G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30030092
Length (bp)1487
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30030092) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30030092) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30030092) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30030092) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030092

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030092SMESG000016449.1 SmedASXL_010470SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30030092SMESG000016449.1 dd_Smed_v6_26348_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: dmsr-7 (DroMyoSuppressin Receptor related [Source:UniProtKB/TrEMBL;Acc:O16548])

HSP 1 Score: 116.316 bits (290), Expect = 5.372e-28
Identity = 115/405 (28.40%), Postives = 201/405 (49.63%), Query Frame = 3
Query:   63 SQSIFPNIGNSTKFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMK-SPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLI---WAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHV----------------WS----SIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIPLSHICVKRTRIVEHDELSQLYSVVKNRKMDDKYKYQQCASSTD--QNE 1199
            +Q+    + +  ++Y  +H ++ ++IC  G+ TN +    L++P M+ S  N +LT +A+ D   MA Y+++ + F+   +   +P     W Q+LL+ +V+   LH  S +L V++A  R + +R   L       K A    + I++   +L IP +  H++  V  +      T    +    + V+                 W+     I  K +P IL+  +S  L+ +++ +EK R+KL S  SN  +DS  KPL  K K+ T       +TT +L+ I+ +FL++ FPQ  + +L  IF       +Y  +GDV+DLL+L+N+ + FVLYC MS ++R TF+ +   IP     +  TR     ELSQL  +  + ++  K  Y   A+  +  +NE
Sbjct:   17 TQAFLRKLAHFQRWYQPIHGYVCVLICVFGIFTNFVHVAVLSRPNMRNSAVNCILTAVAVCDIGTMASYLIYIIHFVLRRNNSCTPTFTHSWLQFLLWHVVLSITLHTTSLWLAVAMAFIRRMTLRVTALNSQWQRPKFAWKLCLGIYMVVFVLCIPNMLVHEIARVEGNDWRPGKTCQKFASNYSEPVYTFMVSHAATINNCRLFKWNIWMIGILFKIIPCILLIFLSFGLVSKIRDAEKHRRKLTSVPSNASTDS--KPL--KKKNGTSD-----RTTLMLVVILLVFLITEFPQGIISILCAIFTTDVHRYLYFYIGDVLDLLSLVNSSVNFVLYCVMSSRYRQTFWEVI--IPSWACGLWTTRRGSPTELSQL-QLNNSLRLGRKQSYTPLATEPEPARNE 409          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: dmsr-1 (DroMyoSuppressin Receptor related [Source:UniProtKB/TrEMBL;Acc:Q8MQ19])

HSP 1 Score: 87.4261 bits (215), Expect = 2.504e-18
Identity = 92/352 (26.14%), Postives = 165/352 (46.88%), Query Frame = 3
Query:   99 KFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKF----LKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIR-YPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVT--PVNNST--------NNNAFTVDYVSVELGKFVHV-----W-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKL--KSDHS--------NIQSDSITKPLNCK---TKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFI 1052
             FY+ +H +L + +C LG I N    + L +  M++P N++LT +A  D +++   +++   +     K    +     WA +L+    +  + H  S +L V LA+ R + +R    +  +  T++ + Y V +      +L+ P    +K+   P+N +         N+ A+      +       V     W S +  K LP  L++     L+  L+   + RQ+L   S H         N Q  SI+   N K      +     R  +TT +LLAI+ + L++  PQ  + +L+G+  E F   +Y+ LGD++DL +L  +C  F++YCSMS QFR+ F  +F+
Sbjct:   28 NFYHPIHAYLSIFLCVLGTIANFCNIVVLTRRTMRTPVNMILTAMASCDTVVLFSNLIYTTHYSFVAFKFCHPKHWSYSWALFLIAHAHLSLVAHSSSVWLSVMLALVRYVTLRSRGNMGGMQVTLRHSYYAVAVTVSLVAVLNAPNFLNYKINEQPLNETCTDLDPMFWNSPAYLPGIADIAKANSCLVFRLSYWISGMVFKVLPCALLSLFVWLLLRILREVRENRQRLLKNSQHRPPNQTTTRNGQRLSISVAGNEKLGRNGSLRGRGERVDRTTHMLLAIVAVMLVTELPQGIMAVLSGMCSEEFRIYIYNNLGDILDLFSLCGSCCSFIIYCSMSGQFRNEFHRVFV 379          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: dmsr-1 (DroMyoSuppressin Receptor related [Source:UniProtKB/TrEMBL;Acc:Q8MQ19])

HSP 1 Score: 87.4261 bits (215), Expect = 4.125e-18
Identity = 94/355 (26.48%), Postives = 165/355 (46.48%), Query Frame = 3
Query:   99 KFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFD-------LKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIR-YPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVT--PVNNST--------NNNAFTVDYVSVELGKFVHV-----W-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKL--KSDHS--------NIQSDSITKPLNCK---TKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFI 1052
             FY+ +H +L + +C LG I N    + L +  M++P N++LT +A  D +++   +++         KF        S   WA +L+    +  + H  S +L V LA+ R + +R    +  +  T++ + Y V +      +L+ P    +K+   P+N +         N+ A+      +       V     W S +  K LP  L++     L+  L+   + RQ+L   S H         N Q  SI+   N K      +     R  +TT +LLAI+ + L++  PQ  + +L+G+  E F   +Y+ LGD++DL +L  +C  F++YCSMS QFR+ F  +F+
Sbjct:   28 NFYHPIHAYLSIFLCVLGTIANFCNIVVLTRRTMRTPVNMILTAMASCDTVVLFSNLIYTTHYSFVAFKFCHPKHWSYS---WALFLIAHAHLSLVAHSSSVWLSVMLALVRYVTLRSRGNMGGMQVTLRHSYYAVAVTVSLVAVLNAPNFLNYKINEQPLNETCTDLDPMFWNSPAYLPGIADIAKANSCLVFRLSYWISGMVFKVLPCALLSLFVWLLLRILREVRENRQRLLKNSQHRPPNQTTTRNGQRLSISVAGNEKLGRNGSLRGRGERVDRTTHMLLAIVAVMLVTELPQGIMAVLSGMCSEEFRIYIYNNLGDILDLFSLCGSCCSFIIYCSMSGQFRNEFHRVFV 379          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: dmsr-8 (DroMyoSuppressin Receptor related [Source:UniProtKB/TrEMBL;Acc:Q18475])

HSP 1 Score: 87.0409 bits (214), Expect = 4.574e-18
Identity = 97/345 (28.12%), Postives = 163/345 (47.25%), Query Frame = 3
Query:   84 IGNSTKFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSP----LIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYP-QLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKV--TPVN-------NSTNNNAFTVDYV--SVELGKF-VHVWSS-IFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKS--DHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIF-GECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFIS 1055
            + N    Y  +H ++ +I+C  G   N++T I L +P+M+S  N LL  +A+ D L+M   +VF   FL     +  P    + WA +L +      I H  S +L V LA  R+  IR    +A    T +      V  F+   +L++P +   ++  TP +       N T  +   V  V  S   G   +  W++ +  K +P +L+T   + L+  ++   KRR++L    +   +  D                      TT +L+A++ IFL +  PQ  L +   IF  E F   +Y  LGDVMD+L+LLN+ + F++YC+MS++FR  F  +F++
Sbjct:   20 VTNINTAYAHIHPYVSVILCLAGTAMNIVTVIVLTRPSMRSAVNSLLCAIALCDILVMTSVLVFVTHFLLFAGYRCDPTDYNIYWAYFLYYHSQATVIFHATSIWLTVLLAQIRVFSIRRATSVAGESVTNQMTCIIAVTTFIVVCLLNVPNMLTFEIIETPASLWLQCKANETAEDDMLVYLVAPSDHCGLLNIAFWTNGVLFKVVPCLLLTFSIVALVSIIRDVGKRRKQLAQVMNKKRMPRD---------------------HTTPMLVAVLSIFLFAELPQGVLHVFNAIFTKETFYDKIYIHLGDVMDVLSLLNSAVNFIIYCAMSRKFRAVFIQIFLT 343          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: dmsr-6 (DroMyoSuppressin Receptor related [Source:UniProtKB/TrEMBL;Acc:G5EGR5])

HSP 1 Score: 82.8037 bits (203), Expect = 6.834e-17
Identity = 90/336 (26.79%), Postives = 157/336 (46.73%), Query Frame = 3
Query:  105 YNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMK-SPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFV----------HVW-SSIFAKTLPIILMTGMSLWLIYELK-GSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIPLSHI 1073
            Y+++H  L  I+C LGL  N +    L +P M+ S  + +L  +AISD   M  Y+++  +F      +     WA +L    ++   LH ++ YL+V +A  RL  ++      +  T  RA  + + I +F  I+ +P + AH++         N     Y SV     +          ++W + IF K +P +L+   ++ LI  L+  +EKR+  +K + +  + D                      TT +LL ++ +FL +  PQ  + +L  +F   F   VY  L DV+DLL+L+N  + F++Y   S ++R T F L   +PL+ I
Sbjct:   30 YSNVHPFLSFILCVLGLAANAIHITVLTRPRMRHSSVHTVLVCIAISDMGTMTSYLMYISRFEFLSDKEGYSYFWALFLKCHAMLSIALHAITLYLVVLMAFIRLSAMKLTTSRWLDHT--RALTSAIFIALFVFIMCVPTLLAHQIDETTRGVTMNGMYYKY-SVGFSTLMMQNGCSLMKGNLWLTGIFLKAIPCLLLLTFTIALINRLRENNEKRKILIKEERAKKRGDF---------------------TTYMLLLMVTVFLFTELPQGIMAILNALFTTQFHQMVYLNLADVLDLLSLINCYVAFLVYSFTSSRYRQTLFSL---LPLTKI 338          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CG13229 (gene:FBgn0033579 transcript:FBtr0330602)

HSP 1 Score: 136.732 bits (343), Expect = 3.020e-35
Identity = 116/352 (32.95%), Postives = 189/352 (53.69%), Query Frame = 3
Query:   30 ENITRFIDHSCSQSIFPNIGNSTKFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAM-KSPTNLLLTFLAISDGLIMALYIVF-DLKFLKSGSLQKS-PLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNA-------FTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLN-CKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFI 1052
            +N+T  +D  C       I N  + YNS+H ++ L+IC  G I N+L  + L +  M K+P N +L +LA++D  +M  YI +   +++  G  +K     WA  LL  +    ILH +S  L V+LAV+R + IR+P     +  +  +R  +++ F+ + IL +P     +V    +    N+       F  D V      ++H   S+  K LP  ++  +S  L++ L  + +RR KL+ D++N    +I   LN  K+K       R  +TT +L+A++ +FL++ FPQ  L LL+G+  +CF ++ Y   G++MDLL L+NA + FVLY  MSKQFR TF  LF+
Sbjct:   48 KNMTPQVD-ECQGYCQGEIYNWLRAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPYTSYQYIYMGPGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFLLAHSREAILLPFILSPILCLPTYFVFQVRETYDVDKVNSEAMYHVYFDKDSVLYRFNFWIH---SVLIKLLPCGILIVISAVLMHVLCEASRRRLKLR-DYNNPAKYAIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCYPPFGELMDLLALINAAVGFVLYGLMSKQFRTTFRSLFM 394          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CG13229 (gene:FBgn0033579 transcript:FBtr0330603)

HSP 1 Score: 136.732 bits (343), Expect = 3.020e-35
Identity = 116/352 (32.95%), Postives = 189/352 (53.69%), Query Frame = 3
Query:   30 ENITRFIDHSCSQSIFPNIGNSTKFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAM-KSPTNLLLTFLAISDGLIMALYIVF-DLKFLKSGSLQKS-PLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNA-------FTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLN-CKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFI 1052
            +N+T  +D  C       I N  + YNS+H ++ L+IC  G I N+L  + L +  M K+P N +L +LA++D  +M  YI +   +++  G  +K     WA  LL  +    ILH +S  L V+LAV+R + IR+P     +  +  +R  +++ F+ + IL +P     +V    +    N+       F  D V      ++H   S+  K LP  ++  +S  L++ L  + +RR KL+ D++N    +I   LN  K+K       R  +TT +L+A++ +FL++ FPQ  L LL+G+  +CF ++ Y   G++MDLL L+NA + FVLY  MSKQFR TF  LF+
Sbjct:   48 KNMTPQVD-ECQGYCQGEIYNWLRAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPYTSYQYIYMGPGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFLLAHSREAILLPFILSPILCLPTYFVFQVRETYDVDKVNSEAMYHVYFDKDSVLYRFNFWIH---SVLIKLLPCGILIVISAVLMHVLCEASRRRLKLR-DYNNPAKYAIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCYPPFGELMDLLALINAAVGFVLYGLMSKQFRTTFRSLFM 394          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CG13229 (gene:FBgn0033579 transcript:FBtr0088206)

HSP 1 Score: 136.732 bits (343), Expect = 3.020e-35
Identity = 116/352 (32.95%), Postives = 189/352 (53.69%), Query Frame = 3
Query:   30 ENITRFIDHSCSQSIFPNIGNSTKFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAM-KSPTNLLLTFLAISDGLIMALYIVF-DLKFLKSGSLQKS-PLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNA-------FTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLN-CKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFI 1052
            +N+T  +D  C       I N  + YNS+H ++ L+IC  G I N+L  + L +  M K+P N +L +LA++D  +M  YI +   +++  G  +K     WA  LL  +    ILH +S  L V+LAV+R + IR+P     +  +  +R  +++ F+ + IL +P     +V    +    N+       F  D V      ++H   S+  K LP  ++  +S  L++ L  + +RR KL+ D++N    +I   LN  K+K       R  +TT +L+A++ +FL++ FPQ  L LL+G+  +CF ++ Y   G++MDLL L+NA + FVLY  MSKQFR TF  LF+
Sbjct:   48 KNMTPQVD-ECQGYCQGEIYNWLRAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPYTSYQYIYMGPGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFLLAHSREAILLPFILSPILCLPTYFVFQVRETYDVDKVNSEAMYHVYFDKDSVLYRFNFWIH---SVLIKLLPCGILIVISAVLMHVLCEASRRRLKLR-DYNNPAKYAIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCYPPFGELMDLLALINAAVGFVLYGLMSKQFRTTFRSLFM 394          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR1 (gene:FBgn0035331 transcript:FBtr0072887)

HSP 1 Score: 92.0485 bits (227), Expect = 1.377e-19
Identity = 60/148 (40.54%), Postives = 90/148 (60.81%), Query Frame = 3
Query:  630 SIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITK-PLNCKT-------KHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLF 1049
            S+  K +P I +T +S+ LI  L  +++RR+KL S  +   + + TK P N K            E   +T +TTR+LLA++ +FL++ FPQ  + LL  + G+ F    Y +L D+MD+L L+N+ I F+LYCSMSKQFR TF +LF
Sbjct:  277 SVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKTLEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLMDILALINSSINFILYCSMSKQFRTTFTLLF 424          

HSP 2 Score: 67.0106 bits (162), Expect = 1.535e-11
Identity = 48/143 (33.57%), Postives = 82/143 (57.34%), Query Frame = 3
Query:  105 YNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDL-KFLKSGSLQKSPLI---WAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIP 521
            Y ++H ++ L++C LG I N L  I L +  M+SPTN +LT LA++D  +M  YI + +  ++ + SL +   +   WA ++ F  +   +LH +S +L V+LAV+R I + YPQ   V C M+    T+   +V  +++  P
Sbjct:   24 YKNMHGYVSLVVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTIHDYILTDSLPREEKLSYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLVVSP 166          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR1 (gene:FBgn0035331 transcript:FBtr0330187)

HSP 1 Score: 92.0485 bits (227), Expect = 1.557e-19
Identity = 60/148 (40.54%), Postives = 90/148 (60.81%), Query Frame = 3
Query:  630 SIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITK-PLNCKT-------KHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLF 1049
            S+  K +P I +T +S+ LI  L  +++RR+KL S  +   + + TK P N K            E   +T +TTR+LLA++ +FL++ FPQ  + LL  + G+ F    Y +L D+MD+L L+N+ I F+LYCSMSKQFR TF +LF
Sbjct:  277 SVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKTLEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLMDILALINSSINFILYCSMSKQFRTTFTLLF 424          

HSP 2 Score: 67.3958 bits (163), Expect = 1.504e-11
Identity = 48/143 (33.57%), Postives = 82/143 (57.34%), Query Frame = 3
Query:  105 YNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDL-KFLKSGSLQKSPLI---WAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIP 521
            Y ++H ++ L++C LG I N L  I L +  M+SPTN +LT LA++D  +M  YI + +  ++ + SL +   +   WA ++ F  +   +LH +S +L V+LAV+R I + YPQ   V C M+    T+   +V  +++  P
Sbjct:   24 YKNMHGYVSLVVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTIHDYILTDSLPREEKLSYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLVVSP 166          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8SWR3|SPR_DROME (Sex peptide receptor OS=Drosophila melanogaster OX=7227 GN=SPR PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.661e-10
Identity = 74/335 (22.09%), Postives = 152/335 (45.37%), Query Frame = 3
Query:  195 AMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPL----IWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTV----------DYVSVEL-GKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQA---TLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIPLSHICVKRTRIVEHDELSQLYSVVKNRK 1145
            +M +PTN +L  +AI D ++  ++    L ++ +      PL    +   Y +F+ ++  + H +S +L ++LAV R IY+ +  +A   CTM R R     I + A +  +P        P+    N +   V          DY+ V+L     +++  +F   LP I++  +++ L   ++ +++RR+ L  ++   +   + +  NC              TT +L+ ++ +FLL+  P A    + +++ +  E     + +    + +   + +  I F +YC MS+QFR+TF  +F+            R++   + S  YS+V   +
Sbjct:  118 SMATPTNFVLMGMAICD-MLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLAYSIFNEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFLHQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKL-RETNC--------------TTLMLIVVVSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLG-----------RLMAKKDSSTKYSIVNGAR 425          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4E0RFR5 (Peptide G protein-coupled receptor OS=Fasciola hepatica OX=6192 GN=D915_003516 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.821e-60
Identity = 138/379 (36.41%), Postives = 223/379 (58.84%), Query Frame = 3
Query:  105 YNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKS-PLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNA-----------------------------FTVDYVSVELGKFVHVW-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKL---KSDHSNIQSDSITKPL--NCKTKHVTE---------------SSNRTI-KTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFIS-IPLSHICVK 1082
            Y  +H+++ L+ICP+G++ N+L  + L QP +++ TNLLL+ LA+SDGL+M +YI+FD  FL +  L     L++A+ LL ++++QN+ H+ S+++IV++A+FRL+YI+    A+VHC++ RA   + I+F+F+++L IP+I AH+V    +S  N                               + V++   E+ K +  W S+I  K LPI++++ +S  LI  ++ +EKR + L   K D  ++  +++  P   N  TK   +               SS R   +TT +LL II  ++++Y PQ+ LLLL    G CF+  VY++LGD MD LTL+N  I F+LYC MSKQFRDTF  LF S  PLS++ ++
Sbjct:   34 YQRVHVYICLVICPIGVLANILNVVVLCQPRLRNSTNLLLSMLAVSDGLVMVVYIIFDYFFLLTPRLAHGMTLVYAELLLINIILQNLFHIFSAWIIVAIAIFRLLYIKTGVRAVVHCSVARAWIAIAIVFLFSVLLIIPFIIAHQVAERKSSVTNQTVAGTLMINNQTVTEGSEFRVSTPIGTEPLYEVNFTDNEMLKVILFWTSAILIKALPILIISSVSAALIISIRQTEKRYRSLHVHKKDRRSVAFNAVPNPTTENGSTKSGRQNKRQQPKSSLPNAYFSSGRNANQTTYMLLTIIIFYIITYLPQSALLLLNHFLGPCFNEFVYERLGDFMDFLTLINNSINFILYCGMSKQFRDTFLSLFCSNFPLSNLPIQ 412          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183QM38 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 5.201e-54
Identity = 132/314 (42.04%), Postives = 192/314 (61.15%), Query Frame = 3
Query:   99 KFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHVW-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTF 1037
            + Y  +H ++ L +CP+ +++N+   I LNQ  M SPTN LLT LAISDGLIM  YI F   FL     + S   WA YLLF + +QN LHL SSY++V +AVFR++Y+++     + C+MKRA+  + I+ V + ILSIP I  H +   NN     ++ V YV  E+      W ++IF K LP++ +  +S  +I+ ++    R +K+K+  S I  D I +  N +      + NR    T+ LLAI+ IF+++  PQA LL L+G+ G+CF+  VY+ LGD MDLLT++N  I F+LYCSMS QFR TF
Sbjct:   35 RVYGDMHGYITLFLCPICVLSNICIVIVLNQRDMISPTNFLLTSLAISDGLIMIFYIPFTSYFLIGRHTRNSTYNWAVYLLFHISLQNFLHLTSSYIVVVIAVFRVLYVKFIVQCQILCSMKRAKLAITIVLVISSILSIPCIMNHHIVQNNNQDKVISYMVTYVDNEVMLNYLYWNTAIFLKLLPLLCLCVLSFLIIFTIRRQNSRMRKMKTK-SIICVDPIVETSNPQ----NPTKNR---MTKFLLAIVIIFMITLLPQAILLFLSGLVGDCFTDTVYNALGDFMDLLTIVNNGINFILYCSMSHQFRTTF 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: G4V9Z6 (Putative dro/myosuppressin receptor OS=Schistosoma mansoni OX=6183 GN=Smp_173010 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.857e-53
Identity = 131/314 (41.72%), Postives = 192/314 (61.15%), Query Frame = 3
Query:   99 KFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHVW-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTF 1037
            + Y  +H ++ L +CP+ +++N+   I LNQ  M SPTN LLT LAISDGL+M  YI F   FL     + S   WA YLLF + +QN LHL SSY++V +AVFR++Y+++     + C+MKRA+  + I+ V + ILSIP I  H +   NN     ++ V YV  E+      W ++IF K LP++ +  +S  +I+ ++    R +K+K+  S I  D I +  N +      + NR    T+ LLAI+ IF+++  PQA LL L+G+ G+CF+  VY+ LGD MDLLT++N  I F+LYCSMS QFR TF
Sbjct:   35 RVYGDMHGYITLFLCPICILSNICIVIVLNQRDMISPTNFLLTSLAISDGLLMIFYIPFTSYFLIGRHTRNSTYNWAVYLLFHISLQNFLHLTSSYIVVVIAVFRVLYVKFIVQCQILCSMKRAKLAITIVLVISSILSIPCIMNHHIVQNNNQDKVISYMVTYVDNEVMLNYLYWNTAIFLKLLPLLCLCVLSFLIIFTIRRQNSRMRKMKTK-SIICVDPIVETSNPQ----NPTKNR---MTKFLLAIVIIFMITLLPQAILLFLSGLVGDCFTDTVYNALGDFMDLLTIVNNGINFILYCSMSHQFRTTF 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3TVB4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11747 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 8.551e-52
Identity = 127/358 (35.47%), Postives = 210/358 (58.66%), Query Frame = 3
Query:   54 HSCSQSIFPNIGNSTKFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLV-VQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTP--VNNSTNNNAFTVDYVSVELGK-FVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITK--PLNCKTKHVT----------------ESSNRTI-KTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISI 1058
            ++CSQS FPN+      Y+ +HI L L IC  G+  N+   I L+QP M+S TNLL++ L+I +G +MA++  +   F     L++     A Y+L+ +V  Q++ H+ SS++IV L +FRL+++R    A+  C  +RA+  ++   V ++I++ P++ AH V    +N+   + ++ +D+V  E+ K  + + S +F K LPI+  T  +  LI  L  S+KR  +L+++ S  +   +     L+ K    T                +SS+R I +TT IL+A+  +++++Y PQA +LLL  I+G CF  NVY+KLGD MDL+TL+  C  FVLYC++S +FR+TF  LF S+
Sbjct:   10 YNCSQSEFPNLQEFAHGYDIVHIPLSLAICVFGVFGNIANVIVLSQPGMQSSTNLLMSALSIGEGSVMAVHAFYVCMFRIDPKLERGMSKPAAYVLYIIVYAQSLFHVFSSWMIVFLTLFRLVFMRAGVAALHICNYRRAKIIIITDVVMSLIVASPFLFAHHVDKDCINSEDRSPSYKLDFVPNEVLKTLLLISSGVFMKALPIVFSTLFTALLIRTLLQSQKRHNRLQNEKSETEQRFLANQAELSAKNTFTTLAEQSENKSPKRPFNHDSSSRNIHQTTNILIALTVLYIVTYLPQAIMLLLLNIYGACFEVNVYEKLGDFMDLMTLICNCGNFVLYCALSSKFRETFVQLFCSL 367          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5K4F023 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.667e-51
Identity = 141/383 (36.81%), Postives = 213/383 (55.61%), Query Frame = 3
Query:  105 YNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKS----GSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKV--------------------------------TPVNNSTNNNAFTVDYVSVELGKFVHVW-SSIFAKTLPIILMTGMSLWLIYELKGSEKRR---QKLKSDHSNIQ------------------------SDSITKPL---NCKTKHVTESSNRTI-KTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLF 1049
            Y  +H++L LI+CP+G+I N L  I L QP ++SPTNLLLTFLA+SDGL+M +YI+FD  +L +      + KS   +A  LL ++V+QN+ H  S+++IV++A+FRLIYI+    A ++C M +A   ++++ + +I+L+IP++ AH++                                T  N ST +  + VDY +    K +  W S+I  K LPII+MT +S  LI  ++ SEKR    ++ ++D  N Q                          SIT P     C +   T S  R+  +TT +LL II +++ +Y PQ+ LLLL    G CFS+ VY++LGD +D LTL+N  + F+LYC MS+QFR TF  LF
Sbjct:   47 YQPIHVYLCLILCPIGVIANTLNVIVLCQPRLRSPTNLLLTFLAVSDGLVMFIYIIFDYFYLMTPRLLNGMTKS---YANLLLINIVLQNLFHAFSAWIIVAVAIFRLIYIKTGVRAAIYCNMFKAWIVIILVIISSILLTIPFMIAHQIRIKSNHYHDNHYTTYNTTDNNTTTTTTNHLIYTTYNQSTTSILYEVDYTTNIHLKIILFWNSAILVKALPIIIMTTVSAALITSIRESEKRYRILRRYRNDCKNFQITIDTTRVDSFMHNNNNNNNNNGEDKSITVPRPKQKCNSHIETYSGGRSANQTTYMLLTIIMLYIFTYLPQSALLLLNNFQGGCFSATVYERLGDFLDFLTLINNGLNFILYCVMSRQFRYTFLQLF 426          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIA0])

HSP 1 Score: 49.6766 bits (117), Expect = 1.386e-6
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 3
Query:  231 LAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYI-RYPQLAIVHC-----TMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYEL-KGSEKRRQKLKSDHSNI---QSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFR 1028
            L+ISD L++ ++I FDL +L++       ++W +Y LF     N L  LS  +IVS      I + RY   A+VH      T +     +++I+V+++   +P+  +  + P  +  N+ A+  +Y +V+L   +  ++  F   +PI  +    L +   L K  E     L+ D + +   Q+  + + L+C T   T                     +   P  T++L+   +    S    D++ +   LL   N+C+  VLY  +S++FR
Sbjct:   62 LSISDLLVLIMFIPFDLAYLEND------MVW-KYGLFMCKFINTLSFLS--VIVSGTTLAAISVDRYR--AVVHPLSPPFTFRTVSLIILVIWVYSVSTLLPFAESLTILPRGSCQNDYAWWPNYTTVQLTFVLCAFTPGFV--IPITCIVVFYLLIARHLRKERENHDLLLRGDIARLRVRQNSKMIRILSCLTVAFT---------------------ICILPSYTIILMVMFYKGTSSLPYIDEVHEFTRLLMTANSCLNPVLYSVVSREFR 303          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000016449.1 (SMESG000016449.1)

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 396/398 (99.50%), Postives = 397/398 (99.75%), Query Frame = 3
Query:   24 MNENITRFIDHSCSQSIFPNIGNSTKFYNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIPLSHICVKRTRIVEHDELSQLYSVVKNRKMDDKYKYQQCASSTDQNEIISPTH 1217
            MNENITRFIDHSCSQSIFPNIGNSTKFYNSLHIHLVLIICPLGLITNLLTAITLNQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRILLAIIFIFLLSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIPLSHICVKRTRIVE DELSQLYSVVKNRKMD+KYKYQQCASSTDQNEIISPTH
Sbjct:    1 MNENITRFIDHSCSQSIFPNIGNSTKFYNSLHIHLVLIICPLGLITNLLTAITLNQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRILLAIIFIFLLSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIPLSHICVKRTRIVEQDELSQLYSVVKNRKMDEKYKYQQCASSTDQNEIISPTH 398          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000056731.1 (SMESG000056731.1)

HSP 1 Score: 285.419 bits (729), Expect = 2.127e-91
Identity = 167/338 (49.41%), Postives = 227/338 (67.16%), Query Frame = 3
Query:  105 YNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNST------NNNAFTVDYVSVELGKFVHVWSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKL---------------KSDHSNI--QSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLF 1049
            Y+++H+HLVL+ICPLGL+ N+L  I LNQ +MKSPTN LLT LA+SD  IMALYI+FDLKFLK+ +L      WA YLLF L +QN LH  SS+ +V+LAVFRLIYIRYP  A+VHCTM RA+ + + I   +I++S+PYI AH V PV  S       +N  F ++Y + ++ K +  W+SIF K+LPI  MT +++ LI  L+ S  RRQ L                +  SNI  +   ITK    K   V   + ++IKTTR+L+AI+ ++  SY PQA +LL +G+ G+CFS +VYDK+G++MDL+TLLNAC+ F+L+CSMS Q+R TF  LF
Sbjct:   23 YDAVHVHLVLLICPLGLVFNILNIIILNQKSMKSPTNFLLTLLALSDSTIMALYIIFDLKFLKTNNLDTMTWSWAHYLLFYLSMQNFLHSFSSWNLVALAVFRLIYIRYPHNAVVHCTMNRAKISGLTIVGVSILISVPYILAHNVMPVATSNLSIFNDSNKTFMINYTNPQMQKVIFFWTSIFVKSLPITWMTILTVILISALRQSVMRRQTLLNSMLVANSPQEVLISNARSNILQRRGGITKDTIGKVDPV--GAKKSIKTTRMLIAIVIMYCFSYLPQALMLLTSGVLGQCFSVHVYDKMGNLMDLITLLNACVNFILFCSMSSQYRQTFTELF 358          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000010008.1 (SMESG000010008.1)

HSP 1 Score: 225.328 bits (573), Expect = 5.812e-69
Identity = 151/344 (43.90%), Postives = 217/344 (63.08%), Query Frame = 3
Query:  105 YNSLHIHLVLIICPXXXXXXXXXXXXXXQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPV---NNSTN---------------NNAFTVDYVSVELGKFVHVW-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQS--DSI----TKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIP 1061
            Y ++H +L LIICPLG+I+N++  I LNQ  M+SPTN LLT LAI+DG +MALYI F L FLK   L  SP +WA Y++  +++QNILH++S  +IV+LA FR++YIR        C + RA  +V  I + A++L+IP   AHK+ P+    NST+                N + V+YV  +  + +  W S+IF K LP++L+T +S+ +I  +K   K+ +KLKS+  N +   D+I     +PL  + + V       I+TTR+LL I+ IF+L+Y PQA LL L GI G CF+  VYD+LGDV+D+LTL N+ I FVLYC MS+QFR+ F  +F  +P
Sbjct:   21 YKNIHENLCLIICPLGVISNIMNVIILNQKVMRSPTNFLLTVLAITDGFLMALYIPFALYFLKKNYLLGSPYLWALYMMVYVIIQNILHVISIGIIVALAAFRVLYIRCLVRCNELCNITRAYISVASIVLIAVLLTIPSAIAHKIRPMCMLPNSTDIQEIDPDSDLTCVNYVNYYRVNYVDNQKIRRLLFWVSAIFIKLLPVVLVTILSIIIIMAIKSRAKKMKKLKSNSKNTKGSRDNIEMKSNQPL-VEKRTVKTVDKDGIRTTRMLLVIVLIFMLTYLPQAILLSLGGILGRCFTDEVYDRLGDVLDMLTLTNSGINFVLYCLMSRQFREAFIKIFCHLP 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000028684.1 (SMESG000028684.1)

HSP 1 Score: 114.005 bits (284), Expect = 2.756e-27
Identity = 93/299 (31.10%), Postives = 154/299 (51.51%), Query Frame = 3
Query:  189 QPAM-KSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLI------WAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYV----SVELGKFVHVW-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLF 1049
            +P M  S TN LL  LAI+D L M +Y+   +KF  S +     L+      W  Y  F +      H ++ +L VSLA+FR I I  P      C++  A  T  +I +   +++IP +   K+    N+ +N      ++    S E+   ++ W  +   K +P +++T +++ LI  +K + +R+  L ++                TK   ++ +R  +TT +LLA++ +FLL+  PQ  L+LL+  F E F   VY+KLGD++D LTL+N    F+LY +MSKQFR+ F  +F
Sbjct:   61 RPTMITSATNWLLMCLAIADLLTMVVYLPILIKFYISSNFGPDLLLHTDSWNWVVYQKFMVSCTISFHSIAVWLTVSLAIFRFICIYMPIKGPPLCSIPNASKTTFVISILCFLVTIPNMVVTKIQSCQNAKDNRLMVFYFLKIDSSFEMISKMNFWLQATLFKLIPSVVLTALTVGLILSMKKATQRQSNLLNN----------------TKSQRKAKHREQRTTYMLLAVVLLFLLTEAPQGLLMLLS-YFKEGFYEKVYEKLGDLIDFLTLVNESTNFILYTTMSKQFRNVFSSIF 342          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000046994.1 (SMESG000046994.1)

HSP 1 Score: 100.908 bits (250), Expect = 3.909e-23
Identity = 93/299 (31.10%), Postives = 152/299 (50.84%), Query Frame = 3
Query:  189 QPAMKSPTNLLLTFLAISDGLIMALYI-------VFDLKFLKSGSLQKSPLIWAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRARYTVVIIFVFAIILSIPYITAHKVTPVNNST---NNNAFTVDYVSVELGKF-VHVW-SSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKPLNCKTKHVTESSNRTIKTTRXXXXXXXXXXXSYFPQATLLLLAGIFGECFSSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLF 1049
            QP M+SPTN +LT+LAI+D L M +Y+       +F+   L   S+  +  IWA Y L  +    I H  + +  V LAV R +++  P +      ++    ++ I+ V ++I +IP +  ++V      T    + AF   Y    + K  ++ W  SI  K +P  +++ +++ LI +++   KRR KL S     +SDS  K          +  NR    T +LL ++ +FL+   P A L+L +     C    +Y+ LGD++D LTL+N  I F+LY +MSKQFR  F + F
Sbjct:   51 QPTMRSPTNWVLTWLAIADLLTMVVYLPNVCHYYIFNNIILPLFSVTSNK-IWAYYRLTIISFVLISHAAAVWFTVVLAVIRYLHLSLPTIGPQIANIENTTISIAIVSVLSLIFTIPNMMINEVNRCVGFTFDKQSKAFHTFYEIKSINKLEINFWIQSIIFKIVPSFVLSVLTILLILKMQHIGKRRNKLIS-----RSDSQKK----------KKENRV---TLMLLMVVVLFLIVELPHAILMLSSNFSQTCLE--IYETLGDLIDFLTLVNESINFILYTTMSKQFRRVFIMTF 328          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dmsr-75.372e-2828.40DroMyoSuppressin Receptor related [Source:UniProt... [more]
dmsr-12.504e-1826.14DroMyoSuppressin Receptor related [Source:UniProt... [more]
dmsr-14.125e-1826.48DroMyoSuppressin Receptor related [Source:UniProt... [more]
dmsr-84.574e-1828.12DroMyoSuppressin Receptor related [Source:UniProt... [more]
dmsr-66.834e-1726.79DroMyoSuppressin Receptor related [Source:UniProt... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG132293.020e-3532.95gene:FBgn0033579 transcript:FBtr0330602[more]
CG132293.020e-3532.95gene:FBgn0033579 transcript:FBtr0330603[more]
CG132293.020e-3532.95gene:FBgn0033579 transcript:FBtr0088206[more]
MsR11.377e-1940.54gene:FBgn0035331 transcript:FBtr0072887[more]
MsR11.557e-1940.54gene:FBgn0035331 transcript:FBtr0330187[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8SWR3|SPR_DROME3.661e-1022.09Sex peptide receptor OS=Drosophila melanogaster OX... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RFR51.821e-6036.41Peptide G protein-coupled receptor OS=Fasciola hep... [more]
A0A183QM385.201e-5442.04G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
G4V9Z61.857e-5341.72Putative dro/myosuppressin receptor OS=Schistosoma... [more]
A0A0R3TVB48.551e-5235.47G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A5K4F0231.667e-5136.81Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO365561.386e-623.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016449.10.000e+099.50SMESG000016449.1[more]
SMESG000056731.12.127e-9149.41SMESG000056731.1[more]
SMESG000010008.15.812e-6943.90SMESG000010008.1[more]
SMESG000028684.12.756e-2731.10SMESG000028684.1[more]
SMESG000046994.13.909e-2331.10SMESG000046994.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030092 ID=SMED30030092|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1487bp
TTTATACTTTTTAATACTTATCTATGAATGAAAATATCACCAGATTTATT
GATCATTCGTGTTCTCAATCGATATTTCCCAATATTGGTAATTCCACGAA
GTTCTACAACTCCCTCCATATTCACTTGGTCTTGATAATATGTCCTCTAG
GACTGATTACGAATCTCCTCACAGCAATAACCCTGAATCAGCCGGCTATG
AAATCCCCAACGAATTTATTGCTCACATTTCTCGCCATCAGCGATGGTCT
AATAATGGCTCTTTATATTGTTTTCGACTTGAAATTCCTAAAATCTGGCT
CCCTCCAAAAGAGTCCTTTAATTTGGGCGCAATATTTACTGTTTTCTTTG
GTTGTTCAGAATATTTTACATCTCCTATCATCATATTTAATTGTTTCTTT
AGCGGTATTTCGTTTGATTTACATTCGATATCCCCAACTGGCCATAGTTC
ATTGCACAATGAAGAGAGCCCGGTATACAGTTGTCATTATTTTCGTATTT
GCGATAATTTTATCCATACCTTACATTACTGCTCACAAGGTGACCCCTGT
AAACAATTCTACAAATAATAATGCTTTCACTGTTGATTACGTCAGTGTTG
AATTGGGGAAATTTGTCCATGTCTGGAGCTCAATTTTCGCAAAAACTTTA
CCAATAATTCTTATGACTGGAATGAGTCTTTGGCTCATCTATGAATTGAA
AGGCTCAGAGAAGCGTCGACAGAAGTTGAAATCAGACCATTCGAACATTC
AAAGCGACAGTATTACGAAGCCGTTGAATTGTAAAACGAAACACGTTACC
GAATCCAGTAATCGAACGATTAAAACAACTCGTATTTTATTGGCAATTAT
TTTCATATTTCTGCTATCTTACTTTCCTCAGGCGACATTGCTGCTGTTGG
CCGGAATTTTCGGAGAATGCTTTTCATCAAATGTTTACGACAAGCTTGGC
GACGTAATGGATTTGCTGACGCTATTGAATGCGTGCATTTACTTCGTGTT
GTACTGTTCGATGAGTAAACAGTTTCGGGACACGTTTTTCGTACTGTTTA
TATCTATCCCATTGAGCCACATCTGTGTGAAGAGGACCAGAATTGTTGAA
CATGACGAGTTGAGCCAACTGTATTCCGTTGTGAAAAATCGGAAAATGGA
TGACAAATACAAATACCAGCAGTGCGCATCATCTACAGATCAGAACGAAA
TTATAAGTCCGACCCATTGACGGAGGCCGAGGACCCATACGGTTGCAAGC
ATCTCTTGCCAATAAATGAAGGAGATTTTTACGATGATATTTACGATAAT
TGTCTAGTTTAGTTGTGTTGTATAACTCCATGTTTAACACTATCATTTTT
ATTATTTTTGTGATTAAATATTTCCAAGATTCGAATGGCTTTTGTTCTAT
GTTTTCTTTCCCTTGCTGTCGCAGATGGGATTAGATAATATTTCTGGATT
TAGTTGGTAAAAATATTTTCAAATTTCCGTATTAAAT
back to top

protein sequence of SMED30030092-orf-1

>SMED30030092-orf-1 ID=SMED30030092-orf-1|Name=SMED30030092-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MNENITRFIDHSCSQSIFPNIGNSTKFYNSLHIHLVLIICPLGLITNLLT
AITLNQPAMKSPTNLLLTFLAISDGLIMALYIVFDLKFLKSGSLQKSPLI
WAQYLLFSLVVQNILHLLSSYLIVSLAVFRLIYIRYPQLAIVHCTMKRAR
YTVVIIFVFAIILSIPYITAHKVTPVNNSTNNNAFTVDYVSVELGKFVHV
WSSIFAKTLPIILMTGMSLWLIYELKGSEKRRQKLKSDHSNIQSDSITKP
LNCKTKHVTESSNRTIKTTRILLAIIFIFLLSYFPQATLLLLAGIFGECF
SSNVYDKLGDVMDLLTLLNACIYFVLYCSMSKQFRDTFFVLFISIPLSHI
CVKRTRIVEHDELSQLYSVVKNRKMDDKYKYQQCASSTDQNEIISPTH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0008528G-protein coupled peptide receptor activity
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR0194277TM_GPCR_serpentine_rcpt_Srw
IPR017452GPCR_Rhodpsn_7TM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 268..292
score: 23.45
coord: 31..55
score: 20.02
coord: 63..84
score: 28.66
coord: 309..335
score: 23.49
coord: 148..169
score: 22.63
IPR0194277TM GPCR, serpentine receptor class w (Srw)PFAMPF103247TM_GPCR_Srwcoord: 37..342
e-value: 1.2E-20
score: 74.0
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 21..342
e-value: 2.9E-48
score: 166.5
NoneNo IPR availablePANTHERPTHR46273FAMILY NOT NAMEDcoord: 4..388
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 31..338
e-value: 5.68863E-54
score: 178.981
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 20..347
NoneNo IPR availableTMHMMTMhelixcoord: 153..170
NoneNo IPR availableTMHMMTMhelixcoord: 271..293
NoneNo IPR availableTMHMMTMhelixcoord: 99..133
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 308..327
NoneNo IPR availableTMHMMTMhelixcoord: 65..84
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 46..327
score: 22.378