLYDSEEDSDEEDGENENRPDTIQMAL-LKEREK--------KLTELKTQKTDFQPGFWNANSILLGGLGKDPII---EDDELLANIEGPFLSAGDTVTQGRSSSVSVTSKKSDSLSDKKSVRSRDSFHSDRQLNKKTAIARSNTSTS-VADKSEASSMPSISAQDRLERLWTLLCMPDAQRLDMAIKYSAEPYCNKLEEALASWEAAAEVVLERESVMTQLEDFERMASDPNRFFDRGAGGTALSRIRESKTRESFDKRLVDLDKDVRKAVAAVKKRFEDVVTFQGRPYQDKIQTDRTEMLYWLHQERR 535          

HSP 2 Score: 79.337 bits (194), Expect = 3.516e-15
Identity = 45/130 (34.62%), Postives = 74/130 (56.92%), Query Frame = 1
Query: 1072 QPSTV-QKFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWK 1458
            QPS V Q+  +  V   +D+R + R +   I+L  Y  V+N+L  E+ P  VK LD NLF GEE+K++Y E+++T S D+L +  D  ++    +  I    AS +L ++ + +RI+N  L +    PW+
Sbjct:   39 QPSVVSQRLPDKSVVRTSDVRVSNRVNKSSITLKRYPTVYNDLTGEIDPHTVKWLDRNLFIGEEIKEVYGEIIRTTSSDHLLFDGDAFVEKTASQADISMCTASSSL-NKGRGERIMNVCLHREVPPPWE 167          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Nematostella
Match: EDO46119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR79])

HSP 1 Score: 59.3066 bits (142), Expect = 2.941e-9
Identity = 56/195 (28.72%), Postives = 101/195 (51.79%), Query Frame = 1
Query:   58 EIISNFEKIAGKLTLFTG-DEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSI--LSEEDQXXXXXXXXXXXXXXW---------PDLENLVDYPLFTPDQNRELR--YT----LFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNI 588
            E  + F  +AG L+L+   D P+    N +    +ERP+TP+E  I   P +   F  L++ R+ + K+ +  +S  DQ  L+G+L  EI+ +W         P L   ++ P+FT   +   R  +T    L IEI+   + LF  + +K    N++ +FS+ +N+ R+K QL+ +    L+I ++RR +  ++
Sbjct:   37 EFHNKFTSLAGPLSLYEAEDNPEVGNVNPD----VERPLTPVEEAIKTPPSTFSAFAKLIRPRL-LPKDVVSGISISDQNELIGVLMNEINNVWGEMKGMAPDPFLVEFINGPMFTLRASEGYRGLFTFPRRLAIEIVIISQGLFVRFLDKAQKLNERAVFSTAANMSRLKTQLALEANKSLNILSIRRDLAMDM 226          
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Planmine SMEST
Match: SMESG000004454.1 (SMESG000004454.1)

HSP 1 Score: 1818.51 bits (4709), Expect = 0.000e+0
Identity = 925/930 (99.46%), Postives = 930/930 (100.00%), Query Frame = 1
Query:   34 MSLAEINNEIISNFEKIAGKLTLFTGDEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSILSEEDQXXXXXXXXXXXXXXWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNISDNIHIDIPXXXXXXXXXXXXXQFLLEIYDKKRRLPENTPHKSIQEKSLLKEFNLNQGNSGIIKDQEPEKMSVDFNIKDIGVGQITLNSKKNHDDLLQLIANNDTNEKEKEFFLKISTSNPSLDNINLRNEGLNRKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQKFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPSFSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHTPLFVKRRNDLRQSDISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETNLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGATNYLTIS 2823
            MSLAEINNEIISNFEKIAGKLTLFTGDEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSILSEEDQLSLLGILEGEISLIWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNISDNIHIDIPKCCEKSSIEKKEEQFLLEIYDKKRRLPENTPHKSIQEKSLLKEFNLNQGNSGIIKDQEPEK+SVDFNIKDIGVGQITLNSKKNH+DLLQLIANNDTNEKEKEFFLKISTSNPSLDNINLRNEGLNRKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQKFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPSFSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHTPLFVKR+NDLRQSDISENPILS+DEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTET+LKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGATNYLTIS
Sbjct:    1 MSLAEINNEIISNFEKIAGKLTLFTGDEPKSKKQNTETAQLLERPITPLEHEITDAPKSLQEFLFLLQRRISIAKNSILSEEDQLSLLGILEGEISLIWPDLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEIFSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNISDNIHIDIPKCCEKSSIEKKEEQFLLEIYDKKRRLPENTPHKSIQEKSLLKEFNLNQGNSGIIKDQEPEKLSVDFNIKDIGVGQITLNSKKNHNDLLQLIANNDTNEKEKEFFLKISTSNPSLDNINLRNEGLNRKIQNIKKKNDEKENLGKYNIRPPIVEQPSTVQKFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQLDSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASHTLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLDLKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPSFSRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKRTFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLKMTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNNERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHTPLFVKRKNDLRQSDISENPILSNDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETHLKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSSLARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKMIWDRTEMLYWLQEERKDRCVNGATNYLTIS 930          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC871.857e-2737.04coiled-coil domain containing 87 [Source:HGNC Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc871.170e-4132.52coiled-coil domain containing 87 [Source:ZFIN;Acc:... [more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
miga21.768e-4930.28mitoguardin 2 [Source:Xenbase;Acc:XB-GENE-996689][more]
miga25.958e-4150.34mitoguardin 2 [Source:Xenbase;Acc:XB-GENE-996689][more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc874.079e-2538.06coiled-coil domain containing 87 [Source:MGI Symbo... [more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9NVE4|CCD87_HUMAN8.916e-2737.04Coiled-coil domain-containing protein 87 OS=Homo s... [more]
sp|Q8CDL9|CCD87_MOUSE2.853e-2438.06Coiled-coil domain-containing protein 87 OS=Mus mu... [more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4YZ437.378e-9830.93Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A1S3HV342.791e-9032.39coiled-coil domain-containing protein 87 isoform X... [more]
A0A1S3HXV13.428e-9032.39coiled-coil domain-containing protein 87 isoform X... [more]
A0A1S3HWH49.909e-8832.71coiled-coil domain-containing protein 87 isoform X... [more]
A0A1I8JG134.706e-8533.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000016929.23.738e-4235.83coiled-coil domain containing 87 [Source:NCBI gene... [more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO461175.479e-6139.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461192.941e-928.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 87 isoform X1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000004454.10.000e+099.46SMESG000004454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030095 ID=SMED30030095|Name=coiled-coil domain-containing protein 87 isoform X1|organism=Schmidtea mediterranea sexual|type=transcript|length=2870bp
TAAAGTTTAGAAACCAACGCGTGTGAAATTCAAATGTCACTTGCTGAAAT
TAATAATGAAATAATAAGTAATTTCGAGAAAATTGCAGGCAAATTAACTT
TATTTACTGGAGATGAGCCTAAGTCCAAAAAACAAAATACTGAGACTGCT
CAATTACTAGAACGACCAATAACACCACTTGAACATGAGATAACAGACGC
TCCAAAATCATTGCAAGAGTTTCTGTTTCTATTACAAAGACGTATTTCCA
TTGCAAAGAACTCTATTTTGTCAGAGGAAGATCAATTGAGTCTACTTGGA
ATTTTGGAAGGAGAAATTAGTTTGATATGGCCAGATTTGGAAAACCTTGT
TGATTATCCATTATTTACTCCTGACCAAAATCGAGAATTACGATATACTC
TGTTTATTGAAATTATATCGAAATGCAAATCATTGTTTGAGGAATATAAC
AACAAATTATTATCTTATAATGACAAAGAAATATTCAGTAGTGAATCGAA
TTTGGTCCGAATAAAACTTCAACTGTCATCAGATATTCGGCATAAACTTC
ATATCCCAACTTTGAGGAGACATATTTATCGAAACATTTCTGATAATATT
CACATTGATATTCCAAAATGTTGTGAAAAATCATCGATAGAGAAGAAAGA
AGAACAATTTTTATTAGAAATATATGATAAAAAAAGAAGATTGCCTGAAA
ATACACCGCACAAATCTATACAAGAAAAATCACTTCTAAAAGAATTTAAT
CTCAATCAAGGAAATTCCGGTATTATAAAAGATCAAGAACCTGAAAAAAT
GTCTGTTGATTTTAATATAAAGGATATTGGCGTTGGTCAAATTACATTGA
ATTCCAAGAAAAATCATGATGATTTACTACAACTTATAGCGAATAATGAT
ACAAATGAAAAAGAAAAAGAATTTTTTCTGAAAATTTCAACAAGTAATCC
ATCCTTAGACAATATTAATCTGCGCAATGAGGGCTTGAATAGAAAAATAC
AAAATATAAAGAAAAAAAATGATGAAAAAGAAAATCTGGGAAAATATAAT
ATTCGTCCGCCCATTGTAGAGCAGCCGTCAACAGTCCAGAAGTTCTACAA
CAATAAAGTATTCTGTGTGGCTGATATACGGCCGACAGAAAGGAAGAGTG
ACCATGAAATTAGTTTGTCATCATATGGACCGGTATGGAATGAACTTGTT
GATGAGGTAACCCCGGAAGTCGTCAAACAATTGGATAGTAATCTGTTTCG
TGGAGAAGAAGTTAAGGATATTTATAAAGAAATGATGAAGACAGTTTCAC
GCGATTATTTGAGTTATGTTGAGGATCCACTCATAGATTATTGTCCCCAG
AAGGTTTTCATTCAAGATATTATGGCCTCTCATACACTGCAAAGTGAAGT
TAAAAGGGATAGAATTATAAATGACGATCTAAAAAAGTATCCAAATTCGC
CGTGGAAGCTGCAATCAAAATTACGAACTGAATGGGAACAACCAAATTAT
GTTTTGGAAAACTCTTCCACGTCAGACTTGGATTTGAAACAATATGTGGC
GATGAGTCTTAATGAACTCTCACATTTGATTAATTATGGACGGGGTTCAT
ATGGAGAATCATTATCGTCAACTGTTAATTCTAATAGAGATGTTTCTACT
TCTTTGGCATTTGTAGCTGAAACTCCAAGTTTTAGTCGTGTGACCCCCAT
CAGAAATATCATTGCAAAACGAGATTATTTTATTCCATTGGAAAAATTTG
AAAAAGGCATATCAAGGTTACCAAAACTAATGCAAGATCGACTTGTAAAG
CAATATAAAGAGTGGTTATCGTTATGGAAAAGAACTTTTGAAACAGAAGA
CTATTTAAAGTATTTAAGTTTACAACCTTCAGATTTTCTCTCCGTTATAT
TTCACCAATACGATTCTGATGCTGAAAATGATGATTTTTCAGAAGAGGAT
CTTTATCCAGAAATTATTGAAGAGAAGTTGAAAATGACTGAAAGAGAAAA
TGAAAGAGCAAGTATTGTTGAAAGCAAGATAGTTGAGCTTCGAAATGAAA
AATCTAATTTTGTAAAAGGTCTTTGGAATCCTTCAACAATTTTAATTGGG
GGTCTCGGTAGAACACCGAAATTAACGAATAATGAAAGGAATGAACTACT
AAAAACCAAACCAGCTTTGCAAGATCCAAGTGATAGATTTAGCAAAATGT
CGGCTTATAGCAGAGCTCAGTCAGCTGTTTCTCCCAGTAAACATACTCCA
TTGTTTGTTAAGAGGAGGAATGATCTACGCCAATCAGATATATCAGAAAA
CCCCATTTTAAGCGATGATGAAGACACAAAATTGAAAGCTATTCAAAGTC
GACTGGAGAAAATATGGAATAACCTGAAAATGCCAAATCATATAAGATTG
GACATGGCCATCAAGTACTCAACGGAAACCAATCTCAAATCAATAGAAAC
TGTGCTCAATCATTGGGATAAAGCTACGGATTTGTTGTTGCAGAGAGAAA
GCTATCTGTCAGAGTTGGAACGGTTTGAAAAAACGGCCTCTGATCCAAAT
CGGTTTTTCGCAAAGGGTTATCGAGGCTCGTCACTGGCAAGGATTGAAGA
ATCGAAAATACGACAAGAACTGAACGAAAAAATAAGTGAATATTCTATGA
AAGTCTCAAACGCTATGCATCAATTGAAATCAACTTTTTCTGATGAATTA
ACTTTTGAAGGACGGCCTTATGCAGACAAAATGATTTGGGATCGCACTGA
AATGTTATATTGGCTTCAAGAAGAAAGAAAAGACCGTTGTGTAAATGGAG
CAACTAATTATCTGACTATAAGTTGACTAAGATTGTTTATTTAAATAAAT
ATATATAAGAATCGTCTGAG
back to top

protein sequence of SMED30030095-orf-1

>SMED30030095-orf-1 ID=SMED30030095-orf-1|Name=SMED30030095-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=931bp
MSLAEINNEIISNFEKIAGKLTLFTGDEPKSKKQNTETAQLLERPITPLE
HEITDAPKSLQEFLFLLQRRISIAKNSILSEEDQLSLLGILEGEISLIWP
DLENLVDYPLFTPDQNRELRYTLFIEIISKCKSLFEEYNNKLLSYNDKEI
FSSESNLVRIKLQLSSDIRHKLHIPTLRRHIYRNISDNIHIDIPKCCEKS
SIEKKEEQFLLEIYDKKRRLPENTPHKSIQEKSLLKEFNLNQGNSGIIKD
QEPEKMSVDFNIKDIGVGQITLNSKKNHDDLLQLIANNDTNEKEKEFFLK
ISTSNPSLDNINLRNEGLNRKIQNIKKKNDEKENLGKYNIRPPIVEQPST
VQKFYNNKVFCVADIRPTERKSDHEISLSSYGPVWNELVDEVTPEVVKQL
DSNLFRGEEVKDIYKEMMKTVSRDYLSYVEDPLIDYCPQKVFIQDIMASH
TLQSEVKRDRIINDDLKKYPNSPWKLQSKLRTEWEQPNYVLENSSTSDLD
LKQYVAMSLNELSHLINYGRGSYGESLSSTVNSNRDVSTSLAFVAETPSF
SRVTPIRNIIAKRDYFIPLEKFEKGISRLPKLMQDRLVKQYKEWLSLWKR
TFETEDYLKYLSLQPSDFLSVIFHQYDSDAENDDFSEEDLYPEIIEEKLK
MTERENERASIVESKIVELRNEKSNFVKGLWNPSTILIGGLGRTPKLTNN
ERNELLKTKPALQDPSDRFSKMSAYSRAQSAVSPSKHTPLFVKRRNDLRQ
SDISENPILSDDEDTKLKAIQSRLEKIWNNLKMPNHIRLDMAIKYSTETN
LKSIETVLNHWDKATDLLLQRESYLSELERFEKTASDPNRFFAKGYRGSS
LARIEESKIRQELNEKISEYSMKVSNAMHQLKSTFSDELTFEGRPYADKM
IWDRTEMLYWLQEERKDRCVNGATNYLTIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR037383CCDC87
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 308..335
NoneNo IPR availableCOILSCoilCoilcoord: 860..880
NoneNo IPR availableCOILSCoilCoilcoord: 652..672
NoneNo IPR availableGENE3DG3DSA:1.20.58.1520coord: 803..923
e-value: 6.9E-6
score: 28.1
IPR037383Coiled-coil domain-containing protein 87PANTHERPTHR16078FAMILY NOT NAMEDcoord: 38..918