Centrosomal protein of 41 kDa

Overview
NameCentrosomal protein of 41 kDa
Smed IDSMED30030069
Length (bp)1305
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein of 41 kDa (SMED30030069) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein of 41 kDa (SMED30030069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein of 41 kDa (SMED30030069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein of 41 kDa (SMED30030069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030069SMESG000026757.1 SmedASXL_009523SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30030069SMESG000026757.1 dd_Smed_v6_9621_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30030069SMESG000026757.1 Contig54791newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030069SMESG000026757.1 Contig54791uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30030069SMESG000026757.1 dd_Smed_v4_9621_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Human
Match: CEP41 (centrosomal protein 41 [Source:HGNC Symbol;Acc:HGNC:12370])

HSP 1 Score: 242.662 bits (618), Expect = 7.230e-76
Identity = 127/301 (42.19%), Postives = 191/301 (63.46%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVT-------------------THKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPV 897
            + L KRIP+NP+Y++I+S +DTG+S+ +Y +++E+I++NYR +KDELFKR+K++TF QL++QVA +++       E    +ED +S ++       D D  +TARTN                       + +ST Q VISGVGELD++   V+ ++  T +        Y   P+LLLDVRDRD Y QCHI+ + SYP A +SR++N  + ++L  +N  GKII++YD++ER+A + A T+ +RG+ENLFMLSGGL+V  +KFP+GLITG +  S + A+ PG  S  K+ S K   LP 
Sbjct:   11 EYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAAS-------DPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDKP------YPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLITGSLPASCQQALPPG--SARKRSSPKGPPLPA 296          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Human
Match: CEP41 (centrosomal protein 41 [Source:HGNC Symbol;Acc:HGNC:12370])

HSP 1 Score: 207.608 bits (527), Expect = 3.423e-63
Identity = 107/256 (41.80%), Postives = 164/256 (64.06%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVT-------------------THKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGG 762
            + L KRIP+NP+Y++I+S +DTG+S+ +Y +++E+I++NYR +KDELFKR+K++TF QL++QVA +++       E    +ED +S ++       D D  +TARTN                       + +ST Q VISGVGELD++   V+ ++  T +        Y   P+LLLDVRDRD Y QCHI+ + SYP A +SR++N  + ++L  +N  GKII++YD++ER+A + A T+ +RG+ENLFMLSGG
Sbjct:   11 EYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAAS-------DPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDKP------YPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGG 253          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Human
Match: CEP41 (centrosomal protein 41 [Source:HGNC Symbol;Acc:HGNC:12370])

HSP 1 Score: 180.259 bits (456), Expect = 7.104e-53
Identity = 101/256 (39.45%), Postives = 150/256 (58.59%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVT-------------------THKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGG 762
            + L KRIP+NP+Y++I+S +DT                +YR +KDELFKR+K++TF QL++QVA +++       E    +ED +S ++       D D  +TARTN                       + +ST Q VISGVGELD++   V+ ++  T +        Y   P+LLLDVRDRD Y QCHI+ + SYP A +SR++N  + ++L  +N  GKII++YD++ER+A + A T+ +RG+ENLFMLSGG
Sbjct:   11 EYLMKRIPQNPRYQHIKSRLDT----------------DYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAAS-------DPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDK------PYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGG 237          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Human
Match: CEP41 (centrosomal protein 41 [Source:HGNC Symbol;Acc:HGNC:12370])

HSP 1 Score: 137.887 bits (346), Expect = 5.854e-38
Identity = 77/206 (37.38%), Postives = 120/206 (58.25%), Query Frame = 1
Query:  127 LNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTND-------------------TVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEE 687
            + +Y +++E+I++NYR +KDELFKR+K++TF QL++QVA +++       E    +ED +S +        D D  +TARTN                       + +ST Q VISGVGELD++   V+ ++  T +        Y   P+LLLDVRDRD Y QCHI+ + SYP A +SR++N  + ++L  +N  GKII++YD++
Sbjct:    1 MTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAA-------SDPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDK------PYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDD 193          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Human
Match: CEP41 (centrosomal protein 41 [Source:HGNC Symbol;Acc:HGNC:12370])

HSP 1 Score: 127.102 bits (318), Expect = 3.931e-34
Identity = 73/194 (37.63%), Postives = 112/194 (57.73%), Query Frame = 1
Query:   31 LTSKKSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTN-------------------DTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQY 555
            + + K    L KRIP+NP+Y++I+S +DTG+S+ +Y +++E+I++NYR +KDELFKR+K++TF QL++QVA +++       E    +ED +S +        D D  +TARTN                       + +ST Q VISGVGELD++   V+ ++  T +        Y   P+LLLDVRDRD Y
Sbjct:    1 MVTHKVHQYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAA-------SDPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDK------PYPDCPFLLLDVRDRDSY 181          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Celegans
Match: F42G8.19 (pep chromosome:WBcel235:IV:8127734:8128909:1 gene:WBGene00249817.1 transcript:F42G8.19.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F42G8.19)

HSP 1 Score: 50.8322 bits (120), Expect = 2.607e-7
Identity = 35/95 (36.84%), Postives = 49/95 (51.58%), Query Frame = 1
Query:  466 VATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFM 750
            +A  E  SG P       + L+DV D D Y + HI  +  Y   M+SR V +ET  +LA     G ++VIY  E   A RVA  L QRG++ + +
Sbjct:   21 IAQSEQTSGCP-----ESFCLVDVNDNDVYHKSHIANAYHYDRIMLSRLV-YET-PILAQARAEGHLLVIYGRE---AERVAKVLFQRGFKTVLL 105          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Zebrafish
Match: cep41 (centrosomal protein 41 [Source:NCBI gene;Acc:431741])

HSP 1 Score: 239.195 bits (609), Expect = 9.329e-75
Identity = 124/284 (43.66%), Postives = 185/284 (65.14%), Query Frame = 1
Query:   58 LQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXX-------HYKHGDQDDVSTART------NDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVT-PGGQSKTKQ 867
            L+K+IP+NPKY+++++ +DTGSSL +Y++R+E+ R+NYR RKDELFKR+K++TF QLV+QVA +++     K E  G  +D +  S +              Q ++   +T       D   + +ST Q VISGVGELD++    ++  ++     +     Y   PYLLLDVRDR+ YDQCHI+ + SYP A +SR++N  TKE+L  +N  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+G+ TG +  S   + T P G+ ++ Q
Sbjct:   13 LKKKIPQNPKYQHVKTRLDTGSSLTKYMERLEEARKNYRYRKDELFKRLKVTTFAQLVIQVASVSDQNDNIKDEMAGLEDDVSIFSASPGLDCLSDQTNGSPQPNLPPPQTINIDESGDNGFSPRSTLQSVISGVGELDLDKNGQKTIRLSPVSTSNTTECPYPDCPYLLLDVRDRELYDQCHIVSAYSYPIATLSRTMNPYTKEVLDYKNASGKIIIVYDEDERIASQAATTMCERGFENLFMLSGGLKVVAQKFPEGMTTGSVPISCLPSPTGPAGRKRSAQ 296          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Zebrafish
Match: cep41 (centrosomal protein 41 [Source:NCBI gene;Acc:431741])

HSP 1 Score: 239.195 bits (609), Expect = 9.329e-75
Identity = 124/284 (43.66%), Postives = 185/284 (65.14%), Query Frame = 1
Query:   58 LQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXX-------HYKHGDQDDVSTART------NDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVT-PGGQSKTKQ 867
            L+K+IP+NPKY+++++ +DTGSSL +Y++R+E+ R+NYR RKDELFKR+K++TF QLV+QVA +++     K E  G  +D +  S +              Q ++   +T       D   + +ST Q VISGVGELD++    ++  ++     +     Y   PYLLLDVRDR+ YDQCHI+ + SYP A +SR++N  TKE+L  +N  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+G+ TG +  S   + T P G+ ++ Q
Sbjct:   13 LKKKIPQNPKYQHVKTRLDTGSSLTKYMERLEEARKNYRYRKDELFKRLKVTTFAQLVIQVASVSDQNDNIKDEMAGLEDDVSIFSASPGLDCLSDQTNGSPQPNLPPPQTINIDESGDNGFSPRSTLQSVISGVGELDLDKNGQKTIRLSPVSTSNTTECPYPDCPYLLLDVRDRELYDQCHIVSAYSYPIATLSRTMNPYTKEVLDYKNASGKIIIVYDEDERIASQAATTMCERGFENLFMLSGGLKVVAQKFPEGMTTGSVPISCLPSPTGPAGRKRSAQ 296          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Xenopus
Match: cep41 (centrosomal protein 41kDa [Source:NCBI gene;Acc:549691])

HSP 1 Score: 236.498 bits (602), Expect = 1.149e-73
Identity = 124/284 (43.66%), Postives = 186/284 (65.49%), Query Frame = 1
Query:   31 LTSKKS---TDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSK---------QENFGNIEDYXXXXXXXHYKHGDQDD-------VSTARTNDTVTTHKSTFQGVISGVGELDINNT------NVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITG 807
            +++K+S   +++L+KRIP+N KY++I++ +DTG+S+ +YL++IE+I++NYR +KDELFKR+K++TF QLVLQVA ++      +         ++N   I D    ++  + K    +D       + + R  + + T +ST Q VISGVGELD+ N       ++QSS    C             P+LLLDVRDRD YDQCH++ + +YP AM+SR++N  T E+L  RN  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+GL TG
Sbjct:    1 MSAKRSIGDSEILKKRIPQNLKYQHIKTRLDTGNSMTKYLEKIEEIKKNYRYKKDELFKRIKVTTFAQLVLQVASVSEERESGEMTTDELQRLEDNSSVISDTEFLTDRTNGKGSPVNDSKSPIQFIDSERGEECIHTSRSTLQSVISGVGELDLGNQADKKKESLQSSSALEC-------------PFLLLDVRDRDSYDQCHVVGAKNYPVAMLSRTMNPFTPEILEYRNAHGKIIILYDEDERIASQAATTMCERGFENLFMLSGGLKVISQKFPQGLTTG 271          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Xenopus
Match: cep41 (centrosomal protein 41kDa [Source:NCBI gene;Acc:549691])

HSP 1 Score: 230.72 bits (587), Expect = 1.643e-71
Identity = 124/291 (42.61%), Postives = 181/291 (62.20%), Query Frame = 1
Query:   46 STDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSK---------QENFGNIEDYXXXXXXXHYKHGDQDD-------VSTARTNDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQK 870
            S  +L+KRIP+N KY++I++ +DTG+S+ +YL++IE+I++NYR +KDELFKR+K++TF QLVLQVA ++      +         ++N   I D    ++  + K    +D       + + R  + + T +ST Q VISGVGELD+ N N                      P+LLLDVRDRD YDQCH++ + +YP AM+SR++N  T E+L  RN  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+GL TG    +    + P  Q K+  K
Sbjct:   23 SFQILKKRIPQNLKYQHIKTRLDTGNSMTKYLEKIEEIKKNYRYKKDELFKRIKVTTFAQLVLQVASVSEERESGEMTTDELQRLEDNSSVISDTEFLTDRTNGKGSPVNDSKSPIQFIDSERGEECIHTSRSTLQSVISGVGELDLGNQNC---------------------PFLLLDVRDRDSYDQCHVVGAKNYPVAMLSRTMNPFTPEILEYRNAHGKIIILYDEDERIASQAATTMCERGFENLFMLSGGLKVISQKFPQGLTTGSFPVT---CLVPPTQMKSALK 289          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Xenopus
Match: cep41 (centrosomal protein 41kDa [Source:NCBI gene;Acc:549691])

HSP 1 Score: 206.068 bits (523), Expect = 7.274e-62
Identity = 113/276 (40.94%), Postives = 169/276 (61.23%), Query Frame = 1
Query:   46 STDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSK---------QENFGNIEDYXXXXXXXHYKHGDQDD-------VSTARTNDTVTTHKSTFQGVISGVGELDINNT------NVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITG 807
            S  +L+KRIP+N KY++I++ +DTG+S+ +YL++IE+I++NYR +KDELFKR+K++TF QLVLQVA ++      +         ++N   I D    ++  + K    +D       + + R  + + T +ST Q VISGVGELD+ N       ++QSS                          + D YDQCH++ + +YP AM+SR++N  T E+L  RN  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+GL TG
Sbjct:   23 SFQILKKRIPQNLKYQHIKTRLDTGNSMTKYLEKIEEIKKNYRYKKDELFKRIKVTTFAQLVLQVASVSEERESGEMTTDELQRLEDNSSVISDTEFLTDRTNGKGSPVNDSKSPIQFIDSERGEECIHTSRSTLQSVISGVGELDLGNQADKKKESLQSSSAL-----------------------ELDSYDQCHVVGAKNYPVAMLSRTMNPFTPEILEYRNAHGKIIILYDEDERIASQAATTMCERGFENLFMLSGGLKVISQKFPQGLTTG 275          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Xenopus
Match: cep41 (centrosomal protein 41kDa [Source:NCBI gene;Acc:549691])

HSP 1 Score: 164.851 bits (416), Expect = 1.998e-46
Identity = 105/297 (35.35%), Postives = 166/297 (55.89%), Query Frame = 1
Query:   46 STDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSK---------QENFGNIEDYXXXXXXXHYKHGDQDD-------VSTARTNDTVTTHKSTFQGVISGVGELDINNT------NVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQK 870
            S  +L+KRIP+N KY++I++ +DTG+S+ +YL++IE+I+++    K+ + + +   +F Q VLQVA ++      +         ++N   I D    ++  + K    +D       + + R  + + T +ST Q VISGVGELD+ N       ++QSS                          + D YDQCH++ + +YP AM+SR++N  T E+L  RN  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+GL TG    +    + P  Q K+  K
Sbjct:   23 SFQILKKRIPQNLKYQHIKTRLDTGNSMTKYLEKIEEIKKS---NKNTVIREV-CGSFPQ-VLQVASVSEERESGEMTTDELQRLEDNSSVISDTEFLTDRTNGKGSPVNDSKSPIQFIDSERGEECIHTSRSTLQSVISGVGELDLGNQADKKKESLQSSSAL-----------------------ELDSYDQCHVVGAKNYPVAMLSRTMNPFTPEILEYRNAHGKIIILYDEDERIASQAATTMCERGFENLFMLSGGLKVISQKFPQGLTTGSFPVT---CLVPPTQMKSALK 288          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Mouse
Match: Cep41 (centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:1891414])

HSP 1 Score: 230.335 bits (586), Expect = 2.617e-71
Identity = 121/294 (41.16%), Postives = 189/294 (64.29%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYK-------HGDQDDVSTARTNDTVTT-----HKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPV 897
            + L +RIP+NP+Y++++S +DTG+S+ +Y++++E+I++NYR +KDELFKR+K++TF QLV+QVA +++       E    +ED +S ++    +        G  ++ S +      +T      +ST Q VISGVGELD++   V+       E  +G    Y   P+LLLDVRDRD Y QCHI+ + SYP A +SR++N  + ++L  +N  GKII++YDE+ER+A + A T+ +RG+ENLFMLSGGL+V  +KFP+GL+TG +  S + A+  G  S  K++  K   LP 
Sbjct:   11 EYLTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKRLKVTTFAQLVIQVASLSDQTLEVTAEEIQRLEDNDSATSEADAEIAAKTNGKGSPEEQSPSPVQFINSTGAGDSSRSTLQSVISGVGELDVDKGLVKK------EEPNGKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDEDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLVTGSLPASCQQALPFG--SVRKRRGPKMPALPA 296          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Mouse
Match: Cep41 (centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:1891414])

HSP 1 Score: 202.986 bits (515), Expect = 1.359e-61
Identity = 104/249 (41.77%), Postives = 163/249 (65.46%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYK-------HGDQDDVSTARTNDTVTT-----HKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGG 762
            + L +RIP+NP+Y++++S +DTG+S+ +Y++++E+I++NYR +KDELFKR+K++TF QLV+QVA +++       E    +ED +S ++    +        G  ++ S +      +T      +ST Q VISGVGELD++   V+       E  +G    Y   P+LLLDVRDRD Y QCHI+ + SYP A +SR++N  + ++L  +N  GKII++YDE+ER+A + A T+ +RG+ENLFMLSGG
Sbjct:   11 EYLTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKRLKVTTFAQLVIQVASLSDQTLEVTAEEIQRLEDNDSATSEADAEIAAKTNGKGSPEEQSPSPVQFINSTGAGDSSRSTLQSVISGVGELDVDKGLVKK------EEPNGKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDEDERLASQAATTMCERGFENLFMLSGG 253          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Mouse
Match: Cep41 (centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:1891414])

HSP 1 Score: 89.7373 bits (221), Expect = 2.078e-21
Identity = 34/69 (49.28%), Postives = 61/69 (88.41%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNH 258
            + L +RIP+NP+Y++++S +DTG+S+ +Y++++E+I++NYR +KDELFKR+K++TF QLV+QVA +++ 
Sbjct:   11 EYLTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKRLKVTTFAQLVIQVASLSDQ 79          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Mouse
Match: Cep41 (centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:1891414])

HSP 1 Score: 89.3521 bits (220), Expect = 2.738e-21
Identity = 34/69 (49.28%), Postives = 61/69 (88.41%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNH 258
            + L +RIP+NP+Y++++S +DTG+S+ +Y++++E+I++NYR +KDELFKR+K++TF QLV+QVA +++ 
Sbjct:   11 EYLTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKRLKVTTFAQLVIQVASLSDQ 79          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Mouse
Match: Cep41 (centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:1891414])

HSP 1 Score: 87.4261 bits (215), Expect = 5.487e-21
Identity = 34/64 (53.12%), Postives = 58/64 (90.62%), Query Frame = 1
Query:   58 LQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEI 249
            L +RIP+NP+Y++++S +DTG+S+ +Y++++E+I++NYR +KDELFKR+K++TF QLV+QVA +
Sbjct:   11 LTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKRLKVTTFAQLVIQVASL 74          
BLAST of Centrosomal protein of 41 kDa vs. UniProt/SwissProt
Match: sp|Q9BYV8|CEP41_HUMAN (Centrosomal protein of 41 kDa OS=Homo sapiens OX=9606 GN=CEP41 PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 3.472e-75
Identity = 127/301 (42.19%), Postives = 191/301 (63.46%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVT-------------------THKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPV 897
            + L KRIP+NP+Y++I+S +DTG+S+ +Y +++E+I++NYR +KDELFKR+K++TF QL++QVA +++       E    +ED +S ++       D D  +TARTN                       + +ST Q VISGVGELD++   V+ ++  T +        Y   P+LLLDVRDRD Y QCHI+ + SYP A +SR++N  + ++L  +N  GKII++YD++ER+A + A T+ +RG+ENLFMLSGGL+V  +KFP+GLITG +  S + A+ PG  S  K+ S K   LP 
Sbjct:   11 EYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAAS-------DPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDKP------YPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLITGSLPASCQQALPPG--SARKRSSPKGPPLPA 296          
BLAST of Centrosomal protein of 41 kDa vs. UniProt/SwissProt
Match: sp|A0JPH7|CE41B_XENLA (Centrosomal protein of 41 kDa B OS=Xenopus laevis OX=8355 GN=cep41-b PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 2.204e-74
Identity = 126/289 (43.60%), Postives = 188/289 (65.05%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQ--ENFGNIEDYXXXXXXXHY----KHGDQDDVS----------TARTNDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQK 870
            ++L+KRIP+N KY+++++ +DTG+S+ +Y++RIE+I++NYR +KDELFKR+K+STF QLVLQVA ++      +   +    +ED +S  ++  +     +G    VS          + R  + + T +ST Q VISGVGELD+ N   +        +    P  Y+  P+LLLDVRDRD YDQCHI+ + +YP+AM+SR++N  T E+L  RN  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+GL TG    +    + P  Q+K+  K
Sbjct:   11 EILKKRIPQNQKYQHVKTRLDTGNSMTKYMERIEEIKKNYRYKKDELFKRIKVSTFAQLVLQVASVSEERESGEMTADELQRLEDNSSVISDTEFLTDRPNGKGSPVSESKSPVQFIDSERGEEFIQTSRSTLQSVISGVGELDLGNQADKEKQSLPSSSALDKP--YEDCPFLLLDVRDRDSYDQCHIVGARNYPTAMLSRTMNPFTSEILEYRNAHGKIIILYDEDERIASQAATTMCERGFENLFMLSGGLKVISQKFPQGLTTGSFPST---CLAPPTQTKSALK 294          
BLAST of Centrosomal protein of 41 kDa vs. UniProt/SwissProt
Match: sp|Q6GQN0|CEP41_DANRE (Centrosomal protein of 41 kDa OS=Danio rerio OX=7955 GN=cep41 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 7.042e-74
Identity = 124/284 (43.66%), Postives = 185/284 (65.14%), Query Frame = 1
Query:   58 LQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXX-------HYKHGDQDDVSTART------NDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVT-PGGQSKTKQ 867
            L+K+IP+NPKY+++++ +DTGSSL +Y++R+E+ R+NYR RKDELFKR+K++TF QLV+QVA +++     K E  G  +D +  S +              Q ++   +T       D   + +ST Q VISGVGELD++    ++  ++     +     Y   PYLLLDVRDR+ YDQCHI+ + SYP A +SR++N  TKE+L  +N  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+G+ TG +  S   + T P G+ ++ Q
Sbjct:   13 LKKKIPQNPKYQHVKTRLDTGSSLTKYMERLEEARKNYRYRKDELFKRLKVTTFAQLVIQVASVSDQNDNIKDEMAGLEDDVSIFSASPGLDCLSDQTNGSPQPNLPPPQTINIDESGDNGFSPRSTLQSVISGVGELDLDKNGQKTIRLSPVSTSNTTECPYPDCPYLLLDVRDRELYDQCHIVSAYSYPIATLSRTMNPYTKEVLDYKNASGKIIIVYDEDERIASQAATTMCERGFENLFMLSGGLKVVAQKFPEGMTTGSVPISCLPSPTGPAGRKRSAQ 296          
BLAST of Centrosomal protein of 41 kDa vs. UniProt/SwissProt
Match: sp|Q6NTY8|CE41A_XENLA (Centrosomal protein of 41 kDa A OS=Xenopus laevis OX=8355 GN=cep41-a PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 8.424e-74
Identity = 127/299 (42.47%), Postives = 192/299 (64.21%), Query Frame = 1
Query:   31 LTSKKS---TDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSK---------QENFGNIEDYXXXXXXXHYKHGDQDD-------VSTARTNDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQK 870
            +++K+S   +++L+KRIP+N KYE+I++ +DTG+S+ +YL+RIEDI++NYR +KDELFKR+K++TF QLVLQVA +       +         ++N   I D    ++  + K    ++       + + R  + + T +ST Q VISGVGELD+ N      +     +    P  Y+  P+LLLDVRDRD YDQCHI+ + +YP AM+SR++N  T E+L  RN  GKII++YDE+ER+A + A T+ +RG+ENLFMLSGGL+V  ++FP+GL TG    +    + P  Q+K+  K
Sbjct:    1 MSAKRSIGDSEILKKRIPQNQKYEHIKTRLDTGNSMTKYLERIEDIKRNYRYKKDELFKRIKVTTFAQLVLQVASVTEERESGEMTTDELQRLEDNSSVISDTEFLTDRPNGKGSPANESNSPIQFIDSERGEELIQTSRSTLQSVISGVGELDLGNQADIKKESLPSSSALDKP--YEDCPFLLLDVRDRDSYDQCHIVGARNYPIAMLSRTMNPFTPEILEYRNAHGKIIILYDEDERVASQAASTMCERGFENLFMLSGGLKVISQRFPQGLTTGSFPIT---CLAPPTQTKSALK 294          
BLAST of Centrosomal protein of 41 kDa vs. UniProt/SwissProt
Match: sp|Q28FA8|CEP41_XENTR (Centrosomal protein of 41 kDa OS=Xenopus tropicalis OX=8364 GN=cep41 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 3.218e-73
Identity = 122/278 (43.88%), Postives = 186/278 (66.91%), Query Frame = 1
Query:   31 LTSKKS---TDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSK---------QENFGNIEDYXXXXXXXHYKHGDQDD-------VSTARTNDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITG 807
            +++K+S   +++L+KRIP+N KY++I++ +DTG+S+ +YL++IE+I++NYR +KDELFKR+K++TF QLVLQVA ++      +         ++N   I D    ++  + K    +D       + + R  + + T +ST Q VISGVGELD+ N   +  +     +    P  Y+  P+LLLDVRDRD YDQCH++ + +YP AM+SR++N  T E+L  RN  GKII++YDE+ERIA + A T+ +RG+ENLFMLSGGL+V  +KFP+GL TG
Sbjct:    1 MSAKRSIGDSEILKKRIPQNLKYQHIKTRLDTGNSMTKYLEKIEEIKKNYRYKKDELFKRIKVTTFAQLVLQVASVSEERESGEMTTDELQRLEDNSSVISDTEFLTDRTNGKGSPVNDSKSPIQFIDSERGEECIHTSRSTLQSVISGVGELDLGNQADKKKESLQSSSALDKP--YEDCPFLLLDVRDRDSYDQCHVVGAKNYPVAMLSRTMNPFTPEILEYRNAHGKIIILYDEDERIASQAATTMCERGFENLFMLSGGLKVISQKFPQGLTTG 276          
BLAST of Centrosomal protein of 41 kDa vs. TrEMBL
Match: H6WA32 (CEP41 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 3.728e-137
Identity = 225/238 (94.54%), Postives = 229/238 (96.22%), Query Frame = 1
Query:  400 FQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPVTXXXXXXXXXXXXXXXXXXXXXXDFTMDDLANLSMNLDAALDSKSSVGSSIYSQNSKNLASRASVTGSLTAS 1113
            F  VISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPVTSQSQRSVQSSAISSSESSEIKSDFTMDDLANLSMNLDAALDSKSSVGSSIYSQNSK      S+T SL+++
Sbjct:   17 FNSVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPVTSQSQRSVQSSAISSSESSEIKSDFTMDDLANLSMNLDAALDSKSSVGSSIYSQNSK------SITRSLSSA 248          
BLAST of Centrosomal protein of 41 kDa vs. TrEMBL
Match: A0A1S3J3K8 (centrosomal protein of 41 kDa-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106169778 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 9.853e-84
Identity = 136/279 (48.75%), Postives = 183/279 (65.59%), Query Frame = 1
Query:   31 LTSKKSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVT--------------------THKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITG 807
            ++ +K  D L +++P+NPKY+++++T+DTG+SLN+Y+ +IE+IR+NYR +KDELFKRMK++TFVQLV+QVAE++        ENF ++        +     GD  D   AR    VT                    T +ST Q VI GVGE+D+N         +    D       D  PYL+LDVRD D Y+ CHII +LS+PSAM+SRS N+E+KE+LA RN+PGKIIVIYD++ERIAP VA  +V+RGYENLFMLSGGL+ AY  FP+GLITG
Sbjct:    4 VSRQKKLDPLSRKVPENPKYQHVKATVDTGASLNKYMSKIEEIRRNYRYKKDELFKRMKVTTFVQLVIQVAEVHQKELA---ENFPDL-------ASPRPGSGDTVDNEIARIQGGVTSPAPSLAITEGDFGPGDPPDTARSTLQSVIKGVGEVDLNAPTTAPPPASNLTAD-------DFNPYLVLDVRDVDAYNDCHIISALSFPSAMLSRSCNYESKELLAYRNQPGKIIVIYDDDERIAPHVATVMVERGYENLFMLSGGLKFAYANFPRGLITG 265          
BLAST of Centrosomal protein of 41 kDa vs. TrEMBL
Match: A0A267E114 (Rhodanese domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025755g1 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.812e-82
Identity = 147/298 (49.33%), Postives = 194/298 (65.10%), Query Frame = 1
Query:   58 LQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHG--DQDDVSTARTNDT-------------VTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTP---GGQSKTKQKSVKAGDLPV 897
            LQKRIP+NPKY N++STIDTG+S+ +Y+K+IE+IR+NYR R+DE+FKRMK +TFVQL+LQV EIN  L      + G   D   +     ++    D DD   AR                 V+T +ST Q VISGVGELD N         A  E         +  PYLLLDVR+R++Y++C II ++SYP  M+SR+ N+E  +MLACRN+PG+I++IYDE+E+IAPRVA TLVQRGY+NLFMLSGGLRVA K FP+GL+TG + ++ R   +    GGQS   Q++  A  L V
Sbjct:    2 LQKRIPRNPKYANVKSTIDTGASITKYMKKIEEIRENYRFRQDEIFKRMKATTFVQLMLQVTEINRSL-AEPPPDAGEFSDAEDDLLPAEFERTLRDGDDGQQARAQSAQSLAVSESDYGRPVSTARSTLQSVISGVGELDENGGGRGGRLSAMPEWP-------EETPYLLLDVREREEYERCRIIGAVSYPYTMLSRAQNYEIPQMLACRNRPGRIVLIYDEDEKIAPRVATTLVQRGYDNLFMLSGGLRVAVKLFPEGLVTGSLPQTARSTTSSSIVGGQSAASQRANDADQLDV 291          
BLAST of Centrosomal protein of 41 kDa vs. TrEMBL
Match: A0A1I8IQL6 (Rhodanese domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008090g1 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 8.030e-82
Identity = 149/303 (49.17%), Postives = 197/303 (65.02%), Query Frame = 1
Query:   43 KSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQE--NFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDT-------------VTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTP---GGQSKTKQKSVKAGDLPV 897
            K  D LQKRIP+NPKY N++STIDTG+S+ +Y+K+IE+IR+NYR R+DE+FKRMK +TFVQL+LQV EIN  L     +   F + ED    + +      D DD   AR                 V+T +ST Q VISGVGELD N         A  E         +  PYLLLDVR+R++Y++C II ++SYP  M+SR+ N+E  +MLACRN+PG+I++IYDE+E+IAPRVA TLVQRGY+NLFMLSGGLRVA K FP+GL+TG + ++ R   +    GG+S   Q++  A  L V
Sbjct:    9 KPIDPLQKRIPRNPKYANVKSTIDTGASITKYMKKIEEIRENYRFRQDEIFKRMKATTFVQLMLQVTEINRGLAEPPPDAGEFSDAEDDLLPAESERTLR-DGDDGQPARAQSAQSLAVSESDYGRPVSTARSTLQSVISGVGELDENGGGRGGRLSAMPEWP-------EETPYLLLDVREREEYERCRIIGAVSYPYTMLSRAQNYEIPQMLACRNRPGRIVLIYDEDEKIAPRVATTLVQRGYDNLFMLSGGLRVAVKLFPEGLVTGSLPQTARSTTSSSIVGGKSAASQRANDADQLDV 303          
BLAST of Centrosomal protein of 41 kDa vs. TrEMBL
Match: G4VJR6 (Putative centrosomal protein of 41 kDa (Cep41 protein) (Testis-specificprotein A14 protein) OS=Schistosoma mansoni OX=6183 GN=Smp_144950 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 9.307e-82
Identity = 141/283 (49.82%), Postives = 194/283 (68.55%), Query Frame = 1
Query:   58 LQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLY----------CSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVTTHKSTFQGVISGVGELDI--NNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQK 870
            LQK IP+NPKYENI+ TIDTG+SL++YLK++E+IR+NY+++ +E+FKR+KI TFVQL+LQ++E+               CS   N   ++++ +N+N +   +G     ST    D   T +ST + +++GVGE DI    +  Q  D  + +  S D       PYLLLDVRDRD YD CHII +L+YP AM+SRSVNFET EMLA RN+P  II++YDE+ER+APR A TLVQRGY NLFMLSGGL+VA+K FPKGLI G++  SI +A+   G+++   +
Sbjct:   17 LQKTIPRNPKYENIQPTIDTGASLSKYLKKMEEIRENYKMKDNEIFKRIKIPTFVQLILQISEVQKQQQQNNELNNHNSCSTPRN--EVDNHINNNNKSTNGNG-----STHGNVDPPLTERSTLESLVTGVGEFDICFGQSRSQIPDTTSKQTSSVDS------PYLLLDVRDRDDYDACHIITALNYPIAMLSRSVNFETTEMLAYRNRPDHIIIVYDEDERLAPRAASTLVQRGYCNLFMLSGGLKVAWKLFPKGLIIGEMPLSISYALKLHGKTRISSR 286          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Cavefish
Match: cep41 (centrosomal protein 41 [Source:NCBI gene;Acc:103032388])

HSP 1 Score: 245.358 bits (625), Expect = 3.222e-77
Identity = 133/284 (46.83%), Postives = 186/284 (65.49%), Query Frame = 1
Query:   49 TDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTART------------NDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTK 864
            T+ L+KRIP+NPKY+++ S +DTG SL +Y++++E+I++NYR RKDELFKR+K++TF QLV+QV+ + N L  S  +    +ED    S  +H    DQ++ S  RT             DT  + +ST Q VISGVGE+D++    ++         S     Y   PYLLLDVRDRDQYDQCHII + SYP A +SR++N  TKE+L  +N PGKII++YDE+ER+A + + T+ +RG+ENLFMLSGGL+V  +KFP+G+ TG I   I    +P G S  K
Sbjct:   14 TEYLKKRIPQNPKYQHVRSRLDTGCSLTKYMEKLEEIKKNYRYRKDELFKRLKVTTFAQLVIQVSSVAN-LNESIMDEIPRLED--DVSEIDHLI--DQNNDSPQRTPQPVKFIDNNESGDTGFSPRSTLQSVISGVGEMDLDKNGQKTISPTPVTTPSSAERPYMDCPYLLLDVRDRDQYDQCHIISAHSYPIATLSRTMNPYTKEVLDYKNAPGKIIILYDEDERLASQASTTMCERGFENLFMLSGGLKVITQKFPEGMTTGTI--PISCLPSPKGSSGRK 290          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Cavefish
Match: cep41 (centrosomal protein 41 [Source:NCBI gene;Acc:103032388])

HSP 1 Score: 214.927 bits (546), Expect = 7.718e-66
Identity = 121/266 (45.49%), Postives = 168/266 (63.16%), Query Frame = 1
Query:  103 STIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTART------------NDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTK 864
            +T   G SL +Y++++E+I++NYR RKDELFKR+K++TF QLV+QV+ + N L  S  +    +ED    S  +H    DQ++ S  RT             DT  + +ST Q VISGVGE+D++    ++         S     Y   PYLLLDVRDRDQYDQCHII + SYP A +SR++N  TKE+L  +N PGKII++YDE+ER+A + + T+ +RG+ENLFMLSGGL+V  +KFP+G+ TG I   I    +P G S  K
Sbjct:    6 ATCFIGCSLTKYMEKLEEIKKNYRYRKDELFKRLKVTTFAQLVIQVSSVAN-LNESIMDEIPRLED--DVSEIDHLI--DQNNDSPQRTPQPVKFIDNNESGDTGFSPRSTLQSVISGVGEMDLDKNGQKTISPTPVTTPSSAERPYMDCPYLLLDVRDRDQYDQCHIISAHSYPIATLSRTMNPYTKEVLDYKNAPGKIIILYDEDERLASQASTTMCERGFENLFMLSGGLKVITQKFPEGMTTGTI--PISCLPSPKGSSGRK 264          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Sea Lamprey
Match: cep41 (centrosomal protein 41 [Source:NCBI gene;Acc:431741])

HSP 1 Score: 237.269 bits (604), Expect = 1.318e-74
Identity = 124/274 (45.26%), Postives = 170/274 (62.04%), Query Frame = 1
Query:   52 DVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHG--------DQDDVSTARTNDTV-TTHKSTFQGVISGVGELDINNTNVQ-------SSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESI 825
            ++L KR+P+NPKY+N++S +DTGSSL +Y++R+ED+R NYR R  ELFKRMKI+TF Q+VLQVA +         E    +E        + +             D + T    D V  T +ST Q VISG+GE+D+  TN         S       +++ +   Y   PYLL+D+RDRD Y+QCHII + SYPSAM+SRS N  TKEML  +N  GKII++YDE+ERIA   A T+ +RG+ENL++LSGGL+V  +KFP GL TG +   +
Sbjct:   14 NILNKRVPQNPKYKNVKSKLDTGSSLTKYMERLEDMRTNYRYRPGELFKRMKITTFAQIVLQVASLTED---PTLEEIMQMEVLFVVLECDEFLWALFSGPSCPQTDRLDTPSGGDAVVATARSTLQSVISGLGEMDLTGTNGSAEKQQPLSPSRQQKRSEASEDQPYPDCPYLLMDLRDRDAYEQCHIIGAASYPSAMLSRSFNQYTKEMLEYKNVTGKIIIVYDEDERIATVAATTMCERGFENLYVLSGGLKVLAQKFPTGLTTGSLPPQL 284          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Nematostella
Match: EDO36249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ76])

HSP 1 Score: 207.608 bits (527), Expect = 2.576e-64
Identity = 116/277 (41.88%), Postives = 172/277 (62.09%), Query Frame = 1
Query:   67 RIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVTTHK---------------STFQGVISGVGELDINNTNV---QSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTP 843
            +IP+NPKY+++++T+DTGSS+ +Y++RI++IR+NY+ RKDE+FKRMK STF QLV    +I +      +E   ++ED     N      GD    ++       T  +               S F  +I GVGE+D+ + +    +SS++ T    S      ++MPYLLLD+RD++ +D+CHII +L YPS+M+SRS N+ TKE+L  +NK GKII++YDE+ER+A   A T VQR  +N+FMLSGGL+V  KKF +G+ITG +  S      P
Sbjct:    1 KIPENPKYKHVKATVDTGSSVTKYMERIDEIRKNYKFRKDEIFKRMKASTFAQLV----KIYSQRTIVPEEK-ESVED---GENVPPLNLGDDRPATSGTATSRSTLQRCLLFLKMVNSRKKTSSFFFSLIHGVGEIDVKDQDSDHNKSSEMPTETPLSTVAPDVESMPYLLLDLRDKEAFDKCHIIGALHYPSSMLSRSYNYFTKEILIFKNKLGKIIILYDEDERLAAPAATTFVQREVDNVFMLSGGLKVLAKKFAQGMITGTLPASCLPTPPP 269          
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Medaka
Match: cep41 (centrosomal protein 41 [Source:NCBI gene;Acc:101163958])

HSP 1 Score: 232.261 bits (591), Expect = 6.796e-72
Identity = 127/312 (40.71%), Postives = 193/312 (61.86%), Query Frame = 1
Query:   13 LKLNKMLTSK----------KSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQD-----DVS------TARTNDTVTTHKSTFQGVISGVGELDINNTNVQSSDV----ATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKS 873
            LK  +ML S+           + + ++K+IPKN KY+ +++ +DTG S+ +Y++R+E+IR+NYR RKDE+FKR+K++T  QLVLQVA + +        N   I+D + +  ++ +   D D     D+S      +  +N +  T +ST   VISG+GEL+++N + +  D     A C +       Y   PYLLLDVR+R+QYD CHII + S+P  M+SR++N  TKE+L  +N PGKII++YDE+ERIA + A  + +RG+ENLFML GGL+V  +KFP+G+ TG I  S    ++P   S   +KS
Sbjct:   24 LKCEEMLASQLKDMSLNRGVGNQEYMKKKIPKNAKYDYVKTKLDTGCSMTKYMERLEEIRKNYRYRKDEIFKRIKLTTLAQLVLQVASVAD-------SNGSEIDDGSQDPEDSLFAGSDADLESHTDISPQASSPSGESNHSCHTARSTLLSVISGIGELNVDNNDHRVEDHLLPDAVCADRP-----YPDCPYLLLDVREREQYDLCHIISAHSFPIGMLSRTMNPYTKEVLEYKNAPGKIIIVYDEDERIASQAATAMCERGFENLFMLCGGLKVIAQKFPRGMTTGCIPAS---CLSPHNASSKGRKS 320          
BLAST of Centrosomal protein of 41 kDa vs. Planmine SMEST
Match: SMESG000026757.1 (SMESG000026757.1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 372/374 (99.47%), Postives = 373/374 (99.73%), Query Frame = 1
Query:   28 MLTSKKSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYXXXXXXXHYKHGDQDDVSTARTNDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPVTXXXXXXXXXXXXXXXXXXXXXXDFTMDDLANLSMNLDAALDSKSSVGSSIYSQNSKNLASRASVTGSLTASTGQIDHKKPFKC 1149
            MLTSKKSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYNSNSNNNHYKH DQDDVSTARTNDTVTTH+STFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPVTSQSQRSVQSSAISSSESSEIKSDFTMDDLANLSMNLDAALDSKSSVGSSIYSQNSKNLASRASVTGSLTASTGQIDHKKPFKC
Sbjct:    1 MLTSKKSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRIRKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYNSNSNNNHYKHCDQDDVSTARTNDTVTTHRSTFQGVISGVGELDINNTNVQSSDVATCENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFETKEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAYKKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPVTSQSQRSVQSSAISSSESSEIKSDFTMDDLANLSMNLDAALDSKSSVGSSIYSQNSKNLASRASVTGSLTASTGQIDHKKPFKC 374          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP417.230e-7642.19centrosomal protein 41 [Source:HGNC Symbol;Acc:HGN... [more]
CEP413.423e-6341.80centrosomal protein 41 [Source:HGNC Symbol;Acc:HGN... [more]
CEP417.104e-5339.45centrosomal protein 41 [Source:HGNC Symbol;Acc:HGN... [more]
CEP415.854e-3837.38centrosomal protein 41 [Source:HGNC Symbol;Acc:HGN... [more]
CEP413.931e-3437.63centrosomal protein 41 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F42G8.192.607e-736.84pep chromosome:WBcel235:IV:8127734:8128909:1 gene:... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep419.329e-7543.66centrosomal protein 41 [Source:NCBI gene;Acc:43174... [more]
cep419.329e-7543.66centrosomal protein 41 [Source:NCBI gene;Acc:43174... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cep411.149e-7343.66centrosomal protein 41kDa [Source:NCBI gene;Acc:54... [more]
cep411.643e-7142.61centrosomal protein 41kDa [Source:NCBI gene;Acc:54... [more]
cep417.274e-6240.94centrosomal protein 41kDa [Source:NCBI gene;Acc:54... [more]
cep411.998e-4635.35centrosomal protein 41kDa [Source:NCBI gene;Acc:54... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cep412.617e-7141.16centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:... [more]
Cep411.359e-6141.77centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:... [more]
Cep412.078e-2149.28centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:... [more]
Cep412.738e-2149.28centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:... [more]
Cep415.487e-2153.13centrosomal protein 41 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BYV8|CEP41_HUMAN3.472e-7542.19Centrosomal protein of 41 kDa OS=Homo sapiens OX=9... [more]
sp|A0JPH7|CE41B_XENLA2.204e-7443.60Centrosomal protein of 41 kDa B OS=Xenopus laevis ... [more]
sp|Q6GQN0|CEP41_DANRE7.042e-7443.66Centrosomal protein of 41 kDa OS=Danio rerio OX=79... [more]
sp|Q6NTY8|CE41A_XENLA8.424e-7442.47Centrosomal protein of 41 kDa A OS=Xenopus laevis ... [more]
sp|Q28FA8|CEP41_XENTR3.218e-7343.88Centrosomal protein of 41 kDa OS=Xenopus tropicali... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA323.728e-13794.54CEP41 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A1S3J3K89.853e-8448.75centrosomal protein of 41 kDa-like isoform X1 OS=L... [more]
A0A267E1142.812e-8249.33Rhodanese domain-containing protein (Fragment) OS=... [more]
A0A1I8IQL68.030e-8249.17Rhodanese domain-containing protein OS=Macrostomum... [more]
G4VJR69.307e-8249.82Putative centrosomal protein of 41 kDa (Cep41 prot... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep413.222e-7746.83centrosomal protein 41 [Source:NCBI gene;Acc:10303... [more]
cep417.718e-6645.49centrosomal protein 41 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep411.318e-7445.26centrosomal protein 41 [Source:NCBI gene;Acc:43174... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO362492.576e-6441.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep416.796e-7240.71centrosomal protein 41 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Centrosomal protein of 41 kDa vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026757.10.000e+099.47SMESG000026757.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030069 ID=SMED30030069|Name=Centrosomal protein of 41 kDa|organism=Schmidtea mediterranea sexual|type=transcript|length=1305bp
TTAACTTAGCAACTTAAATTGAATAAAATGTTAACTTCAAAAAAATCAAC
TGATGTTTTGCAAAAACGAATTCCAAAAAATCCAAAATATGAAAATATCG
AATCGACAATTGATACAGGTTCGAGTTTAAATCGATATCTCAAACGCATT
GAAGACATCAGACAAAATTATCGAATACGTAAAGATGAATTATTTAAACG
AATGAAAATCTCCACATTTGTTCAACTAGTTCTACAAGTTGCAGAAATAA
ATAATCATTTGTATTGTAGTAAGCAAGAGAATTTCGGTAACATCGAGGAT
TATAACTCCAATTCAAACAATAATCATTATAAACATGGTGATCAGGATGA
TGTTTCCACTGCCAGAACAAATGACACCGTAACAACTCACAAGTCAACCT
TCCAAGGTGTGATAAGTGGCGTTGGTGAACTCGATATCAACAACACCAAC
GTCCAGTCGTCAGATGTCGCCACGTGCGAGAATGATTCTGGTGATCCGAT
CGTATATGACACTATGCCGTATCTATTATTAGACGTCAGAGACAGAGATC
AGTACGATCAGTGTCATATCATAAAAAGTCTATCTTATCCTTCTGCTATG
ATATCACGTAGCGTTAATTTTGAAACCAAAGAAATGCTCGCTTGTCGAAA
TAAACCTGGTAAAATCATCGTAATTTACGATGAAGAGGAACGAATTGCTC
CACGAGTTGCTGACACCCTCGTTCAACGAGGATATGAAAACCTGTTTATG
CTATCCGGAGGATTGAGGGTTGCGTACAAGAAATTTCCCAAGGGCCTCAT
AACTGGGAAAATATCGGAATCGATTCGACATGCCGTCACTCCAGGGGGAC
AGAGTAAAACCAAACAGAAATCCGTTAAAGCGGGAGATTTACCAGTTACC
TCACAATCTCAGAGATCAGTACAGTCGAGTGCCATTTCATCCTCAGAGTC
AAGTGAAATCAAATCTGATTTCACAATGGACGATCTGGCTAATTTGAGCA
TGAATCTCGATGCAGCCCTTGATTCTAAATCATCGGTCGGTTCAAGTATT
TATTCGCAAAATTCCAAAAATTTGGCCAGCAGAGCGAGTGTTACTGGCAG
CCTCACAGCTTCAACTGGCCAAATCGATCACAAGAAGCCTTTCAAGTGCT
GAGCAGTGCGGTCAATAATTTGCACCAAAATTTGTGAATTACATTTTGGT
GTTGTTGAATTGATTTATAAATGTTCATTTCTCTGATTGGTGGAATTTGC
CTCTAATTTGCTGGTGTAATTGTTACCATCTTCCTTCAAGCTATTTTTTG
ATCTA
back to top

protein sequence of SMED30030069-orf-1

>SMED30030069-orf-1 ID=SMED30030069-orf-1|Name=SMED30030069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=375bp
MLTSKKSTDVLQKRIPKNPKYENIESTIDTGSSLNRYLKRIEDIRQNYRI
RKDELFKRMKISTFVQLVLQVAEINNHLYCSKQENFGNIEDYNSNSNNNH
YKHGDQDDVSTARTNDTVTTHKSTFQGVISGVGELDINNTNVQSSDVATC
ENDSGDPIVYDTMPYLLLDVRDRDQYDQCHIIKSLSYPSAMISRSVNFET
KEMLACRNKPGKIIVIYDEEERIAPRVADTLVQRGYENLFMLSGGLRVAY
KKFPKGLITGKISESIRHAVTPGGQSKTKQKSVKAGDLPVTSQSQRSVQS
SAISSSESSEIKSDFTMDDLANLSMNLDAALDSKSSVGSSIYSQNSKNLA
SRASVTGSLTASTGQIDHKKPFKC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR001763Rhodanese-like_dom
Vocabulary: biological process
TermDefinition
GO:0000086G2/M transition of mitotic cell cycle
GO:0006810transport
GO:0015031protein transport
GO:0018095protein polyglutamylation
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
GO:0097711ciliary basal body docking
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005929cilium
GO:0016020membrane
GO:0036064ciliary basal body
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 38..58
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 342..374
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..305
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 342..365
NoneNo IPR availablePANTHERPTHR44390FAMILY NOT NAMEDcoord: 8..311
NoneNo IPR availableCDDcd00158RHODcoord: 165..247
e-value: 5.70113E-13
score: 61.9318
IPR001763Rhodanese-like domainSMARTSM00450rhod_4coord: 150..255
e-value: 2.9E-7
score: 40.1
IPR001763Rhodanese-like domainPFAMPF00581Rhodanesecoord: 166..247
e-value: 2.9E-8
score: 34.2
IPR001763Rhodanese-like domainPROSITEPS50206RHODANESE_3coord: 161..259
score: 12.647
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 159..254
e-value: 5.5E-12
score: 48.0
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 163..247