Calcineurin B subunit

Overview
NameCalcineurin B subunit
Smed IDSMED30030070
Length (bp)682
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcineurin B subunit (SMED30030070) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcineurin B subunit (SMED30030070) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcineurin B subunit (SMED30030070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcineurin B subunit (SMED30030070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030070SMESG000077376.1 SmedASXL_009983SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30030070SMESG000077376.1 dd_Smed_v4_17410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30030070SMESG000077376.1 dd_Smed_v4_17410_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcineurin B subunit vs. Ensembl Human
Match: PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha [Source:HGNC Symbol;Acc:HGNC:9317])

HSP 1 Score: 84.7297 bits (208), Expect = 9.272e-20
Identity = 51/180 (28.33%), Postives = 92/180 (51.11%), Query Frame = 3
Query:   81 QKMGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  G++   +   E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:   10 ESCGMELCGKKGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 189          
BLAST of Calcineurin B subunit vs. Ensembl Human
Match: PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha [Source:HGNC Symbol;Acc:HGNC:9317])

HSP 1 Score: 83.9593 bits (206), Expect = 1.158e-19
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Human
Match: PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha [Source:HGNC Symbol;Acc:HGNC:9317])

HSP 1 Score: 82.8037 bits (203), Expect = 2.513e-19
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 3
Query:  147 TRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    3 SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 160          
BLAST of Calcineurin B subunit vs. Ensembl Human
Match: PPP3R2 (protein phosphatase 3 regulatory subunit B, beta [Source:HGNC Symbol;Acc:HGNC:9318])

HSP 1 Score: 75.8702 bits (185), Expect = 1.303e-16
Identity = 44/154 (28.57%), Postives = 84/154 (54.55%), Query Frame = 3
Query:  147 TRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEM-VVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKL 602
            + FD+  I  L +RF +LD+   G ++      +P+ ++NPL  ++ID    D    +DF  F+   S F    +EE+KL   F + D D+DGYI+  +++ +L  ++  + ++  + ++ +K +  +D   +G I+FEEF  +  + +I  KL
Sbjct:   16 SHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKL 169          
BLAST of Calcineurin B subunit vs. Ensembl Human
Match: PPP3R2 (protein phosphatase 3 regulatory subunit B, beta [Source:HGNC Symbol;Acc:HGNC:9318])

HSP 1 Score: 75.8702 bits (185), Expect = 1.342e-16
Identity = 44/154 (28.57%), Postives = 84/154 (54.55%), Query Frame = 3
Query:  147 TRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEM-VVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKL 602
            + FD+  I  L +RF +LD+   G ++      +P+ ++NPL  ++ID    D    +DF  F+   S F    +EE+KL   F + D D+DGYI+  +++ +L  ++  + ++  + ++ +K +  +D   +G I+FEEF  +  + +I  KL
Sbjct:   13 SHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKL 166          
BLAST of Calcineurin B subunit vs. Ensembl Celegans
Match: chpf-1 (Calcineurin-like EF-Hand Protein Family member [Source:UniProtKB/TrEMBL;Acc:Q23643])

HSP 1 Score: 75.0998 bits (183), Expect = 1.741e-16
Identity = 56/195 (28.72%), Postives = 94/195 (48.21%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM--------DNRTNIDFNHFVEKLSLFQYNQNEEK--------KLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG   S  L +E+   + + T F+   I  LY RF  LD K +GF++R+   ++P+   NPL D+I+D           +    ++F  FV  L+ FQ     +K        KL   FKM D +++ YI   +   IL+ ++  +  S+ + K+ ++ + E D   +G I+F+EF       DI  K+ I  L+
Sbjct:    1 MGNSSSLMLRDEEIEEIMSETEFNRNQIVRLYSRFLSLDKKGQGFLSRDDFLNVPELAVNPLGDRIVDAFFTLASSNGDNEEQQLNFRQFVRILAHFQPISRVKKNALNSRKDKLLFAFKMYDLNKNDYITREEFKVILNSMVGANITSDQLDKIADRTIEEADADRDGKISFDEFCRAMEKTDIEEKMSIRFLN 195          
BLAST of Calcineurin B subunit vs. Ensembl Celegans
Match: cnb-1 (Protein phosphatase 2B regulatory subunit cnb-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDN6])

HSP 1 Score: 72.0182 bits (175), Expect = 1.202e-15
Identity = 46/171 (26.90%), Postives = 93/171 (54.39%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTN--IDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQIL--DVDNSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIH 611
            +  +  + ++  + FD   +  L +RF +LD+   G ++      +P+ Q NPL  ++ID I D   N  +DF  F++ +S F    ++  KL   F++ D D+DG+I+  +++ +L  ++  ++ +S++  ++ +K +   D   +G I+F+EF   C   D++  LDIH
Sbjct:    1 MGADASLPMEMCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVID-IFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMVGNNLKDSQL-QQIVDKTILFHDKDGDGKISFQEF---C---DVVGTLDIH 163          
BLAST of Calcineurin B subunit vs. Ensembl Celegans
Match: chpf-2 (Calcineurin-like EF-Hand Protein Family member [Source:UniProtKB/TrEMBL;Acc:O16343])

HSP 1 Score: 70.4774 bits (171), Expect = 8.322e-15
Identity = 54/195 (27.69%), Postives = 96/195 (49.23%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-------DNRTN-IDFNHFVEKLSLFQ--------YNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG   S  L++ +   + + T+F+   I  LY RF  LD   +G+++R+   ++P+   NPL D+IID          D+++  + F  FV  L+ FQ           + + KL   FKM D +++ YI   +   IL+ ++  +  S+ + K+ +K + E D   +G I+FE+F       DI  K+ +  L+
Sbjct:    1 MGNSNSSILSDAEMREIMDETQFNKHQILRLYTRFASLDKNGQGYLSRDDFLNVPELAVNPLGDRIIDAFFTLGDSDGDSKSGQLTFRQFVRILAHFQPISKVKDNALNSRKDKLRFAFKMYDLNKNNYITREEFKVILNSMVGANITSDQLDKIADKTLEEADQDRDGKISFEDFCRAMEKTDIEEKMSMRFLN 195          
BLAST of Calcineurin B subunit vs. Ensembl Celegans
Match: cnb-1 (Protein phosphatase 2B regulatory subunit cnb-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDN6])

HSP 1 Score: 67.3958 bits (163), Expect = 6.983e-14
Identity = 43/171 (25.15%), Postives = 92/171 (53.80%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTN--IDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQIL--DVDNSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIH 611
            +  +  + ++  + FD   +  L +RF +LD+   G ++      +P+ Q NPL  ++ID I D   N  +DF  F++ +S F    ++  KL   F++ D D+DG+I+  +++ +L  ++  ++ +S++  ++ +K +   D   +G I+F+EF   C   D++   ++H
Sbjct:    1 MGADASLPMEMCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVID-IFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMVGNNLKDSQL-QQIVDKTILFHDKDGDGKISFQEF---C---DVVEHTEVH 163          
BLAST of Calcineurin B subunit vs. Ensembl Celegans
Match: pbo-1 (pep chromosome:WBcel235:III:2681451:2686463:-1 gene:WBGene00003941.1 transcript:Y71H2AL.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pbo-1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.570e-11
Identity = 58/197 (29.44%), Postives = 90/197 (45.69%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDI-----KNEGFITRNILYDIPDFQNNPLCDKIID------EIMDNRTNIDFNHFVEKLSLFQ-YNQNE-------EKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVL 617
            MG + S Q+ E +   L   +      I  LY RF  L        NE F+T+     I + + NPL D+IID      E+++ R  + F  FV+ LS F+  N+N+       E KL   F M D ++ G I  ++  +IL  ++ V    + V  + ++ M E D   +G+I F+EF       DI  K+    L
Sbjct:    1 MG-QNSSQIPEHELEHLSIESGLSRGGILKLYGRFISLATHRDKTTNEYFLTKGDFQSIAELKQNPLGDRIIDAFFADAEVLERR-KVYFKDFVKVLSHFRPINKNKPHPWNSREAKLRFAFTMYDLNKSGTITKDEFQDILAMMIGVGVPKDQVNSIADRTMREADRDGDGFITFQEFCNAMEKTDIEQKMSFRFL 195          
BLAST of Calcineurin B subunit vs. Ensembl Fly
Match: CanB2 (gene:FBgn0015614 transcript:FBtr0309866)

HSP 1 Score: 80.1073 bits (196), Expect = 1.680e-18
Identity = 47/170 (27.65%), Postives = 89/170 (52.35%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E  + ++  + FD   I  L KRF +LD+ N G ++ +    +P+ Q NPL  ++ID    D    +DF  F++ +S F    ++  KL   F++ D D DGYI+  +++ +L  ++  +     + ++ +K +   D  ++G I+F+EF  +  N DI  K+ + V
Sbjct:    1 MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Fly
Match: CanB2 (gene:FBgn0015614 transcript:FBtr0088930)

HSP 1 Score: 80.1073 bits (196), Expect = 1.680e-18
Identity = 47/170 (27.65%), Postives = 89/170 (52.35%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E  + ++  + FD   I  L KRF +LD+ N G ++ +    +P+ Q NPL  ++ID    D    +DF  F++ +S F    ++  KL   F++ D D DGYI+  +++ +L  ++  +     + ++ +K +   D  ++G I+F+EF  +  N DI  K+ + V
Sbjct:    1 MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Fly
Match: elm (gene:FBgn0037358 transcript:FBtr0334953)

HSP 1 Score: 80.4925 bits (197), Expect = 1.955e-18
Identity = 58/189 (30.69%), Postives = 95/189 (50.26%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM--DNRTNIDFNHFVEKLSLFQYNQ--------NEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSE-MVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG K S  L  E+   ++  T F    I  LY RF  LD  + G ++R  L  IP+   NPLC++I+       N   ++F  F+  L+ F+  +        + E+KL   FKM D D DG I+ +++ +ILH ++  + S+  +V + E+ + E D+   G I+FE+F       D+  K+ I  L+
Sbjct:    1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN 189          
BLAST of Calcineurin B subunit vs. Ensembl Fly
Match: elm (gene:FBgn0037358 transcript:FBtr0078732)

HSP 1 Score: 80.4925 bits (197), Expect = 1.955e-18
Identity = 58/189 (30.69%), Postives = 95/189 (50.26%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM--DNRTNIDFNHFVEKLSLFQYNQ--------NEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSE-MVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG K S  L  E+   ++  T F    I  LY RF  LD  + G ++R  L  IP+   NPLC++I+       N   ++F  F+  L+ F+  +        + E+KL   FKM D D DG I+ +++ +ILH ++  + S+  +V + E+ + E D+   G I+FE+F       D+  K+ I  L+
Sbjct:    1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN 189          
BLAST of Calcineurin B subunit vs. Ensembl Fly
Match: CanB (gene:FBgn0010014 transcript:FBtr0070764)

HSP 1 Score: 78.1814 bits (191), Expect = 9.143e-18
Identity = 47/170 (27.65%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E  + +   + FD   I  L KRF +LD+ N G ++ +    +P+ Q NPL  ++ID    D    +DF  F++ +S F    ++  KL   F++ D D DGYI+  +++ +L  ++  +     + ++ +K +   D  ++G I+F+EF  +  N DI  K+ + V
Sbjct:    1 MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Zebrafish
Match: ppp3r1b (protein phosphatase 3 (formerly 2B), regulatory s1ubunit B, alpha isoform, b [Source:ZFIN;Acc:ZDB-GENE-040912-18])

HSP 1 Score: 83.9593 bits (206), Expect = 7.366e-20
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Zebrafish
Match: ppp3r1a (protein phosphatase 3, regulatory subunit B, alpha a [Source:ZFIN;Acc:ZDB-GENE-081113-3])

HSP 1 Score: 82.8037 bits (203), Expect = 1.744e-19
Identity = 50/170 (29.41%), Postives = 87/170 (51.18%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEMKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Zebrafish
Match: chp1 (calcineurin-like EF-hand protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4086])

HSP 1 Score: 70.4774 bits (171), Expect = 1.450e-14
Identity = 54/194 (27.84%), Postives = 91/194 (46.91%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEK--------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG + S  L EE    +K  T F    I  LY RF+ LD    G ++R     IP+   NPL D+II+    +    ++F  F+  L+ F+  ++ EK              KL   F++ D D+D  I+ +++  +L  ++ V+ S E +  + ++ + E D   +  I+F EF  +    D+  K+ I  LH
Sbjct:    1 MGSRASSLLREEDIEEIKKETGFSHSQITRLYSRFHSLDKGENGGLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPVEDNEKNKDLTGEPLNSRTNKLLFAFRLYDLDRDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADTNGDMCISFNEFTKVLEKVDVEQKMSIRFLH 194          
BLAST of Calcineurin B subunit vs. Ensembl Zebrafish
Match: chp2 (calcineurin-like EF-hand protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5810])

HSP 1 Score: 60.077 bits (144), Expect = 7.768e-11
Identity = 44/160 (27.50%), Postives = 75/160 (46.88%), Query Frame = 3
Query:  135 LKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMD-NRTNIDFNHFVEKLSLF---------QYNQNE-----EKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFK 566
            L   T F    I  LY+RF  LD +  G +       I +   NP+ D+IID      +  +DF+ FV+ L+ F         + N  E       KL   F++ D D+DG I+ +++  +L  +L +    E +  + ++ + E D+  +  I+FEEF+
Sbjct:   18 LMQETGFSPAHIIRLYERFEALDKERRGHLCPQDFGAIKELAMNPIGDRIIDAFFSPGKDTVDFHTFVKILAHFRPVDKDRPKEPNSPEPINSRSNKLKFAFQLYDQDKDGKISRDELLKVLRDMLGLQVTEEQLESIADRTIQEADLDRDDAISFEEFR 177          
BLAST of Calcineurin B subunit vs. Ensembl Zebrafish
Match: chp2 (calcineurin-like EF-hand protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5810])

HSP 1 Score: 60.077 bits (144), Expect = 7.768e-11
Identity = 44/160 (27.50%), Postives = 75/160 (46.88%), Query Frame = 3
Query:  135 LKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMD-NRTNIDFNHFVEKLSLF---------QYNQNE-----EKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFK 566
            L   T F    I  LY+RF  LD +  G +       I +   NP+ D+IID      +  +DF+ FV+ L+ F         + N  E       KL   F++ D D+DG I+ +++  +L  +L +    E +  + ++ + E D+  +  I+FEEF+
Sbjct:   18 LMQETGFSPAHIIRLYERFEALDKERRGHLCPQDFGAIKELAMNPIGDRIIDAFFSPGKDTVDFHTFVKILAHFRPVDKDRPKEPNSPEPINSRSNKLKFAFQLYDQDKDGKISRDELLKVLRDMLGLQVTEEQLESIADRTIQEADLDRDDAISFEEFR 177          
BLAST of Calcineurin B subunit vs. Ensembl Xenopus
Match: hspe1 (heat shock protein family E (Hsp10) member 1 [Source:Xenbase;Acc:XB-GENE-963412])

HSP 1 Score: 83.9593 bits (206), Expect = 1.050e-19
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Xenopus
Match: hspe1 (heat shock protein family E (Hsp10) member 1 [Source:Xenbase;Acc:XB-GENE-963412])

HSP 1 Score: 77.7962 bits (190), Expect = 4.569e-16
Identity = 48/164 (29.27%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  129 IMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEF----KLICLNQDILPKL 602
            +  K     D   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF     L+C+    LP +
Sbjct:   35 VCRKQKPSIDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVSMLVCVAH--LPSI 196          
BLAST of Calcineurin B subunit vs. Ensembl Xenopus
Match: chp1 (calcineurin-like EF-hand protein 1 [Source:NCBI gene;Acc:448152])

HSP 1 Score: 67.781 bits (164), Expect = 2.023e-13
Identity = 51/193 (26.42%), Postives = 89/193 (46.11%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEK-------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG + S  L +E+   +K  T F    I  LY RF  LD    G ++R     IP+   NPL D+II+    +    ++F  F+  L+ F+  ++  K             KL   F++ D D+D  I+  ++  +L  ++ V+ S + +  + ++ + E D   +  I+F EF  +    D+  K+ I  LH
Sbjct:    1 MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFTEGEDQVNFRGFMRTLAHFRPIEDNSKDANSQEPLNSRSNKLLFAFRLYDLDKDDKISREELLQVLRMMVGVNISDDQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH 193          
BLAST of Calcineurin B subunit vs. Ensembl Xenopus
Match: chp1 (calcineurin-like EF-hand protein 1 [Source:NCBI gene;Acc:448152])

HSP 1 Score: 61.6178 bits (148), Expect = 2.424e-11
Identity = 43/166 (25.90%), Postives = 77/166 (46.39%), Query Frame = 3
Query:  168 ICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEK-------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            I  LY RF  LD    G ++R     IP+   NPL D+II+    +    ++F  F+  L+ F+  ++  K             KL   F++ D D+D  I+  ++  +L  ++ V+ S + +  + ++ + E D   +  I+F EF  +    D+  K+ I  LH
Sbjct:   17 ITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFTEGEDQVNFRGFMRTLAHFRPIEDNSKDANSQEPLNSRSNKLLFAFRLYDLDKDDKISREELLQVLRMMVGVNISDDQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH 182          
BLAST of Calcineurin B subunit vs. Ensembl Xenopus
Match: cib2 (calcium and integrin binding family member 2 [Source:NCBI gene;Acc:780271])

HSP 1 Score: 53.5286 bits (127), Expect = 2.836e-8
Identity = 51/192 (26.56%), Postives = 87/192 (45.31%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNEL-------------DIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEMVVKMT-EKIMSEIDMTDNGYINFEEFK-LICLNQDILPKLDIHV 614
            MG KQ+    +EQ    ++ T F  K I  L+ RF EL             D+K    +   ++ ++P+   NP  ++I+     D   N+ FN FV+  S+       E K    FK+ D + D +I  +D+   L+++   +  E  V +  EK++ E DM  +G + F +F+ +I    D L    I +
Sbjct:    1 MGNKQTI-FTDEQLDAYQDCTFFTRKEILRLHGRFYELAPNIVPMDYTDDPDVK----LPMQLIINMPELVENPFKERIVQSFSEDGEGNLSFNDFVDMFSVMSEMAPRELKAIYAFKIYDFNTDNFICKSDLEKTLNKLTREELEEEEVNLVCEKVIEEADMDGDGKLAFADFENMISKAPDFLSTFHIRI 187          
BLAST of Calcineurin B subunit vs. Ensembl Mouse
Match: Ppp3r1 (protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) [Source:MGI Symbol;Acc:MGI:107172])

HSP 1 Score: 83.9593 bits (206), Expect = 7.949e-20
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Mouse
Match: Ppp3r2 (protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type II) [Source:MGI Symbol;Acc:MGI:107171])

HSP 1 Score: 74.7146 bits (182), Expect = 2.721e-16
Identity = 46/158 (29.11%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  153 FDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEM-VVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            FD + I  L K F +LD+   G ++      +P+ Q NPL  ++ID    D    +DF+ F+   S F    +EE+KL   F++ D D DG+I+  +++ +L  ++  +  +  + ++ +K +  +D   +G I+FEEF  +    +I  KL + V H
Sbjct:   15 FDQEEIRRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGRVIDIFDTDGNGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVVKTMEIHKKLVVFVEH 172          
BLAST of Calcineurin B subunit vs. Ensembl Mouse
Match: Chp1 (calcineurin-like EF hand protein 1 [Source:MGI Symbol;Acc:MGI:1927185])

HSP 1 Score: 73.9442 bits (180), Expect = 7.226e-16
Identity = 53/195 (27.18%), Postives = 91/195 (46.67%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEK---------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG + S  L +E+   +K  T F    I  LY RF  LD    G ++R     IP+   NPL D+II+    +    ++F  F+  L+ F+  ++ EK               KL   F++ D D+D  I+ +++  +L  ++ V+ S E +  + ++ + E D   +  I+F EF  +    D+  K+ I  LH
Sbjct:    1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH 195          
BLAST of Calcineurin B subunit vs. Ensembl Mouse
Match: Chp1 (calcineurin-like EF hand protein 1 [Source:MGI Symbol;Acc:MGI:1927185])

HSP 1 Score: 70.4774 bits (171), Expect = 1.422e-14
Identity = 49/180 (27.22%), Postives = 85/180 (47.22%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEK---------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLIC 575
            MG + S  L +E+   +K  T F    I  LY RF  LD    G ++R     IP+   NPL D+II+    +    ++F  F+  L+ F+  ++ EK               KL   F++ D D+D  I+ +++  +L  ++ V+ S E +  + ++ + E D   +  I+F EF  +C
Sbjct:    1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVC 180          
BLAST of Calcineurin B subunit vs. Ensembl Mouse
Match: Chp2 (calcineurin-like EF hand protein 2 [Source:MGI Symbol;Acc:MGI:1917511])

HSP 1 Score: 67.781 bits (164), Expect = 1.384e-13
Identity = 49/179 (27.37%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  135 LKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRT-NIDFNHFVEKLSLFQYNQNEEK----------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVL 617
            ++  T F   ++  LY RF  LD   +GF++R  L  I     NPL D+IID    N +  + F  F   L+ F+    E+                 KL   F++ D D+DG I+ N++  +L  ++ V    E +  +T++ + E D   +G ++F EF       +I  K+ I +L
Sbjct:   17 IRRETGFSQASLLRLYHRFQALDRDEKGFLSRLDLQQIGALAVNPLGDRIIDSFFPNGSQRLYFAGFARVLAYFRPIDEEDATLRDPKQPEPLNSRMNKLRFAFQLYDLDRDGKISRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEFTKSLEKMNIEQKMSIRIL 195          
BLAST of Calcineurin B subunit vs. UniProt/SwissProt
Match: sp|Q9UU93|CANB_SCHPO (Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnb1 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.164e-20
Identity = 55/176 (31.25%), Postives = 95/176 (53.98%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDK---IIDEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSE-MVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKL 602
            MG  QS+   +     L + + F ++ I  + KRF ++D    G I RN    IP   +NPL  +   ++DE  D   ++DF  F+  LS+F  + N+E+KL   FK+ D D+DGYI+  ++Y +L  ++  +  E  + ++ +K + E+D   +G I+FEEFK I    ++   +
Sbjct:    1 MGQSQSQIFED-----LISNSSFSNEEIERIRKRFIKIDANQSGSIDRNEFLSIPSVASNPLASRLFSVVDE--DGGGDVDFQEFINSLSVFSVHGNKEEKLKFAFKIYDIDRDGYISNGELYLVLKMMVGTNLREDQLQQIVDKTIMEVDKDRDGKISFEEFKDIVSGSNVTSSM 169          
BLAST of Calcineurin B subunit vs. UniProt/SwissProt
Match: sp|P0CM54|CANB_CRYNJ (Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNB1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.557e-19
Identity = 55/181 (30.39%), Postives = 91/181 (50.28%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKII---DEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVL 617
            MG  +S   N      L+  + F    +  L KRF +LD    G I ++    IP   NNPL  ++I   DE  D    +DF  FV  LS F      ++KL   FK+ D D+DGYI+  ++Y +L Q++  +   + + ++ +K + E D   +G ++FEEF  +  + DI+ ++ +  L
Sbjct:    1 MGAAESSMFNS-----LEKNSNFSGPELMRLKKRFMKLDKDGSGSIDKDEFLQIPQIANNPLAHRMIAIFDE--DGSGTVDFQEFVGGLSAFSSKGGRDEKLRFAFKVYDMDRDGYISNGELYLVLKQMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFTQMVASTDIVKQMTLEDL 174          
BLAST of Calcineurin B subunit vs. UniProt/SwissProt
Match: sp|P0CM55|CANB_CRYNB (Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CNB1 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.557e-19
Identity = 55/181 (30.39%), Postives = 91/181 (50.28%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKII---DEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVL 617
            MG  +S   N      L+  + F    +  L KRF +LD    G I ++    IP   NNPL  ++I   DE  D    +DF  FV  LS F      ++KL   FK+ D D+DGYI+  ++Y +L Q++  +   + + ++ +K + E D   +G ++FEEF  +  + DI+ ++ +  L
Sbjct:    1 MGAAESSMFNS-----LEKNSNFSGPELMRLKKRFMKLDKDGSGSIDKDEFLQIPQIANNPLAHRMIAIFDE--DGSGTVDFQEFVGGLSAFSSKGGRDEKLRFAFKVYDMDRDGYISNGELYLVLKQMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFTQMVASTDIVKQMTLEDL 174          
BLAST of Calcineurin B subunit vs. UniProt/SwissProt
Match: sp|P87072|CANB_NEUCR (Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=cnb-1 PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 2.801e-19
Identity = 51/150 (34.00%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  153 FDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKII---DEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDI 590
            FD + +  L KRF +LD  N G I R     +P    NPL  ++I   DE  D   ++DF  FV  LS F    N+E+KL   FK+ D D+DGYI+  +++ +L  ++  +   + + ++ +K + E D+  +G I+FEEF  +  N D+
Sbjct:   18 FDREEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISTNPLATRMIAIFDE--DGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLKMMVGSNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDV 165          
BLAST of Calcineurin B subunit vs. UniProt/SwissProt
Match: sp|P42322|CANB1_NAEGR (Calcineurin subunit B OS=Naegleria gruberi OX=5762 GN=CNB1 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.514e-19
Identity = 60/180 (33.33%), Postives = 96/180 (53.33%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKII---DEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEM-VVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            MG   S    EE + M K T  F  K I  LYKRF +LD    G I+++    IP+   NPL  ++I   DE  D   N  F  F+  LS+F    ++++KL   FK+ D D DGYI+  +++ +L  ++  + S++ + ++ +K + E D   +G I+FEEF     +QD+  K+ I +
Sbjct:    1 MGTNTSSLRPEEVEEMQKGTN-FTQKEIKKLYKRFKKLDKDGNGTISKDEFLMIPELAVNPLVKRVISIFDENGDGSVN--FKEFIAALSVFNAQGDKQRKLEFAFKVYDIDGDGYISNGELFTVLKMMVGNNLSDVQLQQIVDKTILEADEDGDGKISFEEFAKTLSHQDLENKMTIRL 177          
BLAST of Calcineurin B subunit vs. TrEMBL
Match: A0A0M9FY65 (Calcineurin b subunit (CNB) OS=Leptomonas pyrrhocoris OX=157538 GN=ABB37_06498 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.877e-23
Identity = 57/169 (33.73%), Postives = 93/169 (55.03%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEM-VVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIH 611
            L+ E+   ++ +T   D  I  LYKRF +L+    G ITR     IP   +NPL D+++  +  D  + +DF  FV  LS+     ++E KL   FKM D D DG I+  D++  L  ++ V+ S+M + ++ +K   E D+  +GYI FE+F  + +N D   +L++H
Sbjct:    6 LSAEELQSIRESTALTDAQIHRLYKRFAKLNKDRSGEITREEFNSIPALASNPLVDRVLAVMDTDGDSTVDFGEFVRALSVLSSATSKEDKLRFTFKMYDIDGDGRISNKDLFQTLSIMVGVNLSQMQLQQIVDKTFIEADVDRDGYITFEDFSALAVNSDFGDRLNLH 174          
BLAST of Calcineurin B subunit vs. TrEMBL
Match: A0A0N0P419 (Putative calcineurin B subunit OS=Leptomonas seymouri OX=5684 GN=ABL78_6169 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.120e-23
Identity = 58/169 (34.32%), Postives = 93/169 (55.03%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEM-VVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIH 611
            L+ E+   ++ +T   D  I  LYKRF +L+    G ITR     IP   +NPL D+++  +  D  + +DF  FV  LS+     ++E KL   FKM D D DG I+  D++  L  ++ V+ S+M + ++ +K   E D+  +GYI FEEF  + +N D   +L++H
Sbjct:    6 LSAEELQDIRESTALTDAQIQRLYKRFVKLNKDKSGRITREEFNSIPALASNPLVDRVLAVMDTDGDSTVDFGEFVRALSVLSSATSKEDKLRFTFKMYDIDGDGRISNKDLFQTLSIMVGVNLSQMQLQQIVDKTFIEADVDRDGYITFEEFSALAVNSDFGDRLNLH 174          
BLAST of Calcineurin B subunit vs. TrEMBL
Match: E9AVF8 (Putative calcineurin B subunit OS=Leishmania mexicana (strain MHOM/GT/2001/U1103) OX=929439 GN=LMXM_21_1630 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.407e-22
Identity = 55/169 (32.54%), Postives = 93/169 (55.03%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEM-VVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIH 611
            L  E+   ++ +T   D  +  LYK F+ L+    G ITR     IP   +NPL D+++  +  D  + +DF  FV  L++     ++E KL   FKM D D DG I+  D++ +L  ++ V+ S+M + ++ +K   E D+  +GYI FEEF+ + +N D   +L++H
Sbjct:    6 LTAEELQYIRESTALTDAQVQRLYKSFSRLNKDKSGKITRAEFNSIPALASNPLVDRVLAVMDTDGDSTVDFGDFVRALAVLSSATSKEDKLRFTFKMYDIDGDGRISNRDLFQMLSIMVGVNLSQMQLQQIVDKTFIEADVDRDGYITFEEFEALAVNSDFGDRLNLH 174          
BLAST of Calcineurin B subunit vs. TrEMBL
Match: A0A0R3W1V2 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3741 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.601e-22
Identity = 61/187 (32.62%), Postives = 96/187 (51.34%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTNIDFNHFVEKLSLF---------QYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVL 617
            MG   SK L+ E+   +   T F  K I  LY R+  LD    G++ R     IP+   NPL D+II+E       ++F  F++K++ F         +YN N E KL  LF M D D D  I+ +++ ++L  ++    + E + ++ E+ M+E D+  +GYI ++EFK      DI  K+ IH L
Sbjct:    1 MGGGSSKILDPEEVAEISAETGFSAKQIHRLYNRYTTLDRSKAGYLKRQDFLLIPELAINPLGDRIINEFFKGGEELNFREFMQKVARFRKPNSSGVTEYN-NREAKLRFLFGMYDLDVDNRISRSELLSVLQMMVGASVTMEQINRIGERTMAEADVDGDGYITYDEFKAAVEGVDIENKMSIHFL 186          
BLAST of Calcineurin B subunit vs. TrEMBL
Match: A0A068Y4M5 (Calcium binding protein p22 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000447500 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.717e-22
Identity = 61/187 (32.62%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTNIDFNHFVEKLSLF---------QYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVL 617
            MG   SK L+ E+   +   T F  K I  LY R+  LD    G++ R     IP+   NPL D+II+E       ++F  F++K++ F         +YN N E KL  LF M D D D  I+ +++ ++L  ++    + E + ++ E+ M+E D+  +GYI ++EFK    + DI  K+ IH L
Sbjct:    1 MGGGSSKILDPEEVAEISAETGFSAKQIHRLYNRYTTLDRSKAGYLKRQDFLLIPELAINPLGDRIINEFFKGGEELNFREFMQKVARFRKPNSSGVTEYN-NREAKLRFLFGMYDLDVDNRISRSELLSVLQMMVGASVTMEQINRIGERTMAEADVDGDGYITYDEFKAAVESVDIENKMSIHFL 186          
BLAST of Calcineurin B subunit vs. Ensembl Cavefish
Match: ppp3r1a (calcineurin subunit B type 1 [Source:NCBI gene;Acc:103037384])

HSP 1 Score: 83.9593 bits (206), Expect = 5.502e-20
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFQEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Cavefish
Match: ENSAMXT00000038285.1 (calcineurin subunit B type 1 [Source:NCBI gene;Acc:103042847])

HSP 1 Score: 83.9593 bits (206), Expect = 6.242e-20
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Cavefish
Match: ENSAMXT00000049698.1 (calcineurin subunit B type 1 [Source:NCBI gene;Acc:103042847])

HSP 1 Score: 82.0333 bits (201), Expect = 3.411e-19
Identity = 49/162 (30.25%), Postives = 85/162 (52.47%), Query Frame = 3
Query:  135 LKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            L   + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    7 LYPPSLFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 168          
BLAST of Calcineurin B subunit vs. Ensembl Cavefish
Match: ENSAMXT00000045317.1 (calcineurin subunit B type 1 [Source:NCBI gene;Acc:103042847])

HSP 1 Score: 80.1073 bits (196), Expect = 1.512e-18
Identity = 47/155 (30.32%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  156 DDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            D   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:   14 DADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 168          
BLAST of Calcineurin B subunit vs. Ensembl Cavefish
Match: chp1 (calcineurin like EF-hand protein 1 [Source:NCBI gene;Acc:103021582])

HSP 1 Score: 70.8626 bits (172), Expect = 9.510e-15
Identity = 54/194 (27.84%), Postives = 91/194 (46.91%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEK--------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG + S  L EE    +K  T F    I  LY RF+ LD    G ++R     IP+   NPL D+II+    +    ++F  F+  L+ F+  ++ EK              KL   F++ D D+D  I+ +++  +L  ++ V+ S E +  + ++ + E D   +  I+F EF  +    D+  K+ I  LH
Sbjct:    1 MGSRASSLLREEDIEEIKKETGFSHSQITRLYSRFHSLDKGENGALSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPVEDNEKNKDPTAEPLNSRNNKLLFAFRLYDLDRDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADTNGDMSISFSEFIKVLEKVDVEQKMSIRFLH 194          
BLAST of Calcineurin B subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009304.1 (pep scaffold:Pmarinus_7.0:GL479988:26077:30241:1 gene:ENSPMAG00000008415.1 transcript:ENSPMAT00000009304.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 1.901e-19
Identity = 47/158 (29.75%), Postives = 84/158 (53.16%), Query Frame = 3
Query:  147 TRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            T FD   I  L KRF +LD+ N G ++ +    +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++++KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    D   K+ + V
Sbjct:   13 THFDADEIKRLGKRFRKLDLDNSGSLSVDEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKDQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTILNADKDGDGRISFEEFCAVVGGLDFHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000781.1 (pep scaffold:Pmarinus_7.0:GL476952:2198:8857:1 gene:ENSPMAG00000000709.1 transcript:ENSPMAT00000000781.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 1.422e-17
Identity = 47/167 (28.14%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  120 EQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            E    L+  + FD   I  L KRF +LD+   G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   +   + D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    4 ESSYPLEMCSHFDADEIKRLGKRFRKLDLDGSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRCKYSSCNMDRDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCEVVGGMDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004125.1 (pep scaffold:Pmarinus_7.0:GL483005:7747:12994:-1 gene:ENSPMAG00000003768.1 transcript:ENSPMAT00000004125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 4.460e-16
Identity = 36/131 (27.48%), Postives = 73/131 (55.73%), Query Frame = 3
Query:  177 LYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEF 563
            L  RF++LD+ + G ++ +    +P+  NNPL  +++D +  D    +DF  F+E +S F  N  +E+KL   F++ D D+DG+I   +++ +L  ++  +     + ++ +K +   D   +G ++F EF
Sbjct:   17 LSARFHKLDLDSSGALSADEFLSLPELHNNPLVRRVVDILDSDGDGEVDFAEFIEGISRFTINGTKEEKLKFAFQIYDVDRDGFITNGELFGVLKTMVGRNLRDPQLQQIVDKSIISADADGDGKVSFPEF 147          
BLAST of Calcineurin B subunit vs. Ensembl Sea Lamprey
Match: chp2 (calcineurin-like EF-hand protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5810])

HSP 1 Score: 63.929 bits (154), Expect = 5.007e-13
Identity = 50/194 (25.77%), Postives = 89/194 (45.88%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQ--------------YNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG + S  L +E+   +K  T F    I  LY RF  LD    G ++R     IP+   NPL D+II+    +    ++F  F+  L+ F+                 +   KL   F++ D D+D  I+ +++  +L  ++ V+ S E +  + ++ + E D   +  I+F EF+ +    D+  K+ I  L+
Sbjct:    1 MGSRASSLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPVDTVKEKDPNAPAALNSRASKLKFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDNAISFTEFQKVLEKVDVEQKMSIRFLN 194          
BLAST of Calcineurin B subunit vs. Ensembl Sea Lamprey
Match: chp1 (calcineurin-like EF-hand protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4086])

HSP 1 Score: 60.8474 bits (146), Expect = 5.235e-12
Identity = 45/165 (27.27%), Postives = 78/165 (47.27%), Query Frame = 3
Query:  168 ICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDE-IMDNRTNIDFNHFVEKLSLFQ---YNQNEEK---------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            I  LY RF  LD    G ++R     IP+   NPL D+I++   +     ++F  F+  L+ F+     +N E          KL   FK+ D D D  I+  ++ ++L  ++ V+ S E +  + ++ + E D   +  I+F EF+ +    D+  K+ I  LH
Sbjct:    3 ITRLYSRFTSLDKGENGTLSREDFLRIPELAINPLGDRIVNAFFIYGEDQVNFRRFMATLAHFRPMDGQKNGEANEALNSRSNKLKFAFKLYDLDNDDKISRQELLHVLRMMVGVNISDEQLGSIADRTIQEADQDGDNAISFTEFEKVLEKVDVEQKMSIRFLH 167          
BLAST of Calcineurin B subunit vs. Ensembl Yeast
Match: CNB1 (Calcineurin B; regulatory subunit of calcineurin, a Ca++/calmodulin-regulated type 2B protein phosphatase which regulates Crz1p (stress-response transcription factor); other calcineurin subunit encoded by CNA1 and/or CMP1; regulates function of Aly1p alpha-arrestin; myristoylation by Nmt1p reduces calcineurin activity in response to submaximal Ca signals, is needed to prevent constitutive phosphatase activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001673])

HSP 1 Score: 78.9518 bits (193), Expect = 7.165e-19
Identity = 51/162 (31.48%), Postives = 89/162 (54.94%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFK 566
            MG   SK ++      L   T FD   I  L KRF +LD  + G I +N    IP   +NPL  +I++    DN  ++DF  F+  LS+F    ++++KL   FK+ D D+DG+I+  +++ +L  ++  + + E + ++ ++ + E D   +G ++FEEFK
Sbjct:    1 MGAAPSKIVDG-----LLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGRIMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDKDGFISNGELFIVLKIMVGSNLDDEQLQQIVDRTIVENDSDGDGRLSFEEFK 157          
BLAST of Calcineurin B subunit vs. Ensembl Yeast
Match: FRQ1 (N-myristoylated calcium-binding protein; may have a role in intracellular signaling through its regulation of the phosphatidylinositol 4-kinase Pik1p; member of the recoverin/frequenin branch of the EF-hand superfamily; human NCS1 functionally complements the heat sensitivity of a frq1 ts mutant [Source:SGD;Acc:S000002781])

HSP 1 Score: 44.2838 bits (103), Expect = 3.140e-6
Identity = 50/176 (28.41%), Postives = 80/176 (45.45%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRF----NELDIKNEGFIT---RNILYDIP-DFQNNPLCDKIIDEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYIN-------TNDVYNILHQILDVDNSEMVVKM-TEKIMSEIDMTDNGYINFEEFK 566
            MG K SK L+++    LK +T FD + I   +K F        +  E F+    +   +  P DF N+     + D+  DN   I F  F+  LS       EEK L   F++ D + DGYI           VY ++  ++ ++  E   +M  +KI   +D  ++GYI  +EF+
Sbjct:    1 MGAKTSK-LSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVKIYKQFFPFGSPEDFANHLFT--VFDK--DNNGFIHFEEFITVLSTTSRGTLEEK-LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVKKIFKLMDKNEDGYITLDEFR 170          
BLAST of Calcineurin B subunit vs. Ensembl Nematostella
Match: EDO40303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7U9])

HSP 1 Score: 94.3597 bits (233), Expect = 4.484e-24
Identity = 64/192 (33.33%), Postives = 97/192 (50.52%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTNI------DFNHFVEKLSLFQ----YNQN----EEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVL 617
            MGLK S  L EE    ++  T F  K I  LY RF+ LD  N+G +TR     IP+   NPL D+I+D    N+         +F  FV  L+ F+    ++ N     E+KL   F++ D D DGYI+  D+  ILH ++ V  S E +  + ++ +S+ D   +  I+F E K +  + D+  K+ I  L
Sbjct:    1 MGLKSSSLLQEEDLAEIQRETGFSPKQISRLYSRFSNLDKANQGTLTREDFLRIPELAINPLGDRIVDAFFMNQEEAGLQEQCNFKQFVRTLAHFRPFHGHSPNPLNTREEKLKFAFRIYDIDSDGYISKTDLIAILHMMVGVTISDEHLTGIADRAISDADTDGDKLISFAELKKVMEDVDLNAKMSIRFL 192          
BLAST of Calcineurin B subunit vs. Ensembl Nematostella
Match: EDO48535 (Predicted protein; Protein phosphatase 3 (Formerly 2B), regulatory subunit B [Source:UniProtKB/TrEMBL;Acc:A7RJ82])

HSP 1 Score: 80.1073 bits (196), Expect = 6.483e-19
Identity = 49/159 (30.82%), Postives = 81/159 (50.94%), Query Frame = 3
Query:  144 TTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSE-MVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
             T FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++I     D    +DF  F+E +S F    ++E KL   F++ D D DGYI+  +++ +L  ++  +  E  + ++ +K +   D   +G I F EF  I  N D+  K+ + V
Sbjct:   12 VTHFDADEIRRLGKRFRKLDLDNSGSLSVEEFMSLPELQQNPLVQRVITIFDADGNGEVDFKEFIEGVSQFSVKGDKESKLKFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKETQLQQIVDKTILNADKDGDGKICFSEFCAIVGNMDVHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Nematostella
Match: EDO47515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM01])

HSP 1 Score: 56.225 bits (134), Expect = 4.745e-10
Identity = 50/174 (28.74%), Postives = 84/174 (48.28%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDI------KNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNR-TNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNIL-----HQILDVDNSEMVVKMTEKIMSEIDMTDNGYINFEEFKLI 572
            MG   S Q  E++    +  T F  K I   +KRF +LD       KN     R IL  +P+ + NP  D+I      ++  ++ F  F++ +S+F  N  +  K+   F++ D ++D YI  ND+  ++      Q L  DN +    M EKI  E D+ ++  ++F EF+ +
Sbjct:    1 MGASHS-QFTEDELKDYQELTYFTQKEILHCFKRFMQLDPEAVRLNKNAKLSQRKIL-TLPELKVNPFRDRICKVFSSSKDGSLTFEDFLDMMSVFSENAPKSVKVEYAFRIYDFNEDDYICENDLKKVIMRLCGEQRLSDDNMQ---AMIEKIFEEADLDEDNQLSFAEFEHV 169          
BLAST of Calcineurin B subunit vs. Ensembl Nematostella
Match: EDO36724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHW4])

HSP 1 Score: 46.9802 bits (110), Expect = 1.143e-6
Identity = 39/163 (23.93%), Postives = 74/163 (45.40%), Query Frame = 3
Query:  114 NEEQKIMLKNTTRFDDKTICSLYKRFNEL----------DIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTN-IDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEMVVK-MTEKIMSEIDMTDNGYINFEEFK 566
             EEQ    ++ T F    I  ++KR+  L          +++ +  +    L  +P+ + NP   +I      N +  + F+ F+  +S+   +   E K+   FK+ D D D  +   D+   +  +   D  E  V+ + E ++SE D+ + GY+NF EF+
Sbjct:    9 TEEQLEDYQDCTFFTRADILRIHKRYRALHPVLIPDDYKELETQPLLKMRHLLKLPELKENPFKCRICQVFSVNGSGALTFDDFLNMMSVLSDSAPRELKVKYAFKIFDFDGDQKLGPTDLAQTVLSVTGGDLKEDEVQFVVESLLSEADIDETGYLNFLEFE 171          
BLAST of Calcineurin B subunit vs. Ensembl Nematostella
Match: EDO26502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBV1])

HSP 1 Score: 44.2838 bits (103), Expect = 8.605e-6
Identity = 39/152 (25.66%), Postives = 76/152 (50.00%), Query Frame = 3
Query:  135 LKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDI--PDFQNNPLCDKIIDEIMDNRTN--IDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEMVV-KMTEKIMSEIDMTDNGYINFEEFKLIC 575
            L++ + FD   I ++ ++F  L  ++ G ITR +      P  Q + L  + + +  D+  +  ID   F++ LS+     ++E+K+   FK  D ++ GYI   ++  +     +V  S+  + +M E + +  D   NG I++EEFK+  
Sbjct:    5 LQDKSHFDQVEIEAIIEQFKTLATEDLG-ITREVFDQCLGPLGQQSNLVMEQMFKFYDSNGDNIIDLEEFIQALSIL-VKGSQEEKIPHAFKGYDTEKKGYITKENLRQMFKAYFNVTMSQDAIDEMVEHVFAYADADKNGEISYEEFKVWA 154          
BLAST of Calcineurin B subunit vs. Ensembl Medaka
Match: ENSORLT00000002911.2 (protein phosphatase 3 regulatory subunit B, alpha [Source:NCBI gene;Acc:101161991])

HSP 1 Score: 83.9593 bits (206), Expect = 6.204e-20
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E    L+  + FD   I  L KRF +LD+ N G ++      +P+ Q NPL  ++ID    D    +DF  F+E +S F    ++E+KL   F++ D D+DGYI+  +++ +L  ++  +     + ++ +K +   D   +G I+FEEF  +    DI  K+ + V
Sbjct:    1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170          
BLAST of Calcineurin B subunit vs. Ensembl Medaka
Match: chp1 (calcineurin like EF-hand protein 1 [Source:NCBI gene;Acc:101163622])

HSP 1 Score: 73.1738 bits (178), Expect = 1.172e-15
Identity = 56/195 (28.72%), Postives = 92/195 (47.18%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQYNQNEEK---------------KLFILFKMNDHDQDGYINTNDVYNILHQILDVDNS-EMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MG + S  L EE+   +K  T F    I  LY RF  LD    G ++R     IP+   NPL D+II+    D    ++F  F+  L+ F+  ++ EK               KL   F++ D D+D  I+ +++  +L  ++ V+ S E +  + ++ + E D   +G I+F EF  +    D+  K+ I  LH
Sbjct:    1 MGSRASTLLREEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPDGEDQVNFRGFMRTLAHFRPVEDNEKNKNLSNTEPLNSRTNKLHFAFQLYDLDRDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADTNGDGCISFTEFIKVLEKVDVEQKMSIRFLH 195          
BLAST of Calcineurin B subunit vs. Ensembl Medaka
Match: ENSORLT00000002912.2 (calcineurin subunit B type 1-like [Source:NCBI gene;Acc:101168674])

HSP 1 Score: 58.151 bits (139), Expect = 2.247e-10
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  201 DIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNIL 455
            D+   G ++      +P+ Q NPL  ++ID    D    IDF  F+E +S F    + E+KL   F++ D D+DG+I+  +++ +L
Sbjct:   29 DLDGSGSLSVGEFMSLPELQQNPLVPRVIDIFDTDGDGEIDFREFMEGISQFSVGGSREQKLQFAFRIYDVDKDGFISNGELFQVL 114          
BLAST of Calcineurin B subunit vs. Ensembl Medaka
Match: ENSORLT00000043316.1 (calcineurin subunit B type 1-like [Source:NCBI gene;Acc:101168674])

HSP 1 Score: 58.5362 bits (140), Expect = 2.307e-10
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  201 DIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNIL 455
            D+   G ++      +P+ Q NPL  ++ID    D    IDF  F+E +S F    + E+KL   F++ D D+DG+I+  +++ +L
Sbjct:   44 DLDGSGSLSVGEFMSLPELQQNPLVPRVIDIFDTDGDGEIDFREFMEGISQFSVGGSREQKLQFAFRIYDVDKDGFISNGELFQVL 129          
BLAST of Calcineurin B subunit vs. Ensembl Medaka
Match: ENSORLT00000043908.1 (calcineurin subunit B type 1-like [Source:NCBI gene;Acc:101168674])

HSP 1 Score: 58.151 bits (139), Expect = 2.770e-10
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  201 DIKNEGFITRNILYDIPDFQNNPLCDKIIDEI-MDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNIL 455
            D+   G ++      +P+ Q NPL  ++ID    D    IDF  F+E +S F    + E+KL   F++ D D+DG+I+  +++ +L
Sbjct:   38 DLDGSGSLSVGEFMSLPELQQNPLVPRVIDIFDTDGDGEIDFREFMEGISQFSVGGSREQKLQFAFRIYDVDKDGFISNGELFQVL 123          
BLAST of Calcineurin B subunit vs. Planmine SMEST
Match: SMESG000077376.1 (SMESG000077376.1)

HSP 1 Score: 354.755 bits (909), Expect = 2.606e-126
Identity = 178/178 (100.00%), Postives = 178/178 (100.00%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH
Sbjct:    1 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 178          
BLAST of Calcineurin B subunit vs. Planmine SMEST
Match: SMESG000081409.1 (SMESG000081409.1)

HSP 1 Score: 83.9593 bits (206), Expect = 4.126e-20
Identity = 50/171 (29.24%), Postives = 93/171 (54.39%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTN--IDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDNSE-MVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E  + ++  + FD + I  L KRF +LD+   G ++ +    +P  Q NPL  ++I EI D+ +N  +DF  F+E +S F    N+E KL   FK+ D D+DG+I+  +++ +L  ++  +  E  + ++ +K +   D   +G I++EEF  +    D+  K+ + V
Sbjct:    1 MGNESSLPVEMCSTFDQEEIRRLGKRFKKLDLDGSGSLSVDEFMSLPQLQQNPLVQRVI-EIFDSDSNGEVDFKEFIEGMSQFSVKGNKESKLKFAFKIYDIDRDGFISNGELFQVLKMMVGNNLKETQLQQIVDKTIMFADKDGDGKISYEEFCAVVSGMDVHSKMVVDV 170          
BLAST of Calcineurin B subunit vs. Planmine SMEST
Match: SMESG000018297.1 (SMESG000018297.1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.900e-19
Identity = 55/166 (33.13%), Postives = 89/166 (53.61%), Query Frame = 3
Query:  147 TRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTN-IDFNHFVEKLSLFQ------YNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHVLH 620
            T F DK I  LY RF  LD ++ G++TR     IP+   NPL D+I+ E   N  + ++F  FV KL++F+         + E KL  LF + D D+D  I+  ++  +L  ++  +  SE +  + E+ M+E D+ ++GYI++ EF+      DI  K+ I  L 
Sbjct:   21 TGFSDKQIRRLYNRFVALDKEDNGYLTRQTFLLIPELAINPLGDRIVHEFFKNNVDELNFKDFVHKLAIFRKTSVDSTKSSRELKLKFLFDLYDLDKDEKISLEELMGMLQMMVGENITSEQMNNIGERTMAEADLDNDGYISYGEFEKAFEGIDIEQKVSIKFLE 186          
BLAST of Calcineurin B subunit vs. Planmine SMEST
Match: SMESG000019278.1 (SMESG000019278.1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.188e-17
Identity = 48/172 (27.91%), Postives = 91/172 (52.91%), Query Frame = 3
Query:  111 LNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIMDNRTN--IDFNHFVEKLSLFQYNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVDN--SEMVVKMTEKIMSEIDMTDNGYINFEEFKLICLNQDILPKLDIHV 614
            +  E  + ++  + FD   +  L KRF +LD+   G ++      +P  Q NPL  ++I EI D+  N  +DF  F++ +S F    N+E KL   FK+ D D+DG+I+  +++ +L +I+  +N     + ++ +K +   D   +G I++EEF  +    D+  K+ + +
Sbjct:    1 MGNEASLPIELCSTFDQDELRRLGKRFRKLDLDGSGSLSVEEFMSLPQLQQNPLVQRVI-EIFDSDGNGEVDFKEFIDGMSQFSVKGNKEAKLRFAFKIYDMDRDGFISNGELFQVL-KIMVGNNLKDAQLQQIVDKTIIFADKDGDGKISYEEFCSVVSGMDVHTKMVVDI 170          
BLAST of Calcineurin B subunit vs. Planmine SMEST
Match: SMESG000028868.1 (SMESG000028868.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.785e-13
Identity = 45/153 (29.41%), Postives = 77/153 (50.33%), Query Frame = 3
Query:   87 MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNILYDIPDFQNNPLCDKIIDEIM-DNRTNIDFNHFVEKLSLFQ------YNQNEEKKLFILFKMNDHDQDGYINTNDVYNILHQILDVD-NSEMVVKMTEKIMSE 521
            MG +Q K L+  +   +   T F  K I  LY R+  LD    GF+TR     IP+   NPL D+I+ E   ++   + F +F++KL+ F+       + ++E KL  LF + D D D  I+  ++  +L  ++  +   E +  + E+ M+E
Sbjct:    1 MGNRQVKTLDSAEIAEISFETGFQPKQILRLYNRYLSLDRDKRGFLTRKNFLLIPELAINPLGDRIVHEFFRESGEELSFINFLKKLAPFRKADSQNIHSSKEAKLRFLFGLYDLDNDSMISRFELLGMLQMLVGSNITEEQLASIGERTMAE 153          
The following BLAST results are available for this feature:
BLAST of Calcineurin B subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP3R19.272e-2028.33protein phosphatase 3 regulatory subunit B, alpha ... [more]
PPP3R11.158e-1929.41protein phosphatase 3 regulatory subunit B, alpha ... [more]
PPP3R12.513e-1930.38protein phosphatase 3 regulatory subunit B, alpha ... [more]
PPP3R21.303e-1628.57protein phosphatase 3 regulatory subunit B, beta [... [more]
PPP3R21.342e-1628.57protein phosphatase 3 regulatory subunit B, beta [... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chpf-11.741e-1628.72Calcineurin-like EF-Hand Protein Family member [S... [more]
cnb-11.202e-1526.90Protein phosphatase 2B regulatory subunit cnb-1 [... [more]
chpf-28.322e-1527.69Calcineurin-like EF-Hand Protein Family member [S... [more]
cnb-16.983e-1425.15Protein phosphatase 2B regulatory subunit cnb-1 [... [more]
pbo-13.570e-1129.44pep chromosome:WBcel235:III:2681451:2686463:-1 gen... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CanB21.680e-1827.65gene:FBgn0015614 transcript:FBtr0309866[more]
CanB21.680e-1827.65gene:FBgn0015614 transcript:FBtr0088930[more]
elm1.955e-1830.69gene:FBgn0037358 transcript:FBtr0334953[more]
elm1.955e-1830.69gene:FBgn0037358 transcript:FBtr0078732[more]
CanB9.143e-1827.65gene:FBgn0010014 transcript:FBtr0070764[more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3r1b7.366e-2029.41protein phosphatase 3 (formerly 2B), regulatory s1... [more]
ppp3r1a1.744e-1929.41protein phosphatase 3, regulatory subunit B, alpha... [more]
chp11.450e-1427.84calcineurin-like EF-hand protein 1 [Source:ZFIN;Ac... [more]
chp27.768e-1127.50calcineurin-like EF-hand protein 2 [Source:ZFIN;Ac... [more]
chp27.768e-1127.50calcineurin-like EF-hand protein 2 [Source:ZFIN;Ac... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspe11.050e-1929.41heat shock protein family E (Hsp10) member 1 [Sour... [more]
hspe14.569e-1629.27heat shock protein family E (Hsp10) member 1 [Sour... [more]
chp12.023e-1326.42calcineurin-like EF-hand protein 1 [Source:NCBI ge... [more]
chp12.424e-1125.90calcineurin-like EF-hand protein 1 [Source:NCBI ge... [more]
cib22.836e-826.56calcium and integrin binding family member 2 [Sour... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp3r17.949e-2029.41protein phosphatase 3, regulatory subunit B, alpha... [more]
Ppp3r22.721e-1629.11protein phosphatase 3, regulatory subunit B, alpha... [more]
Chp17.226e-1627.18calcineurin-like EF hand protein 1 [Source:MGI Sym... [more]
Chp11.422e-1427.22calcineurin-like EF hand protein 1 [Source:MGI Sym... [more]
Chp21.384e-1327.37calcineurin-like EF hand protein 2 [Source:MGI Sym... [more]
back to top
BLAST of Calcineurin B subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UU93|CANB_SCHPO4.164e-2031.25Calcineurin subunit B OS=Schizosaccharomyces pombe... [more]
sp|P0CM54|CANB_CRYNJ1.557e-1930.39Calcineurin subunit B OS=Cryptococcus neoformans v... [more]
sp|P0CM55|CANB_CRYNB1.557e-1930.39Calcineurin subunit B OS=Cryptococcus neoformans v... [more]
sp|P87072|CANB_NEUCR2.801e-1934.00Calcineurin subunit B OS=Neurospora crassa (strain... [more]
sp|P42322|CANB1_NAEGR3.514e-1933.33Calcineurin subunit B OS=Naegleria gruberi OX=5762... [more]
back to top
BLAST of Calcineurin B subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M9FY655.877e-2333.73Calcineurin b subunit (CNB) OS=Leptomonas pyrrhoco... [more]
A0A0N0P4197.120e-2334.32Putative calcineurin B subunit OS=Leptomonas seymo... [more]
E9AVF83.407e-2232.54Putative calcineurin B subunit OS=Leishmania mexic... [more]
A0A0R3W1V23.601e-2232.62Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068Y4M53.717e-2232.62Calcium binding protein p22 OS=Echinococcus multil... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3r1a5.502e-2029.41calcineurin subunit B type 1 [Source:NCBI gene;Acc... [more]
ENSAMXT00000038285.16.242e-2029.41calcineurin subunit B type 1 [Source:NCBI gene;Acc... [more]
ENSAMXT00000049698.13.411e-1930.25calcineurin subunit B type 1 [Source:NCBI gene;Acc... [more]
ENSAMXT00000045317.11.512e-1830.32calcineurin subunit B type 1 [Source:NCBI gene;Acc... [more]
chp19.510e-1527.84calcineurin like EF-hand protein 1 [Source:NCBI ge... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009304.11.901e-1929.75pep scaffold:Pmarinus_7.0:GL479988:26077:30241:1 g... [more]
ENSPMAT00000000781.11.422e-1728.14pep scaffold:Pmarinus_7.0:GL476952:2198:8857:1 gen... [more]
ENSPMAT00000004125.14.460e-1627.48pep scaffold:Pmarinus_7.0:GL483005:7747:12994:-1 g... [more]
chp25.007e-1325.77calcineurin-like EF-hand protein 2 [Source:ZFIN;Ac... [more]
chp15.235e-1227.27calcineurin-like EF-hand protein 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CNB17.165e-1931.48Calcineurin B; regulatory subunit of calcineurin, ... [more]
FRQ13.140e-628.41N-myristoylated calcium-binding protein; may have ... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403034.484e-2433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485356.483e-1930.82Predicted protein; Protein phosphatase 3 (Formerly... [more]
EDO475154.745e-1028.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367241.143e-623.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265028.605e-625.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcineurin B subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002911.26.204e-2029.41protein phosphatase 3 regulatory subunit B, alpha ... [more]
chp11.172e-1528.72calcineurin like EF-hand protein 1 [Source:NCBI ge... [more]
ENSORLT00000002912.22.247e-1031.40calcineurin subunit B type 1-like [Source:NCBI gen... [more]
ENSORLT00000043316.12.307e-1031.40calcineurin subunit B type 1-like [Source:NCBI gen... [more]
ENSORLT00000043908.12.770e-1031.40calcineurin subunit B type 1-like [Source:NCBI gen... [more]
back to top
BLAST of Calcineurin B subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077376.12.606e-126100.00SMESG000077376.1[more]
SMESG000081409.14.126e-2029.24SMESG000081409.1[more]
SMESG000018297.13.900e-1933.13SMESG000018297.1[more]
SMESG000019278.13.188e-1727.91SMESG000019278.1[more]
SMESG000028868.11.785e-1329.41SMESG000028868.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030070 ID=SMED30030070|Name=Calcineurin B subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=682bp
AAAATACAATTACATAATTTAATTTTTTTAAAAATTGTTTTAATTTTCAT
AATAAAATGATTTAGTTATTTTACGAAATTCAGAAAATGGGTTTAAAGCA
ATCTAAACAGTTAAATGAGGAGCAAAAAATTATGTTGAAAAATACAACCC
GATTTGACGATAAAACGATCTGCAGTCTCTATAAACGTTTTAATGAATTA
GATATCAAGAATGAAGGATTTATTACAAGAAATATATTATATGATATTCC
AGATTTCCAAAACAATCCTCTATGTGATAAAATAATCGATGAAATAATGG
ATAATAGAACTAATATAGATTTCAACCATTTCGTTGAGAAATTGTCATTG
TTCCAATATAATCAAAATGAAGAAAAAAAATTATTCATTCTATTTAAAAT
GAACGATCATGATCAAGACGGATATATAAATACAAATGATGTTTACAACA
TTCTTCATCAAATACTTGATGTCGATAACTCTGAAATGGTTGTTAAAATG
ACTGAGAAAATTATGTCAGAAATTGATATGACAGATAACGGTTACATAAA
TTTTGAAGAGTTCAAATTGATCTGTTTAAATCAAGATATTCTTCCCAAAT
TAGATATTCATGTTTTACACTAGTTTAAAATATGAGTTTATAGTTAACTA
TTTATATTTGCAATATTTTGCCTTTCATTTAG
back to top

protein sequence of SMED30030070-orf-1

>SMED30030070-orf-1 ID=SMED30030070-orf-1|Name=SMED30030070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=179bp
MGLKQSKQLNEEQKIMLKNTTRFDDKTICSLYKRFNELDIKNEGFITRNI
LYDIPDFQNNPLCDKIIDEIMDNRTNIDFNHFVEKLSLFQYNQNEEKKLF
ILFKMNDHDQDGYINTNDVYNILHQILDVDNSEMVVKMTEKIMSEIDMTD
NGYINFEEFKLICLNQDILPKLDIHVLH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0008597calcium-dependent protein serine/threonine phosphatase regulator activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005955calcineurin complex
GO:0032153cell division site
Vocabulary: biological process
TermDefinition
GO:0009966regulation of signal transduction
GO:0050790regulation of catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1..178
e-value: 2.7E-32
score: 113.7
NoneNo IPR availablePANTHERPTHR46002FAMILY NOT NAMEDcoord: 1..176
NoneNo IPR availablePANTHERPTHR46002:SF5EG:114D9.1 PROTEIN-RELATEDcoord: 1..176
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 96..160
e-value: 1.1E-9
score: 38.5
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 94..129
score: 9.604
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 134..169
score: 9.743
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 107..119
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 1..167