Growth hormone-inducible transmembrane protein

Overview
NameGrowth hormone-inducible transmembrane protein
Smed IDSMED30030077
Length (bp)1231
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Growth hormone-inducible transmembrane protein (SMED30030077) t-SNE clustered cells

Violin plots show distribution of expression levels for Growth hormone-inducible transmembrane protein (SMED30030077) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Growth hormone-inducible transmembrane protein (SMED30030077) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Growth hormone-inducible transmembrane protein (SMED30030077) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030077

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030077h1SMcG0014129 Contig34819newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030077h1SMcG0014129 Contig34819uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30030077h1SMcG0014129 dd_Smed_v4_754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030077h1SMcG0014129 dd_Smed_v4_754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030077h1SMcG0014129 dd_Smed_v4_754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030077h1SMcG0014129 dd_Smed_v4_754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030077h1SMcG0014129 dd_Smed_v4_754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030077h1SMcG0014129 dd_Smed_v4_754_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Human
Match: GHITM (growth hormone inducible transmembrane protein [Source:HGNC Symbol;Acc:HGNC:17281])

HSP 1 Score: 197.978 bits (502), Expect = 2.598e-59
Identity = 129/257 (50.19%), Postives = 179/257 (69.65%), Query Frame = 2
Query:  311 YYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            YY L  S++    + K+ +WP YV++RIHSTY Y A S  +TA SA+A+ R+PVL  +  R S   + +    ++G+G+++RSIPYD++ G KH+AWLLH G +G VVAP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PL +GLGLVF SSL  +FL P +  GA   S  +YGGLVLF  FLLYDTQ V++RAE  P     +  Q     YDPIN+ ++I++DTLNIF+R+ T+L  G N+K+
Sbjct:   98 YYGLGLSNE-IGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSP----MYGVQK----YDPINSMLSIYMDTLNIFMRVATMLATGGNRKK 345          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Celegans
Match: K11H12.8 (pep chromosome:WBcel235:IV:655353:658604:1 gene:WBGene00019664.1 transcript:K11H12.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11H12.8)

HSP 1 Score: 203.756 bits (517), Expect = 5.972e-62
Identity = 136/275 (49.45%), Postives = 182/275 (66.18%), Query Frame = 2
Query:  257 TFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            T+ + G  +S  G+G + YY L       SI+ KSA+WPSYVRERI +TYAY A S A+TA S VA  RS  + +  +   + +L   M  +I SG++ RSI Y+ TV  KH+AW LHCG LG V AP+C M G V+ RAA YT GIVGGL++ A+TAPS+KFL M  PLAMG G+VF +++   FL P S +GA+  S  +YGGL+LF  FLLYDTQ +V++AE HP  ++ +     I  +DPIN  M+I++D LNIF+RLV I+G  N  +R
Sbjct:   72 TYALAG--ASVFGVGALMYYGLVSKEQ--SILQKSAIWPSYVRERISTTYAYLAGSLALTAVSGVAASRSAAIMRLTAGGGMMSLFGTMAAMIASGMLARSIDYESTVA-KHLAWALHCGVLGAVFAPLCFMAGPVLTRAAWYTAGIVGGLSATAITAPSEKFLMMSGPLAMGFGVVFVANIGAFFLPPGSALGASLASIVVYGGLILFSAFLLYDTQRLVKKAENHPHSSQLYGSDMQIRSFDPINAQMSIYMDVLNIFMRLVMIMGGMNGNRR 341          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Celegans
Match: K11H12.8 (pep chromosome:WBcel235:IV:655390:658604:1 gene:WBGene00019664.1 transcript:K11H12.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11H12.8)

HSP 1 Score: 203.756 bits (517), Expect = 5.972e-62
Identity = 136/275 (49.45%), Postives = 182/275 (66.18%), Query Frame = 2
Query:  257 TFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            T+ + G  +S  G+G + YY L       SI+ KSA+WPSYVRERI +TYAY A S A+TA S VA  RS  + +  +   + +L   M  +I SG++ RSI Y+ TV  KH+AW LHCG LG V AP+C M G V+ RAA YT GIVGGL++ A+TAPS+KFL M  PLAMG G+VF +++   FL P S +GA+  S  +YGGL+LF  FLLYDTQ +V++AE HP  ++ +     I  +DPIN  M+I++D LNIF+RLV I+G  N  +R
Sbjct:   72 TYALAG--ASVFGVGALMYYGLVSKEQ--SILQKSAIWPSYVRERISTTYAYLAGSLALTAVSGVAASRSAAIMRLTAGGGMMSLFGTMAAMIASGMLARSIDYESTVA-KHLAWALHCGVLGAVFAPLCFMAGPVLTRAAWYTAGIVGGLSATAITAPSEKFLMMSGPLAMGFGVVFVANIGAFFLPPGSALGASLASIVVYGGLILFSAFLLYDTQRLVKKAENHPHSSQLYGSDMQIRSFDPINAQMSIYMDVLNIFMRLVMIMGGMNGNRR 341          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Celegans
Match: K11H12.8 (pep chromosome:WBcel235:IV:656637:658598:1 gene:WBGene00019664.1 transcript:K11H12.8c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11H12.8)

HSP 1 Score: 162.925 bits (411), Expect = 2.796e-48
Identity = 92/172 (53.49%), Postives = 121/172 (70.35%), Query Frame = 2
Query:  566 YDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            Y+ TV  KH+AW LHCG LG V AP+C M G V+ RAA YT GIVGGL++ A+TAPS+KFL M  PLAMG G+VF +++   FL P S +GA+  S  +YGGL+LF  FLLYDTQ +V++AE HP  ++ +     I  +DPIN  M+I++D LNIF+RLV I+G  N  +R
Sbjct:   16 YESTVA-KHLAWALHCGVLGAVFAPLCFMAGPVLTRAAWYTAGIVGGLSATAITAPSEKFLMMSGPLAMGFGVVFVANIGAFFLPPGSALGASLASIVVYGGLILFSAFLLYDTQRLVKKAENHPHSSQLYGSDMQIRSFDPINAQMSIYMDVLNIFMRLVMIMGGMNGNRR 186          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Fly
Match: CG2076 (gene:FBgn0030263 transcript:FBtr0346280)

HSP 1 Score: 211.846 bits (538), Expect = 4.643e-65
Identity = 140/245 (57.14%), Postives = 174/245 (71.02%), Query Frame = 2
Query:  344 SIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKK 1078
            SI + + MWP +VR+RI STYA+F  S  +TAA+A A FRS  L + ASR  I A +  +  VIGSG + RSI Y   +G KH+AW +HC  LG V+AP+C MGG ++ RAALYT GIVGGL+++A  APSDKFLYMG PLA+GLG+VFASSLA ++L P + +GA   S  LYGGLVLF GFLLYDTQ +VRRAE +P        Q S   YDPIN SM+I++D LNIFIR+VTIL  G  +K
Sbjct:  105 SIADNAIMWPQFVRDRIQSTYAFFGGSCVLTAAAAAATFRSHRLLELASRGGILATIASLALVIGSGAVARSIEYQPGLGAKHLAWAVHCAILGAVIAPICFMGGPILTRAALYTGGIVGGLSTIAACAPSDKFLYMGGPLAIGLGVVFASSLASMWLPPTTALGAGLASMSLYGGLVLFSGFLLYDTQRMVRRAEVYP--------QYSYTPYDPINASMSIYMDVLNIFIRIVTILSGGQRRK 341          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Fly
Match: CG2076 (gene:FBgn0030263 transcript:FBtr0073428)

HSP 1 Score: 211.846 bits (538), Expect = 4.643e-65
Identity = 140/245 (57.14%), Postives = 174/245 (71.02%), Query Frame = 2
Query:  344 SIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKK 1078
            SI + + MWP +VR+RI STYA+F  S  +TAA+A A FRS  L + ASR  I A +  +  VIGSG + RSI Y   +G KH+AW +HC  LG V+AP+C MGG ++ RAALYT GIVGGL+++A  APSDKFLYMG PLA+GLG+VFASSLA ++L P + +GA   S  LYGGLVLF GFLLYDTQ +VRRAE +P        Q S   YDPIN SM+I++D LNIFIR+VTIL  G  +K
Sbjct:  105 SIADNAIMWPQFVRDRIQSTYAFFGGSCVLTAAAAAATFRSHRLLELASRGGILATIASLALVIGSGAVARSIEYQPGLGAKHLAWAVHCAILGAVIAPICFMGGPILTRAALYTGGIVGGLSTIAACAPSDKFLYMGGPLAIGLGVVFASSLASMWLPPTTALGAGLASMSLYGGLVLFSGFLLYDTQRMVRRAEVYP--------QYSYTPYDPINASMSIYMDVLNIFIRIVTILSGGQRRK 341          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Fly
Match: Mics1 (gene:FBgn0037506 transcript:FBtr0081554)

HSP 1 Score: 190.66 bits (483), Expect = 1.213e-56
Identity = 142/338 (42.01%), Postives = 204/338 (60.36%), Query Frame = 2
Query:   83 KHIIEIEMLSKMQLNLYRHITR-----RLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            K +I    + ++ +  Y   +R     +L ++  G + K R          M+ P S    S         +    +G+  YY L  ++ P SI + S +WP YVR+RIH+TYAYF  S  VTAASAVA F+S  +    +R+   A L+ +  V+ SG I + + Y    G K +AWL+HC  LG V+AP+C++GG ++ +A LYT GIVG L++VA  APS+KFL+MG PLA+GLG+VFASSLA ++L P + +GA   S  LYGGL+LF GFLLYDTQ +V+ AE +P  +K        P YDPIN+++ I++D LNIFIR+  IL  G+ K++
Sbjct:   48 KSVIPKRNMQELGMRKYSRESRDRDRSQLESRTRGPSLKER----------MMGPPSENAYSMGKGAAAGAALMGLVGLC-YYGLGLANQP-SIYDHSMVWPQYVRDRIHATYAYFGASCGVTAASAVAFFQSDAMMALMTRSGWVASLVTLGLVMLSGSIAQGLEYQPGFGAKQLAWLVHCAVLGAVLAPMCLLGGPILTKALLYTSGIVGALSTVAACAPSEKFLHMGGPLAIGLGVVFASSLASMWLPPTTAVGAGLASMSLYGGLILFSGFLLYDTQRIVKSAELYPQYSK-------FP-YDPINHALAIYMDALNIFIRIAIILA-GDQKRK 364          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Zebrafish
Match: CABZ01112656.1 (pep chromosome:GRCz11:12:49003489:49032899:-1 gene:ENSDARG00000098983.2 transcript:ENSDART00000159356.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01112656.1)

HSP 1 Score: 49.6766 bits (117), Expect = 6.626e-7
Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  311 YYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVL 475
            YY L  SS+    + K+A+WP YVR+RIHSTY YFA S  +TA SAVA+ R+PVL
Sbjct:   94 YYGLGMSSE-IGAIEKAAIWPQYVRDRIHSTYLYFAGSVGLTALSAVAISRTPVL 147          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Xenopus
Match: ghitm (growth hormone inducible transmembrane protein [Source:NCBI gene;Acc:549949])

HSP 1 Score: 164.081 bits (414), Expect = 2.368e-46
Identity = 145/313 (46.33%), Postives = 197/313 (62.94%), Query Frame = 2
Query:  161 KNYGSNFKFRQARPKDVTRDMVEPA---SAETASK---TFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTIL-GMGNNKK 1078
            + Y S  +F   R K    ++ E A   S  TA++   T R++    +  G+G + YY L  S++    + K+ +WP YV+ERI STY YFA S  +TA SAVAV R+P L     R S  A+      +IG+G+++RSI YD+  G KH+AW+LH G +G VVAP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PL +GLGLV ASS+   FL P S  GA   S  +YGGLVLFG FLLYDTQ V++RAE +P           +  +DPIN+ + I+ DTLNIFIR+  +L G GN +K
Sbjct:   44 QGYSSRSRFGLRRVKSAREELKEAAFEPSMGTAARIDTTGRLIVAGGAVVGLGALCYYGLGMSNE-IGAIEKAVIWPEYVKERIRSTYMYFAGSIGLTALSAVAVSRAPALMSLMMRGSWLAIGATFAAMIGAGMLVRSISYDQNPGAKHLAWMLHAGVMGAVVAPLTLLGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGGPLGIGLGLVLASSIGSAFLPPTSVFGAGLYSIAIYGGLVLFGMFLLYDTQKVIKRAETYP--------MYGVAKFDPINSCLGIYTDTLNIFIRVAMMLAGSGNRRK 347          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Mouse
Match: Ghitm (growth hormone inducible transmembrane protein [Source:MGI Symbol;Acc:MGI:1913342])

HSP 1 Score: 190.66 bits (483), Expect = 1.163e-56
Identity = 139/314 (44.27%), Postives = 199/314 (63.38%), Query Frame = 2
Query:  158 AKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRI------VGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            ++ Y +  + R  R K   +++ E A   +  K F+I           +A G+G + YY L  S++    + K+ +WP YV++RIHSTY Y A S  +TA SA+AV R+P L  +    S   +      +IG+G+++ SI Y+++ G KH+AW+LH G +G VVAP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PL +GLGLVFASSL  +FL P S  GA   S  +YGGLVLF  FLLYDTQ V++RAE  P     +  Q     YDPIN+ + I++DTLNIF+R+ T+L  G+N+K+
Sbjct:   43 SREYATKTRIRTHRGKT-GQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNE-IGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALAVARTPALMNFMMTGSWVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTILGGPLLLRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFASSLGSMFLPPTSVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEITP----MYGAQK----YDPINSMLTIYMDTLNIFMRVATMLATGSNRKK 346          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Mouse
Match: Ghitm (growth hormone inducible transmembrane protein [Source:MGI Symbol;Acc:MGI:1913342])

HSP 1 Score: 190.66 bits (483), Expect = 1.163e-56
Identity = 139/314 (44.27%), Postives = 199/314 (63.38%), Query Frame = 2
Query:  158 AKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRI------VGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            ++ Y +  + R  R K   +++ E A   +  K F+I           +A G+G + YY L  S++    + K+ +WP YV++RIHSTY Y A S  +TA SA+AV R+P L  +    S   +      +IG+G+++ SI Y+++ G KH+AW+LH G +G VVAP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PL +GLGLVFASSL  +FL P S  GA   S  +YGGLVLF  FLLYDTQ V++RAE  P     +  Q     YDPIN+ + I++DTLNIF+R+ T+L  G+N+K+
Sbjct:   43 SREYATKTRIRTHRGKT-GQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNE-IGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALAVARTPALMNFMMTGSWVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTILGGPLLLRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFASSLGSMFLPPTSVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEITP----MYGAQK----YDPINSMLTIYMDTLNIFMRVATMLATGSNRKK 346          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Mouse
Match: Ghitm (growth hormone inducible transmembrane protein [Source:MGI Symbol;Acc:MGI:1913342])

HSP 1 Score: 54.6842 bits (130), Expect = 3.089e-8
Identity = 53/157 (33.76%), Postives = 87/157 (55.41%), Query Frame = 2
Query:  158 AKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRI------VGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLH 610
            ++ Y +  + R  R K   +++ E A   +  K F+I           +A G+G + YY L  S++    + K+ +WP YV++RIHSTY Y A S  +TA SA+AV R+P L  +    S   +      +IG+G+++ SI Y+++ G KH+AW+LH
Sbjct:   43 SREYATKTRIRTHRGK-TGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNE-IGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALAVARTPALMNFMMTGSWVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLH 197          
BLAST of Growth hormone-inducible transmembrane protein vs. UniProt/SwissProt
Match: sp|Q9H3K2|GHITM_HUMAN (Growth hormone-inducible transmembrane protein OS=Homo sapiens OX=9606 GN=GHITM PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 1.248e-58
Identity = 129/257 (50.19%), Postives = 179/257 (69.65%), Query Frame = 2
Query:  311 YYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            YY L  S++    + K+ +WP YV++RIHSTY Y A S  +TA SA+A+ R+PVL  +  R S   + +    ++G+G+++RSIPYD++ G KH+AWLLH G +G VVAP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PL +GLGLVF SSL  +FL P +  GA   S  +YGGLVLF  FLLYDTQ V++RAE  P     +  Q     YDPIN+ ++I++DTLNIF+R+ T+L  G N+K+
Sbjct:   98 YYGLGLSNE-IGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSP----MYGVQK----YDPINSMLSIYMDTLNIFMRVATMLATGGNRKK 345          
BLAST of Growth hormone-inducible transmembrane protein vs. UniProt/SwissProt
Match: sp|Q5XIA8|GHITM_RAT (Growth hormone-inducible transmembrane protein OS=Rattus norvegicus OX=10116 GN=Ghitm PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.178e-56
Identity = 140/314 (44.59%), Postives = 201/314 (64.01%), Query Frame = 2
Query:  158 AKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRI------VGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            ++ Y +  + R  R K   +++ E A   +  K F+I           +A G+G + YY L  S++    + K+ +WP YV++RIHSTY Y A S  +TA SA+A+ RSP L  +    S   +      +IG+G++++SI Y+++ G KH+AW+LH G +G VVAP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PL +GLGLVFASSL  +FL P S  GA   S  +YGGLVLF  FLLYDTQ VV+RAE  P    ++  Q     YDPIN+ + I++DTLNIF+R+ T+L  G+N+K+
Sbjct:   43 SREYATKTRIRTHRGK-TGQELKEAALEPSLEKVFKIDQMGKWFVAGGAAVGLGALCYYGLGMSNE-IGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALALARSPALMNFMMTGSWMTIGATFAAMIGAGMLVQSISYEQSPGPKHLAWMLHSGVMGAVVAPLTILGGPLLLRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFASSLGSMFLPPTSVAGATLYSVAMYGGLVLFSMFLLYDTQKVVKRAEITP----AYGAQK----YDPINSMLTIYMDTLNIFMRVATMLATGSNRKK 346          
BLAST of Growth hormone-inducible transmembrane protein vs. UniProt/SwissProt
Match: sp|Q91VC9|GHITM_MOUSE (Growth hormone-inducible transmembrane protein OS=Mus musculus OX=10090 GN=Ghitm PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 8.138e-56
Identity = 139/314 (44.27%), Postives = 199/314 (63.38%), Query Frame = 2
Query:  158 AKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRI------VGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            ++ Y +  + R  R K   +++ E A   +  K F+I           +A G+G + YY L  S++    + K+ +WP YV++RIHSTY Y A S  +TA SA+AV R+P L  +    S   +      +IG+G+++ SI Y+++ G KH+AW+LH G +G VVAP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PL +GLGLVFASSL  +FL P S  GA   S  +YGGLVLF  FLLYDTQ V++RAE  P     +  Q     YDPIN+ + I++DTLNIF+R+ T+L  G+N+K+
Sbjct:   43 SREYATKTRIRTHRGKT-GQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNE-IGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALAVARTPALMNFMMTGSWVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTILGGPLLLRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFASSLGSMFLPPTSVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEITP----MYGAQK----YDPINSMLTIYMDTLNIFMRVATMLATGSNRKK 346          
BLAST of Growth hormone-inducible transmembrane protein vs. TrEMBL
Match: W8C0K3 (Growth hormone-inducible transmembrane protein OS=Ceratitis capitata OX=7213 GN=GHITM PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 1.860e-67
Identity = 158/326 (48.47%), Postives = 204/326 (62.58%), Query Frame = 2
Query:  107 LSKMQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTIL-GMGNNKKR 1081
            L    LN+ R   R      Y  N      R   +   ++ P S E A    +     +SA G+G + +Y L  + DP SI   S +WP +VRERIH+TY YF  S  +TA +A+AVFRSP L    +R    ++L     +IG+G + +SI Y   VG K +AW LHC  LG VVAP+C +GG ++ RAALYT GIVGGL++VAV APSDKFLYMG PLA+GLGLVFASSLA ++L P + +GA   S  LYGGL+LF GFLLYDTQ +VR AE HP        Q  +  YDPIN S++I++DT+NIFIR+ TIL G G N++R
Sbjct:   38 LKSYNLNISRSYARGPTRGPYTRN---EVGRTPTLKEKLMGPPS-ENAYSIGKGAVAGASAIGLGALCFYGLGLNKDP-SIYTNSMLWPEFVRERIHATYGYFGASCVITAGAAMAVFRSPRLLSIVTRNGWMSMLGTFALMIGTGALAQSIEYQPGVGPKQLAWALHCAVLGAVVAPMCFLGGPILTRAALYTAGIVGGLSTVAVCAPSDKFLYMGGPLAVGLGLVFASSLASMWLPPTTALGAGLASMSLYGGLILFSGFLLYDTQRIVRYAENHP--------QIFVKPYDPINASLSIYMDTINIFIRIATILAGGGGNRRR 350          
BLAST of Growth hormone-inducible transmembrane protein vs. TrEMBL
Match: A0A1B0CR00 (Uncharacterized protein OS=Lutzomyia longipalpis OX=7200 PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.172e-65
Identity = 138/266 (51.88%), Postives = 185/266 (69.55%), Query Frame = 2
Query:  284 SATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            SA G+G + +Y L       S++N S +WP YV++RIH+TY YF  S  +TA +A+A FRSP +    SR    A+ L M  V+GSG I +SIPY   +G K  AW +HC  LG V+AP+C +GG ++ RAALY+ G+VGGL++VAV APSDKFLYMG PLA+GLG+VFASSLA I+L P + +GA   S  LYGGL+LF GFLLYDTQ ++RRAE HP     ++ Q     +DP+N +M+I++DTLNIFIR+V++L  G   +R
Sbjct:   75 SALGLGALCFYGLGLGKGT-SVLNNSMLWPEYVKQRIHTTYLYFGASLGITALTAMAAFRSPAILNVVSRNGFLAIALMMGAVVGSGSIAQSIPYSGGIGAKQFAWAVHCAILGAVIAPLCFVGGPILTRAALYSTGVVGGLSTVAVCAPSDKFLYMGGPLAIGLGVVFASSLASIWLPPTTALGAGLASMSLYGGLLLFSGFLLYDTQRIIRRAETHP----MYAMQP----FDPVNCAMSIYMDTLNIFIRIVSLLAGGGGNRR 331          
BLAST of Growth hormone-inducible transmembrane protein vs. TrEMBL
Match: A0A0C9QSZ8 (GHITM_0 protein OS=Fopius arisanus OX=64838 GN=GHITM_0 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.064e-65
Identity = 139/339 (41.00%), Postives = 216/339 (63.72%), Query Frame = 2
Query:   77 IFKHIIEIEMLSKMQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIV-GVV--SSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQ-NSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            + K  I  ++ S ++  +  H +R   A+ +G+  +   +R       +VE A   TA K F I  G V  S+  G+G + YY    S    +I + +A+WP YV++RIH+TY YF  S   + A+A A  RSP + +  ++    A+ + +  +IG+ I+  SIPY E  G K +AWLLHCG +G V+AP+ ++GG ++ RAA+YT G+VGGL++VAV APSDKFL M  PL +G G+VF SSL  IFL P + +G+   +  LYGGLVLF  +LLYDTQ ++R+AE HP  ++ + +  N++  YDP+NN+M+I++DT+NIF+R+++IL  G ++++
Sbjct:    6 VCKATIAPQVSSLLKTPVVAHGSRVQVARLFGNEGRSTFSRAARNRGSLVEDAVKPTAEKAFNIGRGFVAGSAVLGLGALCYYGAGLSPTTGAI-DHAALWPQYVKDRIHTTYMYFGGSVLASGAAAAACLRSPTIMRMVTQGGWVAMGVSLAAMIGTSILTTSIPYQEGFGPKQMAWLLHCGVIGAVLAPMSLLGGALVVRAAIYTAGVVGGLSAVAVCAPSDKFLSMAAPLGIGFGVVFVSSLGSIFLPPTTALGSGLYAISLYGGLVLFSMYLLYDTQKLIRQAETHPAYDRQYDYAGNAVRSYDPVNNAMHIYMDTVNIFVRILSILAGGGSRRK 343          
BLAST of Growth hormone-inducible transmembrane protein vs. TrEMBL
Match: A0A1V9XH30 (Growth hormone-inducible transmembrane protein-like OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_03733 PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.890e-64
Identity = 142/315 (45.08%), Postives = 205/315 (65.08%), Query Frame = 2
Query:  137 HITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            H  R+   +   +  +    R K +    +EPA+ ++A +  + +   +S  G+G + YY L  SS+    V ++  WP YVR+RI  TY YF  S  +TAASAV VFR+P L +  S  SI   +     +IGS +++RSIPY+   G K +AW+ HCG +G V+AP+C++GG +I RAA  T G++GGL++VA  APSD+FL M  PL +GLG+VFASS+   FL P + +GA   S  LYGGLVLF  FLLYDTQ ++++AE HPPPN    ++ + P YDPIN+SM+I++DT+NIFIR++TIL  G ++K+
Sbjct:   35 HSIRQFMQQQKTTRLERIMERRKTLKELAMEPAT-DSAFQAGKGLLAGASVVGLGALCYYGLGMSSE-IGAVERAYAWPQYVRDRIRDTYGYFGGSIILTAASAVTVFRTPALLRLVSANSIMGFVATFAAMIGSSMLVRSIPYEHGFGTKQLAWMGHCGVVGAVIAPLCVLGGPIIIRAAWLTAGVLGGLSAVAACAPSDRFLNMTAPLGIGLGVVFASSVGSFFLPPSTALGAGLYSISLYGGLVLFSMFLLYDTQRIIKKAETHPPPN----YRLAAP-YDPINSSMSIYMDTINIFIRILTILAGGGSRKK 342          
BLAST of Growth hormone-inducible transmembrane protein vs. TrEMBL
Match: A0A0P4VST4 (Putative growth hormone-induced protein OS=Rhodnius neglectus OX=72488 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.346e-63
Identity = 147/333 (44.14%), Postives = 208/333 (62.46%), Query Frame = 2
Query:   92 IEIEMLSKMQLNLYRHITRRLHAKNYGSNFKFRQARPK----DVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKK 1078
            ++I ++++  L   R  + +   + Y  N +F + RP        R+ + P     A+    + G  +S  G+G + YY L   S P +I +++ +WP YVR+RI  TY YF  S  +TA SAV  FRSPV+  + +R S  A+   +  +IG+G + R IPY    G K +AW+LH   +G V+APVC++GG ++ RAA YT G+VGGL+++A  APSDKFLYMG PLAMGLG+VFASSL  +FL+P S +GA+A +  +YGGL+LF GFLLYDTQ +VR AE +P        Q     YDP+N S++IFLDT+NIFIR+ TIL     +K
Sbjct:   21 VKINVITRGNLKSVRQWSFQ-PKRCYSDNSRFTRRRPAFGQALREREALSPFDVGKAA----LAG--ASLVGVGALCYYGLGAGSQPGAI-DQAVVWPEYVRQRIKDTYTYFGGSLMITATSAVMAFRSPVIMNFVARNSFLAVAACIAAMIGTGEVCRQIPYQPGFGTKQLAWMLHSSVVGIVLAPVCIIGGPILVRAAWYTAGVVGGLSAIACCAPSDKFLYMGGPLAMGLGVVFASSLGSMFLSPTSMLGASAAAISIYGGLILFSGFLLYDTQRIVRAAEVYP--------QYHPQPYDPVNMSISIFLDTINIFIRIATILSGSQQRK 337          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Cavefish
Match: GHITM (growth hormone inducible transmembrane protein [Source:NCBI gene;Acc:103031367])

HSP 1 Score: 195.667 bits (496), Expect = 1.123e-58
Identity = 146/314 (46.50%), Postives = 199/314 (63.38%), Query Frame = 2
Query:  161 KNYGSNFKFRQARPKDVTRDMVEPASAETASKTF-------RIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            + + S  +F   R K   +D ++ A+ E A+ T        R++    +A G+G + YY L  SS+    + KS +WP YV++RIHSTY YFA S  VTA SAVAV R+P L     R S  A+      +IG+G+++RSI Y+ +   KH+AW+LH G +G V+AP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PLA+G G+VFASSL  +FL P +  GA   S  +YGGL+LF  FLLYDTQ V++RAE HP     +  Q     YDPIN  M I++DTLNIF+RLV IL  G   +R
Sbjct:   44 QGFSSRARFGIRRSK-TAKDQLQEAAFEPATDTAIKIDTMGRMILAGGAAVGMGALCYYGLGMSSE-IGALEKSVIWPQYVKDRIHSTYMYFAGSVGVTALSAVAVSRTPALLGLMMRGSWLAIGATFAAMIGAGMLVRSISYEHSPLPKHLAWMLHAGVMGAVIAPLTLLGGPLMMRAAWYTAGIVGGLSTVAMCAPSEKFLNMGGPLAIGFGVVFASSLGTMFLPPTTPFGAGLYSIAVYGGLILFSMFLLYDTQKVIKRAETHP----LYGVQK----YDPINACMGIYMDTLNIFMRLVMILANGGGGRR 347          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Cavefish
Match: GHITM (growth hormone inducible transmembrane protein [Source:NCBI gene;Acc:103031367])

HSP 1 Score: 192.586 bits (488), Expect = 1.857e-57
Identity = 133/259 (51.35%), Postives = 174/259 (67.18%), Query Frame = 2
Query:  305 ISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            + YY L  SS+    + KS +WP YV++RIHSTY YFA S  VTA SAVAV R+P L     R S  A+      +IG+G+++RSI Y+ +   KH+AW+LH G +G V+AP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PLA+G G+VFASSL  +FL P +  GA   S  +YGGL+LF  FLLYDTQ V++RAE HP     +  Q     YDPIN  M I++DTLNIF+RLV IL  G   +R
Sbjct:   96 LCYYGLGMSSE-IGALEKSVIWPQYVKDRIHSTYMYFAGSVGVTALSAVAVSRTPALLGLMMRGSWLAIGATFAAMIGAGMLVRSISYEHSPLPKHLAWMLHAGVMGAVIAPLTLLGGPLMMRAAWYTAGIVGGLSTVAMCAPSEKFLNMGGPLAIGFGVVFASSLGTMFLPPTTPFGAGLYSIAVYGGLILFSMFLLYDTQKVIKRAETHP----LYGVQK----YDPINACMGIYMDTLNIFMRLVMILANGGGGRR 345          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Nematostella
Match: EDO32604 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUK2])

HSP 1 Score: 163.696 bits (413), Expect = 8.358e-48
Identity = 123/259 (47.49%), Postives = 168/259 (64.86%), Query Frame = 2
Query:  311 YYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLX--XXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            YY L  SS+    +++S MWP  VR+RIH+TYAYFA S AVTA +A ++ RS  +Y    RAS P L +G  M+  I S +I  S+PY+  +  KH AWL H   +G ++AP+ ++GG ++ RAA+ T G+VG L+  A  AP  KFL  G PLA+GLG V  +SL  +FL   + +GA   +   YGGLV+FGGFLLYDTQ ++R+AE HP          S P YDPIN S+ I++DT+NIFIR+VTI+   NN++R
Sbjct:   18 YYGLGLSSE-VGAIDRSVMWPQVVRDRIHATYAYFAGSLAVTAGAAYSISRSRAVYTMM-RAS-PLLFVGGGMLATIASSMICMSLPYEAGLNGKHFAWLAHSSLVGTILAPIMLLGGPLVVRAAVVTAGVVGALSLTAACAPDGKFLTWGGPLAIGLGGVVMASLGSLFLPATTAVGAGLQAITTYGGLVIFGGFLLYDTQKIIRQAETHP-------LYASRP-YDPINASIGIYMDTINIFIRIVTIMASQNNRRR 265          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Medaka
Match: GHITM (growth hormone inducible transmembrane protein [Source:NCBI gene;Acc:101162402])

HSP 1 Score: 196.438 bits (498), Expect = 5.590e-59
Identity = 145/310 (46.77%), Postives = 198/310 (63.87%), Query Frame = 2
Query:  173 SNFKFRQARPKDVTRDMVEPASAETASKTF-------RIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            + F FR+ +     +D ++ A+ E A+ T        RI+    +A G+G + YY L  S++    + KS +WP YV++RIHSTY YFA S  +TA SAVAV R+P L     + S  A+      +IG+G+++RSI Y+ +   KH+AW+LH G +G V+AP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PLA+G G+VFASSL  +FL P S  GA   S  +YGGLVLF  FLLYDTQ V+++AE HP     +  Q     YDPIN  M I++DTLNIF+RLV IL  G   KR
Sbjct:   50 ARFGFRRVK---TAKDQIKEAAFEPATDTAIKIDSMGRIILAGGAAVGLGALCYYGLGMSNE-IGALEKSMIWPQYVKDRIHSTYMYFAGSVGLTALSAVAVSRTPALMGLMMKGSWLAIGATFAAMIGAGMLVRSISYEHSPMPKHLAWMLHAGVMGAVIAPLTLLGGPLMMRAAWYTAGIVGGLSTVAMCAPSEKFLNMGGPLAVGFGVVFASSLGSMFLPPTSAFGAGLYSVAVYGGLVLFSMFLLYDTQKVIKKAETHP----LYGVQK----YDPINACMGIYMDTLNIFMRLVMILANGGGGKR 347          
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Medaka
Match: GHITM (growth hormone inducible transmembrane protein [Source:NCBI gene;Acc:101162402])

HSP 1 Score: 164.081 bits (414), Expect = 7.827e-47
Identity = 129/282 (45.74%), Postives = 179/282 (63.48%), Query Frame = 2
Query:  173 SNFKFRQARPKDVTRDMVEPASAETASKTF-------RIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPIN 997
            + F FR+ +     +D ++ A+ E A+ T        RI+    +A G+G + YY L  S++    + KS +WP YV++RIHSTY YFA S  +TA SAVAV R+P L     + S  A+      +IG+G+++RSI Y+ +   KH+AW+LH G +G V+AP+ ++GG ++ RAA YT GIVGGL++VA+ APS+KFL MG PLA+G G+VFASSL  +FL P S  GA   S  +YGGLVLF  FLLYDTQ V+++AE HP     +  Q     YDPIN
Sbjct:   50 ARFGFRRVK---TAKDQIKEAAFEPATDTAIKIDSMGRIILAGGAAVGLGALCYYGLGMSNE-IGALEKSMIWPQYVKDRIHSTYMYFAGSVGLTALSAVAVSRTPALMGLMMKGSWLAIGATFAAMIGAGMLVRSISYEHSPMPKHLAWMLHAGVMGAVIAPLTLLGGPLMMRAAWYTAGIVGGLSTVAMCAPSEKFLNMGGPLAVGFGVVFASSLGSMFLPPTSAFGAGLYSVAVYGGLVLFSMFLLYDTQKVIKKAETHP----LYGVQK----YDPIN 319          
BLAST of Growth hormone-inducible transmembrane protein vs. Planmine SMEST
Match: SMESG000029240.1 (SMESG000029240.1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 326/326 (100.00%), Postives = 326/326 (100.00%), Query Frame = 2
Query:  104 MLSKMQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            MLSKMQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFAVSNAVTAASAVAVFRSPVLYKYASRASIPALLLGMVGVIGSGIIMRSIPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQLYGGLVLFGGFLLYDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR
Sbjct:    1 MLSKMQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFAVSNAVTAASAVAVFRSPVLYKYASRASIPALLLGMVGVIGSGIIMRSIPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQLYGGLVLFGGFLLYDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 326          
BLAST of Growth hormone-inducible transmembrane protein vs. Planmine SMEST
Match: SMESG000029240.1 (SMESG000029240.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 322/322 (100.00%), Postives = 322/322 (100.00%), Query Frame = 2
Query:  116 MQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFXXXXXXXXXXXXXXFRSPVLYKYASRASIPALLLXXXXXXXXXXXXXXXPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQXXXXXXXXXXXXXXDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 1081
            MQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFAVSNAVTAASAVAVFRSPVLYKYASRASIPALLLGMVGVIGSGIIMRSIPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQLYGGLVLFGGFLLYDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR
Sbjct:    1 MQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETASKTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHSTYAYFAVSNAVTAASAVAVFRSPVLYKYASRASIPALLLGMVGVIGSGIIMRSIPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVGGLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALSFQLYGGLVLFGGFLLYDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNSMNIFLDTLNIFIRLVTILGMGNNKKR 322          
The following BLAST results are available for this feature:
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GHITM2.598e-5950.19growth hormone inducible transmembrane protein [So... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
K11H12.85.972e-6249.45pep chromosome:WBcel235:IV:655353:658604:1 gene:WB... [more]
K11H12.85.972e-6249.45pep chromosome:WBcel235:IV:655390:658604:1 gene:WB... [more]
K11H12.82.796e-4853.49pep chromosome:WBcel235:IV:656637:658598:1 gene:WB... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG20764.643e-6557.14gene:FBgn0030263 transcript:FBtr0346280[more]
CG20764.643e-6557.14gene:FBgn0030263 transcript:FBtr0073428[more]
Mics11.213e-5642.01gene:FBgn0037506 transcript:FBtr0081554[more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01112656.16.626e-758.18pep chromosome:GRCz11:12:49003489:49032899:-1 gene... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ghitm2.368e-4646.33growth hormone inducible transmembrane protein [So... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ghitm1.163e-5644.27growth hormone inducible transmembrane protein [So... [more]
Ghitm1.163e-5644.27growth hormone inducible transmembrane protein [So... [more]
Ghitm3.089e-833.76growth hormone inducible transmembrane protein [So... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9H3K2|GHITM_HUMAN1.248e-5850.19Growth hormone-inducible transmembrane protein OS=... [more]
sp|Q5XIA8|GHITM_RAT1.178e-5644.59Growth hormone-inducible transmembrane protein OS=... [more]
sp|Q91VC9|GHITM_MOUSE8.138e-5644.27Growth hormone-inducible transmembrane protein OS=... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W8C0K31.860e-6748.47Growth hormone-inducible transmembrane protein OS=... [more]
A0A1B0CR001.172e-6551.88Uncharacterized protein OS=Lutzomyia longipalpis O... [more]
A0A0C9QSZ82.064e-6541.00GHITM_0 protein OS=Fopius arisanus OX=64838 GN=GHI... [more]
A0A1V9XH302.890e-6445.08Growth hormone-inducible transmembrane protein-lik... [more]
A0A0P4VST41.346e-6344.14Putative growth hormone-induced protein OS=Rhodniu... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GHITM1.123e-5846.50growth hormone inducible transmembrane protein [So... [more]
GHITM1.857e-5751.35growth hormone inducible transmembrane protein [So... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO326048.358e-4847.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GHITM5.590e-5946.77growth hormone inducible transmembrane protein [So... [more]
GHITM7.827e-4745.74growth hormone inducible transmembrane protein [So... [more]
back to top
BLAST of Growth hormone-inducible transmembrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000029240.10.000e+0100.00SMESG000029240.1[more]
SMESG000029240.10.000e+0100.00SMESG000029240.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030077 ID=SMED30030077|Name=Growth hormone-inducible transmembrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1231bp
CAAAAATAACTAGTAGAAATTTCTCGATTTATTTAAAAGGTCGAAGTGTT
TTAAATTTGTGTATTTCCAAAGCACTATTTTCAAACATATTATAGAAATA
GAAATGCTTTCTAAAATGCAGTTAAATCTTTATCGACATATAACACGACG
TTTGCATGCCAAAAATTATGGAAGTAATTTCAAATTTCGCCAGGCAAGAC
CTAAAGATGTAACGCGCGATATGGTGGAACCTGCAAGCGCTGAAACTGCC
TCCAAAACTTTTCGAATTGTTGGAGTAGTATCATCTGCTACCGGAATTGG
CATAATATCATACTATGCATTAAAGAAATCAAGTGATCCATTTTCTATCG
TGAATAAGTCTGCAATGTGGCCTTCGTATGTGCGAGAAAGAATCCATTCA
ACTTACGCCTATTTTGCTGTCAGTAATGCTGTGACTGCCGCTAGTGCAGT
TGCTGTCTTTCGTAGTCCAGTTTTGTATAAGTATGCGTCTCGCGCATCCA
TTCCAGCATTGTTGTTAGGAATGGTTGGCGTTATAGGTTCAGGAATAATT
ATGAGATCTATTCCATATGATGAAACGGTTGGAATAAAACACATTGCATG
GTTGTTACATTGTGGTACTTTGGGATTTGTGGTCGCTCCGGTTTGTATGA
TGGGAGGGCAAGTTATTCAGAGAGCGGCTCTTTATACTCTGGGAATTGTA
GGAGGATTAACTTCGGTGGCGGTTACTGCACCGTCGGATAAATTCCTATA
CATGGGAGTACCGTTGGCAATGGGCCTAGGCTTGGTGTTCGCTTCATCAT
TAGCGGGAATTTTCCTAAATCCTTTAAGCCGAATCGGAGCTGCTGCGCTA
TCTTTTCAGTTGTATGGCGGTCTGGTATTGTTTGGAGGATTTCTCCTCTA
TGACACCCAGATGGTTGTGAGGCGTGCTGAGGAGCACCCTCCACCTAATA
AATCGTTCAGTTTCCAAAACTCTATCCCACTATATGATCCAATCAACAAC
TCAATGAACATATTTCTGGACACTCTCAACATTTTCATTCGATTGGTCAC
TATTTTGGGCATGGGGAATAATAAAAAAAGATAAACTTTCGTTGTCGTTA
CGAACAATAATACATATTCATTTACAGAGATTCATGAAATTCATTTGCTA
CCGCTACATAACCTCTTAGTAACTGTTGTTTGAAAATAAATATATCGATT
TGTCAAAAAAAAAAGATAAACTTTCGTTGTC
back to top

protein sequence of SMED30030077-orf-1

>SMED30030077-orf-1 ID=SMED30030077-orf-1|Name=SMED30030077-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MLSKMQLNLYRHITRRLHAKNYGSNFKFRQARPKDVTRDMVEPASAETAS
KTFRIVGVVSSATGIGIISYYALKKSSDPFSIVNKSAMWPSYVRERIHST
YAYFAVSNAVTAASAVAVFRSPVLYKYASRASIPALLLGMVGVIGSGIIM
RSIPYDETVGIKHIAWLLHCGTLGFVVAPVCMMGGQVIQRAALYTLGIVG
GLTSVAVTAPSDKFLYMGVPLAMGLGLVFASSLAGIFLNPLSRIGAAALS
FQLYGGLVLFGGFLLYDTQMVVRRAEEHPPPNKSFSFQNSIPLYDPINNS
MNIFLDTLNIFIRLVTILGMGNNKKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006214Bax_inhibitor_1-related
IPR011528NERD
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006214Bax inhibitor 1-relatedPFAMPF01027Bax1-Icoord: 95..318
e-value: 1.3E-38
score: 132.9
IPR006214Bax inhibitor 1-relatedPANTHERPTHR23291BAX INHIBITOR-RELATEDcoord: 26..321
NoneNo IPR availablePANTHERPTHR23291:SF32GROWTH HORMONE-INDUCIBLE TRANSMEMBRANE PROTEINcoord: 26..321
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 192..211
NoneNo IPR availableTMHMMTMhelixcoord: 163..185
NoneNo IPR availableTMHMMTMhelixcoord: 55..73
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
NoneNo IPR availableTMHMMTMhelixcoord: 303..322
NoneNo IPR availableTMHMMTMhelixcoord: 97..119