Progestin and adipoQ receptor family member 3

Overview
NameProgestin and adipoQ receptor family member 3
Smed IDSMED30030065
Length (bp)960
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Progestin and adipoQ receptor family member 3 (SMED30030065) t-SNE clustered cells

Violin plots show distribution of expression levels for Progestin and adipoQ receptor family member 3 (SMED30030065) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Progestin and adipoQ receptor family member 3 (SMED30030065) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Progestin and adipoQ receptor family member 3 (SMED30030065) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030065h1SMcG0015083 Contig23479newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Human
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:HGNC Symbol;Acc:HGNC:30130])

HSP 1 Score: 236.884 bits (603), Expect = 4.531e-76
Identity = 121/276 (43.84%), Postives = 179/276 (64.86%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IP  LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +Y++  L+F+FY  K+PER++PG+ +++GSSHQIWH+L ++  Y WH S V +  YR +  C
Sbjct:   29 RLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Human
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:HGNC Symbol;Acc:HGNC:30130])

HSP 1 Score: 236.884 bits (603), Expect = 4.531e-76
Identity = 121/276 (43.84%), Postives = 179/276 (64.86%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IP  LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +Y++  L+F+FY  K+PER++PG+ +++GSSHQIWH+L ++  Y WH S V +  YR +  C
Sbjct:   29 RLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Human
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:HGNC Symbol;Acc:HGNC:30130])

HSP 1 Score: 195.282 bits (495), Expect = 2.450e-60
Identity = 103/236 (43.64%), Postives = 152/236 (64.41%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWP 805
            RL  Y  IP  LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +Y++  L+F+FY  K+PER++P
Sbjct:   29 RLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFP 264          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Human
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:HGNC Symbol;Acc:HGNC:30130])

HSP 1 Score: 195.282 bits (495), Expect = 4.722e-60
Identity = 103/236 (43.64%), Postives = 152/236 (64.41%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWP 805
            RL  Y  IP  LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +Y++  L+F+FY  K+PER++P
Sbjct:   29 RLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFP 264          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Human
Match: ADIPOR1 (adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGNC:24040])

HSP 1 Score: 120.939 bits (302), Expect = 6.653e-31
Identity = 91/312 (29.17%), Postives = 160/312 (51.28%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIKCE-----------RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYD--WHSSGVELFDYRITHGCN 928
            ++LP+  +H ++   K E           R++ Y  +P +LK N ++  G+R    + + C KSIF+   E+ NIWTHL+GF++F++  I+  +           + ++  +  L  ++C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  Y+     L IS +I     R+   +    R  +FL L + GVVPT+H+       ++  V      FL  V  +Y+ GA     Y  +IPERF+PG+FD    SHQI+HVLV+   +   +  S ++ F Y +  GC 
Sbjct:   67 LTLPLQAHHAME---KMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAV--MYITGA---GLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCT 370          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Celegans
Match: paqr-3 (Progestin and AdipoQ Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061ACE6])

HSP 1 Score: 169.088 bits (427), Expect = 6.780e-50
Identity = 99/276 (35.87%), Postives = 149/276 (53.99%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRT-SYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTS----IFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELF-DYR 910
            RL+    +   L  N ++ + YR  + T K C KS F  +NE++NIW+HL+GFI F Y     N I LP      +DH + ++ +    +CML S  YH F C S  M+Q W  +D+ GI  GL+G YL GIY A++CF      Y++  L + +          +   +    R      I+ ++  FG+ PTVHW++L  GF ++ V+ +   V+ LY L A +F+FY   +PE+ WPG+FD +G SHQ WH+ +L     W  SG +L  +YR
Sbjct:   21 RLVSKHKLHKTLWQNDYVINHYRPPAMTKKMCAKSAFHINNETINIWSHLLGFIYFTYQQYNTNYIVLPSIGSHPSDHFVFTLSIFGMQMCMLLSASYHTFGCTSIEMRQKWLKMDIFGISAGLLGMYLNGIYTAFFCFQDHLTSYIYILLGIFVITAYVPTRQDFFERKIIGSRVGLLHIIYCIIITFGICPTVHWVFLHGGFENDHVTKWFPNVVVLYSLIAAAFMFYVTMVPEKLWPGKFDVVGCSHQWWHIFILGAMIYWQQSGNQLLTEYR 296          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Celegans
Match: paqr-3 (Progestin and AdipoQ Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061ACE6])

HSP 1 Score: 165.236 bits (417), Expect = 6.580e-49
Identity = 93/249 (37.35%), Postives = 137/249 (55.02%), Query Frame = 2
Query:  179 TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTS----IFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELF-DYR 910
            T K C KS F  +NE++NIW+HL+GFI F Y     N I LP      +DH + ++ +    +CML S  YH F C S  M+Q W  +D+ GI  GL+G YL GIY A++CF      Y++  L + +          +   +    R      I+ ++  FG+ PTVHW++L  GF ++ V+ +   V+ LY L A +F+FY   +PE+ WPG+FD +G SHQ WH+ +L     W  SG +L  +YR
Sbjct:    2 TKKMCAKSAFHINNETINIWSHLLGFIYFTYQQYNTNYIVLPSIGSHPSDHFVFTLSIFGMQMCMLLSASYHTFGCTSIEMRQKWLKMDIFGISAGLLGMYLNGIYTAFFCFQDHLTSYIYILLGIFVITAYVPTRQDFFERKIIGSRVGLLHIIYCIIITFGICPTVHWVFLHGGFENDHVTKWFPNVVVLYSLIAAAFMFYVTMVPEKLWPGKFDVVGCSHQWWHIFILGAMIYWQQSGNQLLTEYR 250          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 107.842 bits (268), Expect = 1.042e-26
Identity = 79/283 (27.92%), Postives = 140/283 (49.47%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXX-----XVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI 931
            ++LKY  +P +L+ N F++ G+R    +  +C KSI+    E+ NIWTHLIG + F +         DN IQ       F + ++ S      ++C+  S  +H  SCHS  + + +  +D  GI + +IG ++P IY+ +YC    +  Y+     L I  ++  L  ++        R ++F+ +   GV+PT+H+I +++G  S         ++ +  L  L    Y  + PERF+PG+ D    SHQ++H  V+I  +  +    E+   R+   C +
Sbjct:   60 KVLKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQ-------FQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKITYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYI-ITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFARLNEQCPV 334          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 106.301 bits (264), Expect = 1.378e-25
Identity = 76/263 (28.90%), Postives = 133/263 (50.57%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXX-----XVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFY 871
            ++LKY  +P +L+ N F++ G+R    +  +C KSI+    E+ NIWTHLIG + F +         DN IQ       F + ++ S      ++C+  S  +H  SCHS  + + +  +D  GI + +IG ++P IY+ +YC    +  Y+     L I  ++  L  ++        R ++F+ +   GV+PT+H+I +++G  S         ++ +  L  L    Y  + PERF+PG+ D    SHQ++H  V+I  +
Sbjct:  159 KVLKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQ-------FQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKITYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYI-ITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAF 413          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 106.301 bits (264), Expect = 1.378e-25
Identity = 76/263 (28.90%), Postives = 133/263 (50.57%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXX-----XVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFY 871
            ++LKY  +P +L+ N F++ G+R    +  +C KSI+    E+ NIWTHLIG + F +         DN IQ       F + ++ S      ++C+  S  +H  SCHS  + + +  +D  GI + +IG ++P IY+ +YC    +  Y+     L I  ++  L  ++        R ++F+ +   GV+PT+H+I +++G  S         ++ +  L  L    Y  + PERF+PG+ D    SHQ++H  V+I  +
Sbjct:  159 KVLKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQ-------FQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKITYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYI-ITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAF 413          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0333277)

HSP 1 Score: 192.971 bits (489), Expect = 6.612e-59
Identity = 103/294 (35.03%), Postives = 177/294 (60.20%), Query Frame = 2
Query:   68 NHNIQYSIKCER---LLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTL---SLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
             H   Y  K  +   L  +   P +LK+NP+I+ GYRT   + K C++SIF ++NE++NIW+HL G I+FI   I D  +Q    + S +D +++   L+C+ +CML S  YH+FSC SE   + + S+D  GI + L+  Y+ G+Y+A++C +  +  Y    L   +LAI+V I +L+    G      + ++ L+ + +G++P  HW     G  +E+V + + R++ +Y+L  ++F+FY  KIPER++ G+ DF+G SH  WH++++  FY WH++G+   +YR+ +GC 
Sbjct:   51 GHGPNYDDKLSKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFD--LQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTIALGMFALAIAVQIPRLNVSMNG------KVAVLLLWSAYGIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHWHNTGLVYAEYRLNNGCT 336          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0083021)

HSP 1 Score: 192.586 bits (488), Expect = 1.298e-58
Identity = 103/294 (35.03%), Postives = 177/294 (60.20%), Query Frame = 2
Query:   68 NHNIQYSIKCER---LLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTL---SLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
             H   Y  K  +   L  +   P +LK+NP+I+ GYRT   + K C++SIF ++NE++NIW+HL G I+FI   I D  +Q    + S +D +++   L+C+ +CML S  YH+FSC SE   + + S+D  GI + L+  Y+ G+Y+A++C +  +  Y    L   +LAI+V I +L+    G      + ++ L+ + +G++P  HW     G  +E+V + + R++ +Y+L  ++F+FY  KIPER++ G+ DF+G SH  WH++++  FY WH++G+   +YR+ +GC 
Sbjct:   61 GHGPNYDDKLSKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFD--LQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTIALGMFALAIAVQIPRLNVSMNG------KVAVLLLWSAYGIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHWHNTGLVYAEYRLNNGCT 346          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0083019)

HSP 1 Score: 192.586 bits (488), Expect = 1.298e-58
Identity = 103/294 (35.03%), Postives = 177/294 (60.20%), Query Frame = 2
Query:   68 NHNIQYSIKCER---LLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTL---SLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
             H   Y  K  +   L  +   P +LK+NP+I+ GYRT   + K C++SIF ++NE++NIW+HL G I+FI   I D  +Q    + S +D +++   L+C+ +CML S  YH+FSC SE   + + S+D  GI + L+  Y+ G+Y+A++C +  +  Y    L   +LAI+V I +L+    G      + ++ L+ + +G++P  HW     G  +E+V + + R++ +Y+L  ++F+FY  KIPER++ G+ DF+G SH  WH++++  FY WH++G+   +YR+ +GC 
Sbjct:   61 GHGPNYDDKLSKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFD--LQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTIALGMFALAIAVQIPRLNVSMNG------KVAVLLLWSAYGIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHWHNTGLVYAEYRLNNGCT 346          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0083020)

HSP 1 Score: 192.586 bits (488), Expect = 1.298e-58
Identity = 103/294 (35.03%), Postives = 177/294 (60.20%), Query Frame = 2
Query:   68 NHNIQYSIKCER---LLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTL---SLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
             H   Y  K  +   L  +   P +LK+NP+I+ GYRT   + K C++SIF ++NE++NIW+HL G I+FI   I D  +Q    + S +D +++   L+C+ +CML S  YH+FSC SE   + + S+D  GI + L+  Y+ G+Y+A++C +  +  Y    L   +LAI+V I +L+    G      + ++ L+ + +G++P  HW     G  +E+V + + R++ +Y+L  ++F+FY  KIPER++ G+ DF+G SH  WH++++  FY WH++G+   +YR+ +GC 
Sbjct:   61 GHGPNYDDKLSKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFIGLTIFD--LQFLRLHASLSDQVLVVCLLVCFCLCMLMSAIYHIFSCKSEEHYELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTIALGMFALAIAVQIPRLNVSMNG------KVAVLLLWSAYGIIPLGHWAVAMGGLENELVRLMVPRIVLMYLLCLVAFVFYAAKIPERWFTGKVDFVGHSHNWWHLIIVAAFYHWHNTGLVYAEYRLNNGCT 346          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084284)

HSP 1 Score: 115.931 bits (289), Expect = 2.070e-29
Identity = 80/278 (28.78%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGF----RSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITH 919
            ++  Y ++P +L+ N F+  G+R    + + C KSIF+   E+ NIWTHL+G I FI   +    I  P       + ++     +  I+C+  S  +H  SCHS  M + +  +D  GI + ++G ++P +Y+ +YC    +  Y+     L I  ++  L  ++        R  +F+   + GV+P +H+  +   F    R+ +  + L  +  LY+LGAL    Y  ++PER++PG+FD  G SHQI+H+LV+   +  +    E+  YR+ +
Sbjct:   80 KVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALY--FISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGL--LYILGAL---LYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMY 350          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Zebrafish
Match: paqr3b (progestin and adipoQ receptor family member IIIb [Source:ZFIN;Acc:ZDB-GENE-050913-128])

HSP 1 Score: 258.455 bits (659), Expect = 1.183e-84
Identity = 123/277 (44.40%), Postives = 187/277 (67.51%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
            RL  Y  IP++LK NP+I  GYR     K C+KSIF  SNE+VNIW+HL+GF++F    + D    LP    S  D++I SIGL C+ +CML SVGYHLF CH SE   + W ++D  GI +G++GCY+PG+++A+YC S W++ Y+   L+L ++V   Q+ P Y   +    R+ +F ++A +G++P  HW++++ GF SEIV +F  RV+ +Y++ A +F+FY  KIPER++PG+ +++G+SHQ+WHVLV++ FY WH + V + +YR    C 
Sbjct:   29 RLYTYEQIPMFLKENPYITDGYRAHLPSKLCLKSIFILSNETVNIWSHLLGFLLFFSLGVNDMATVLPSAGASREDYVIYSIGLFCFQVCMLCSVGYHLFCCHRSEKTCRRWLALDYAGISVGILGCYVPGVFYAFYCNSFWRQVYLLTVLALILAVFAAQIHPLYLSQQWKKLRSLMFCLVAAYGIIPACHWVWINGGFSSEIVKVFFPRVMIMYLIAASAFLFYVSKIPERYFPGQLNYVGASHQLWHVLVVVMFYWWHQTAVYIMNYRHNQPCG 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Zebrafish
Match: paqr3b (progestin and adipoQ receptor family member IIIb [Source:ZFIN;Acc:ZDB-GENE-050913-128])

HSP 1 Score: 258.455 bits (659), Expect = 1.183e-84
Identity = 123/277 (44.40%), Postives = 187/277 (67.51%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
            RL  Y  IP++LK NP+I  GYR     K C+KSIF  SNE+VNIW+HL+GF++F    + D    LP    S  D++I SIGL C+ +CML SVGYHLF CH SE   + W ++D  GI +G++GCY+PG+++A+YC S W++ Y+   L+L ++V   Q+ P Y   +    R+ +F ++A +G++P  HW++++ GF SEIV +F  RV+ +Y++ A +F+FY  KIPER++PG+ +++G+SHQ+WHVLV++ FY WH + V + +YR    C 
Sbjct:   29 RLYTYEQIPMFLKENPYITDGYRAHLPSKLCLKSIFILSNETVNIWSHLLGFLLFFSLGVNDMATVLPSAGASREDYVIYSIGLFCFQVCMLCSVGYHLFCCHRSEKTCRRWLALDYAGISVGILGCYVPGVFYAFYCNSFWRQVYLLTVLALILAVFAAQIHPLYLSQQWKKLRSLMFCLVAAYGIIPACHWVWINGGFSSEIVKVFFPRVMIMYLIAASAFLFYVSKIPERYFPGQLNYVGASHQLWHVLVVVMFYWWHQTAVYIMNYRHNQPCG 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Zebrafish
Match: paqr3b (progestin and adipoQ receptor family member IIIb [Source:ZFIN;Acc:ZDB-GENE-050913-128])

HSP 1 Score: 258.455 bits (659), Expect = 1.183e-84
Identity = 123/277 (44.40%), Postives = 187/277 (67.51%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
            RL  Y  IP++LK NP+I  GYR     K C+KSIF  SNE+VNIW+HL+GF++F    + D    LP    S  D++I SIGL C+ +CML SVGYHLF CH SE   + W ++D  GI +G++GCY+PG+++A+YC S W++ Y+   L+L ++V   Q+ P Y   +    R+ +F ++A +G++P  HW++++ GF SEIV +F  RV+ +Y++ A +F+FY  KIPER++PG+ +++G+SHQ+WHVLV++ FY WH + V + +YR    C 
Sbjct:   29 RLYTYEQIPMFLKENPYITDGYRAHLPSKLCLKSIFILSNETVNIWSHLLGFLLFFSLGVNDMATVLPSAGASREDYVIYSIGLFCFQVCMLCSVGYHLFCCHRSEKTCRRWLALDYAGISVGILGCYVPGVFYAFYCNSFWRQVYLLTVLALILAVFAAQIHPLYLSQQWKKLRSLMFCLVAAYGIIPACHWVWINGGFSSEIVKVFFPRVMIMYLIAASAFLFYVSKIPERYFPGQLNYVGASHQLWHVLVVVMFYWWHQTAVYIMNYRHNQPCG 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Zebrafish
Match: paqr3a (progestin and adipoQ receptor family member IIIa [Source:ZFIN;Acc:ZDB-GENE-040426-1667])

HSP 1 Score: 253.447 bits (646), Expect = 1.336e-82
Identity = 121/276 (43.84%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  +P +L+ NP+I  GYR   T + CIKSIF  SNE+VNIW+HL+GF +F    + D +  LP+   S  D++I SIGL C+ +CML SVG+HLF CH SE   + W ++D  GI IG+IGCY+PG+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ +F  +A +G++PT HWI++S GF S+IV  FL +V+ +Y+L   + +FY  K+PER++PG+ +++GSSHQ+WH+LV++ FY WH + + +  YR +H C
Sbjct:   30 RLYTYEQVPAFLRENPYITDGYRAYLTSRLCIKSIFILSNETVNIWSHLLGFFLFFTLGVYDLLAVLPMLGASREDYVIYSIGLFCFQVCMLCSVGFHLFCCHRSEKTSRRWMALDYAGISIGIIGCYVPGVFYAFYCNNYWRQVYLVTVLAMMLAVFFAQIHPHYLSKKWQKLRSLLFCAVAGYGLIPTFHWIWISGGFGSQIVQEFLPKVLIMYLLAVAAIVFYMSKVPERYFPGQLNYLGSSHQVWHILVVLMFYWWHQAALFITSYRHSHPC 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Zebrafish
Match: paqr3a (progestin and adipoQ receptor family member IIIa [Source:ZFIN;Acc:ZDB-GENE-040426-1667])

HSP 1 Score: 253.447 bits (646), Expect = 1.336e-82
Identity = 121/276 (43.84%), Postives = 187/276 (67.75%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  +P +L+ NP+I  GYR   T + CIKSIF  SNE+VNIW+HL+GF +F    + D +  LP+   S  D++I SIGL C+ +CML SVG+HLF CH SE   + W ++D  GI IG+IGCY+PG+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ +F  +A +G++PT HWI++S GF S+IV  FL +V+ +Y+L   + +FY  K+PER++PG+ +++GSSHQ+WH+LV++ FY WH + + +  YR +H C
Sbjct:   30 RLYTYEQVPAFLRENPYITDGYRAYLTSRLCIKSIFILSNETVNIWSHLLGFFLFFTLGVYDLLAVLPMLGASREDYVIYSIGLFCFQVCMLCSVGFHLFCCHRSEKTSRRWMALDYAGISIGIIGCYVPGVFYAFYCNNYWRQVYLVTVLAMMLAVFFAQIHPHYLSKKWQKLRSLLFCAVAGYGLIPTFHWIWISGGFGSQIVQEFLPKVLIMYLLAVAAIVFYMSKVPERYFPGQLNYLGSSHQVWHILVVLMFYWWHQAALFITSYRHSHPC 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Xenopus
Match: atg4a (autophagy related 4A cysteine peptidase [Source:Xenbase;Acc:XB-GENE-922674])

HSP 1 Score: 245.743 bits (626), Expect = 1.642e-79
Identity = 121/276 (43.84%), Postives = 183/276 (66.30%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IPV+LK NP+I  GYR     K C+KS+F  SNE+VNIW+HL+GF++F    + D +  LP  N S  D +I SI L C+ +CML SVGYHLF CH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ IF  ++ +G++PTVHWI+L+ G  + IV  F  RVI +Y++ A++F+FY  K+PER++PG+ +++GSSHQ+WH+L ++  Y WH S V +  YR +  C
Sbjct:   29 RLYTYEQIPVFLKDNPYITDGYRAYLPSKLCLKSLFILSNETVNIWSHLLGFLLFFSLGVYDMMSVLPSANASREDFVICSICLFCFQVCMLCSVGYHLFCCHRSEKTSRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPSYLTQQWHRLRSVIFCSVSGYGIIPTVHWIWLNGGVGTSIVQEFAPRVIVMYIIAAVAFLFYISKVPERYFPGQLNYLGSSHQLWHILAVVMLYWWHQSTVYIMQYRHSQPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Xenopus
Match: adipor1 (adiponectin receptor 1 [Source:NCBI gene;Acc:493308])

HSP 1 Score: 118.242 bits (295), Expect = 6.066e-30
Identity = 89/314 (28.34%), Postives = 160/314 (50.96%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIKCE-----------RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVL----ICFYDWHSSGVELFDYRITHGCN 928
            ++LP+  +H ++   K E           R++ Y  +P +LK N ++  G+R    + + C +SIF+   E+ NIWTHL+GF++F+   ++  +           + ++  +  L  ++C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  Y+     L I+ ++     R+   +    R  +FL L + G+VPT+H+       ++  V      FL  V  +Y+ GA     Y  +IPERF+PG+FD    SHQI+HVLV+    I FY    S ++ F Y +  GC 
Sbjct:   71 LTLPLQAHHAME---KMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFRSIFRIHTETGNIWTHLLGFVLFLSLGVLTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGITAIVVAQWDRFATPKHRPTRAGVFLGLGLSGIVPTLHFTIAEGFVKATTVGQMGWFFLMAV--MYITGA---GLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFIHFYG--ISNLQEFRYALEGGCT 374          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Xenopus
Match: rec8 (REC8 meiotic recombination protein [Source:Xenbase;Acc:XB-GENE-957047])

HSP 1 Score: 85.8853 bits (211), Expect = 1.150e-18
Identity = 79/286 (27.62%), Postives = 131/286 (45.80%), Query Frame = 2
Query:   89 IKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICM---LSSVGYHLFSCH--SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI 931
            +   RLL ++S P +L++N F+ +GYR   +  +C++S+F   NE  NI+TH     I +   ++   +Q+P    S     +  +GL+ Y+ C+   L SV YHLF  H    P+     ++D+ GIC+      LP IY    C+ + +   +    +L+  V+   +S     H +  +  S     A    +  + W  L  G  S +    L   + L     L  I    ++PER  PG+FD+  +SHQI HVLV+I     H        +  +H C +
Sbjct:   36 LSGPRLLDWASSPPHLQFNKFVLTGYRPVASGAECMRSLFYLHNELGNIYTH----GIPLLGFLLLLPLQIPWLQLS-----VPWLGLVHYLACVSPQLGSVVYHLFMNHHGGAPVYHKLLTLDMCGICLVNTLGALPIIYCTLLCYPSTRTLALLAYSALSSYVIFCAVS----AHSNISRLCSFAWQAAFRFFIFYLRWADLGFGHPSSLRCYLLMDGLAL-----LGGIINISRLPERLHPGKFDYWFNSHQIMHVLVVISILYLHWGVTSDLTWISSHSCPL 303          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Xenopus
Match: PAQR9 (progestin and adipoQ receptor family member IX [Source:NCBI gene;Acc:100495753])

HSP 1 Score: 59.3066 bits (142), Expect = 2.583e-9
Identity = 75/286 (26.22%), Postives = 118/286 (41.26%), Query Frame = 2
Query:  149 FIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCY----IICMLSSVGYHLFSCHSEPMQQFWFSIDLTGIC--------------IGLIGCYLPGIYFAYYCFSAWQK--------FYMFFTLSLA--ISVLIFQLSPRYRGHE---SFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYD---WHSSGVELF 901
            FI SGYR  + T ++C+ SIFQ +NE++N WTH I  ++F     V     +         H    + L CY    ++    S   H+FSC S  ++  +F +D   I               +  +    P +   Y     W +         Y    L +A  ++V       + R  +    F  RT +F  + +    P +    L +  R    ++F+    R + L   +F F   KIPER  PG FD IG SHQ++H+   +  YD   +   G+ELF
Sbjct:   53 FILSGYRRLHLTAQECLASIFQPTNETLNFWTHFIPLVLF-----VSKFYHVFFLATELPFHHPALLPLWCYASGVLLTFAMSCTAHVFSCRSLRLRAAFFFLDYASISYYGFASTVAYSYYLLPRLSLLDPAVMTPYLQSLGWHQVDYSMLMGLYGKLVLPVAFILAVTCTVACCKSRAEDCSYPFAIRTFVF-AMPLSMACPVMIESLLFD-LRKRNPTLFVHFYRRYFWLLVAAF-FNVSKIPERIHPGLFDIIGHSHQLFHIFTFLSIYDQMHYVEQGLELF 330          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Xenopus
Match: hspa1l (heat shock protein family A (Hsp70) member 1 like [Source:Xenbase;Acc:XB-GENE-6045069])

HSP 1 Score: 58.9214 bits (141), Expect = 2.801e-9
Identity = 70/262 (26.72%), Postives = 116/262 (44.27%), Query Frame = 2
Query:  119 SIPVYLKW-----NPFIKSGYRTS-YTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISI---GLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYY--------CFSAWQKFYMFFTLSLAISVLIFQLSPR-YRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHV 850
            SIP+Y+ +        I  GYR+   +   CI S+FQ +NE+VNIWTH I    F++ ++        L +G ++D  +  +    L C I  ++S+   H FS  S   +   F +D   + +  +G  +   Y AY          F  W  F       +  ++  +   P   R   S   RT+ F    +F  +P  + ++L +G      +  L   I   +L  L+   +   +PER  PG FD++G SHQ++HV
Sbjct:    2 SIPIYILFFKVFHEDSIICGYRSPCSSATACILSLFQMTNETVNIWTHFIPTWYFLWKMLSF------LYSGFWDDPFLWPLLVYQLSCCIYPLMSTCA-HTFSVMSTKARHICFFLDYGAVSLYSLGAAIA--YSAYVFPDRWVGGTFHRWYVFCAVMNTGICTALACYSRIPEVARPRLSKVLRTTAFAYPYLFDSIPLFYRLFLCSG-SGCAQNAALPMHIWHSILAFLTAFLFATHLPERLAPGCFDYVGHSHQLFHV 253          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Mouse
Match: Paqr3 (progestin and adipoQ receptor family member III [Source:MGI Symbol;Acc:MGI:2679683])

HSP 1 Score: 240.736 bits (613), Expect = 1.142e-77
Identity = 124/276 (44.93%), Postives = 179/276 (64.86%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IPV LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R  IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +YV+  L+F+FY  K+PER++PG+ +++GSSHQIWHVL ++  Y WH S V +  YR +  C
Sbjct:   29 RLYTYEQIPVSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRVIVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVVMLYWWHQSTVYVMQYRHSKPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Mouse
Match: Paqr3 (progestin and adipoQ receptor family member III [Source:MGI Symbol;Acc:MGI:2679683])

HSP 1 Score: 240.736 bits (613), Expect = 1.142e-77
Identity = 124/276 (44.93%), Postives = 179/276 (64.86%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IPV LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R  IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +YV+  L+F+FY  K+PER++PG+ +++GSSHQIWHVL ++  Y WH S V +  YR +  C
Sbjct:   29 RLYTYEQIPVSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRVIVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVVMLYWWHQSTVYVMQYRHSKPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Mouse
Match: Paqr3 (progestin and adipoQ receptor family member III [Source:MGI Symbol;Acc:MGI:2679683])

HSP 1 Score: 153.68 bits (387), Expect = 6.628e-45
Identity = 92/221 (41.63%), Postives = 127/221 (57.47%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGAL 760
            RL  Y  IPV LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC +                     + P Y   +    R  IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +YV+  L
Sbjct:   29 RLYTYEQIPVSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNN---------------------IHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRVIVMYVIALL 228          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Mouse
Match: Paqr3 (progestin and adipoQ receptor family member III [Source:MGI Symbol;Acc:MGI:2679683])

HSP 1 Score: 128.257 bits (321), Expect = 9.786e-36
Identity = 70/138 (50.72%), Postives = 91/138 (65.94%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYC 511
            RL  Y  IPV LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC
Sbjct:   29 RLYTYEQIPVSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYC 166          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Mouse
Match: Adipor1 (adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:1919924])

HSP 1 Score: 120.939 bits (302), Expect = 4.759e-31
Identity = 91/312 (29.17%), Postives = 160/312 (51.28%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIKCE-----------RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYD--WHSSGVELFDYRITHGCN 928
            ++LP+  +H ++   K E           R++ Y  +P +LK N ++  G+R    + + C KSIF+   E+ NIWTHL+GF++F++  I+  +           + ++  +  L  ++C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  Y+     L IS +I     R+   +    R  +FL L + GVVPT+H+       ++  V      FL  V  +Y+ GA     Y  +IPERF+PG+FD    SHQI+HVLV+   +   +  S ++ F Y +  GC 
Sbjct:   67 LTLPLQAHHAME---KMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAV--MYITGA---GLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCT 370          
BLAST of Progestin and adipoQ receptor family member 3 vs. UniProt/SwissProt
Match: sp|Q6TCG8|PAQR3_MOUSE (Progestin and adipoQ receptor family member 3 OS=Mus musculus OX=10090 GN=Paqr3 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 7.990e-77
Identity = 124/276 (44.93%), Postives = 179/276 (64.86%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IPV LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R  IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +YV+  L+F+FY  K+PER++PG+ +++GSSHQIWHVL ++  Y WH S V +  YR +  C
Sbjct:   29 RLYTYEQIPVSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRVIVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVVMLYWWHQSTVYVMQYRHSKPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. UniProt/SwissProt
Match: sp|Q6TCH7|PAQR3_HUMAN (Progestin and adipoQ receptor family member 3 OS=Homo sapiens OX=9606 GN=PAQR3 PE=1 SV=2)

HSP 1 Score: 236.884 bits (603), Expect = 2.176e-75
Identity = 121/276 (43.84%), Postives = 179/276 (64.86%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IP  LK NP+I  GYR     + CIKS+F  SNE+VNIW+HL+GF +F    I D    LP  + S  D +I SI L C+ +CML SVGYHLFSCH SE   + W ++D  GI IG++GCY+ G+++A+YC + W++ Y+   L++ ++V   Q+ P Y   +    R+ IF  ++ +GV+PT+HW++L+ G  + IV  F  RVI +Y++  L+F+FY  K+PER++PG+ +++GSSHQIWH+L ++  Y WH S V +  YR +  C
Sbjct:   29 RLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. UniProt/SwissProt
Match: sp|Q93ZH9|HHP1_ARATH (Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana OX=3702 GN=HHP1 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.793e-34
Identity = 87/287 (30.31%), Postives = 144/287 (50.17%), Query Frame = 2
Query:   80 QYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXV-----DNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            Q ++K   L+ Y  +P Y+K N +I + YR  ++I+    S+F F NES+N+WTHLIGFI F+   +      D    +  K+          + L   + C+L+S   HLF CHS+ +  F   ID  GI   +I  + P I++ + C   W   Y+    S+ I  +I   +P     +    R  +F  + +FG+VP  H + ++ G     V++  + ++ ++ L      FY  ++PER  PG FD +G SHQI+HV VL+     +++ +   D+R   GC
Sbjct:   48 QKTMKRRELMSYCELPEYMKDNEYILNYYRADWSIRDAFFSVFSFHNESLNVWTHLIGFIFFVALTVANIIHHDGFFPVDAKSPGNVTRWPFFVFLGGSMFCLLASSICHLFCCHSKELNVFLLRIDYAGITAMIITSFFPPIFYIFQCTPRWYFIYLAGITSMGIFTIITLFTPSLSAPKYRAFRALLFASMGLFGIVPAAHALVVNWGNPQRNVTLVYELLMAVFYLVGTG--FYVGRVPERLKPGWFDRVGHSHQIFHVFVLLGALSHYAAALLFLDWRDHVGC 332          
BLAST of Progestin and adipoQ receptor family member 3 vs. UniProt/SwissProt
Match: sp|Q96A54|PAQR1_HUMAN (Adiponectin receptor protein 1 OS=Homo sapiens OX=9606 GN=ADIPOR1 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.195e-30
Identity = 91/312 (29.17%), Postives = 160/312 (51.28%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIKCE-----------RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYD--WHSSGVELFDYRITHGCN 928
            ++LP+  +H ++   K E           R++ Y  +P +LK N ++  G+R    + + C KSIF+   E+ NIWTHL+GF++F++  I+  +           + ++  +  L  ++C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  Y+     L IS +I     R+   +    R  +FL L + GVVPT+H+       ++  V      FL  V  +Y+ GA     Y  +IPERF+PG+FD    SHQI+HVLV+   +   +  S ++ F Y +  GC 
Sbjct:   67 LTLPLQAHHAME---KMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAV--MYITGA---GLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCT 370          
BLAST of Progestin and adipoQ receptor family member 3 vs. UniProt/SwissProt
Match: sp|Q91VH1|PAQR1_MOUSE (Adiponectin receptor protein 1 OS=Mus musculus OX=10090 GN=Adipor1 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.329e-30
Identity = 91/312 (29.17%), Postives = 160/312 (51.28%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIKCE-----------RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYD--WHSSGVELFDYRITHGCN 928
            ++LP+  +H ++   K E           R++ Y  +P +LK N ++  G+R    + + C KSIF+   E+ NIWTHL+GF++F++  I+  +           + ++  +  L  ++C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  Y+     L IS +I     R+   +    R  +FL L + GVVPT+H+       ++  V      FL  V  +Y+ GA     Y  +IPERF+PG+FD    SHQI+HVLV+   +   +  S ++ F Y +  GC 
Sbjct:   67 LTLPLQAHHAME---KMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAV--MYITGA---GLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCT 370          
BLAST of Progestin and adipoQ receptor family member 3 vs. TrEMBL
Match: A0A2C9JGV9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056246 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.530e-91
Identity = 129/274 (47.08%), Postives = 192/274 (70.07%), Query Frame = 2
Query:  104 LLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            LLKY  +P +L+ NP++  GYR+      C+KS+  ++NE++NIWTH +GF +F+  ++ DN+I LP  NGS +DH+I++IGL C++ CML S G+H+F CHSE   + W + D+TG+  G+IGCYLP +++A+YC S W+  YM     L+  +LIF L P +  H+ F  R ++++ L  +G++PTVHWIYL+ G  S IV +F+ +V  +Y+LG+L+F FY  K PER +PG+FDFIGSSHQ+WH+L++I F  WH +G E+  YRI H C
Sbjct:   59 LLKYHEVPEFLRGNPYVVHGYRSLLPFNMCMKSLLFWTNETMNIWTHFMGFFVFLLLVLYDNIIALPSMNGSLSDHIILTIGLSCFMFCMLCSTGFHIFCCHSERASRRWLAFDMTGVTFGIIGCYLPAVHYAFYCLSIWRDLYMISITVLSACILIFNLHPHFFSHKWFYTRMALYVGLTAYGIIPTVHWIYLNGGISSHIVQMFIPKVTMMYMLGSLAFSFYITKFPERIFPGKFDFIGSSHQLWHILIVIAFCYWHKAGKEILMYRIAHEC 332          
BLAST of Progestin and adipoQ receptor family member 3 vs. TrEMBL
Match: A0A1S3HQ25 (progestin and adipoQ receptor family member 3 OS=Lingula unguis OX=7574 GN=LOC106156767 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 9.091e-89
Identity = 130/274 (47.45%), Postives = 191/274 (69.71%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHG 922
            +L KY+ +P +L+ NP+++ GYR   +   CIKS+F ++NE++NIW+HLIGF+IF    +VDN++ +P  +G F+DHLI++ GLLCY  CML S GYH+F+CHSE   + W   DL GI +GLIGCYLP +++A+YC S W+  Y+F    L+ +VL  QL PR      + KR  ++  LA +G++PT+HWIYLS G+  E+V +F+ +V+ +Y  G  +  FY  K PER++PG+ D+IGSSHQ WHV+V+  F+ WH++G E+F YRI H 
Sbjct:   52 QLYKYNEVPEFLQGNPYVRDGYRAFLSSNACIKSLFVWNNETINIWSHLIGFVIFCLCTLVDNIVMIPHYSGGFSDHLIVTAGLLCYQFCMLCSAGYHIFNCHSERASKRWLMTDLAGISVGLIGCYLPAVHYAFYCLSIWRDIYLFTVAILSAAVLFTQLHPRSFSPHWWTKRLILYCCLAAYGIIPTIHWIYLSGGWEEEMVQMFIPKVVIMYFFGMSALGFYLTKFPERYFPGKVDYIGSSHQWWHVIVVAAFFYWHAAGSEIFIYRIQHA 325          
BLAST of Progestin and adipoQ receptor family member 3 vs. TrEMBL
Match: K1PLJ9 (Progestin and adipoQ receptor family member 3 OS=Crassostrea gigas OX=29159 GN=CGI_10007924 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 6.245e-88
Identity = 133/276 (48.19%), Postives = 194/276 (70.29%), Query Frame = 2
Query:  104 LLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI 931
            L KY+ IP +L+ NP++  GYR       C+KSIF +SNES+NIW+HL+GF+IF+  ++ DN+I LP    SF+D+ ++S+GLLCY +CML SVG+H+F CHSE   + W ++DLTGI +G+IGCYLP +++A+YC S W+  Y F    L +S ++ QL  ++  H  F  R  I++ LA +GV+PT+HWIYL+ G ++EIV +F+ +V+ +Y  G L+ +FY  K PERF PG FD+IGSSHQ WH++V+  F  WH +G E+  YR +H C+I
Sbjct:   51 LYKYTDIPDFLQGNPYVIHGYRVMLPFSLCLKSIFVWSNESINIWSHLLGFLIFLLLMVYDNLIILPRTGSSFSDYFVVSLGLLCYQVCMLCSVGFHMFCCHSERASRRWLAVDLTGISLGVIGCYLPAVHYAFYCLSVWRDVYFFIITILTVSTIVIQLHRKFFSHGWFRYRILIYVFLAGYGVLPTIHWIYLNGGPQAEIVQLFIPKVMTIYCAGVLALVFYLSKFPERFLPGSFDYIGSSHQWWHIIVVAAFIYWHFAGQEILLYRQSHQCHI 326          
BLAST of Progestin and adipoQ receptor family member 3 vs. TrEMBL
Match: A0A210QNJ3 (Progestin and adipoQ receptor family member 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06293 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.005e-87
Identity = 130/275 (47.27%), Postives = 189/275 (68.73%), Query Frame = 2
Query:  104 LLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
            L KYS IP +L+ NP++  GYR       C+KS+F ++NE++NIW+HL+GFI+F +    DN + LP+   S+ DH+II++GL CY  CML S G+H+F+CHSE   + W +IDLTGI IG+IGCYLP +++A+YC S W+  Y+F    L+IS  +   +PRY  +E    R  +++ L  +GV+PT+HWIYL+ G  S+IV +F+ +V+ +Y LG ++ +FY  K PERF PG FDF+GSSHQ WHV+V+  F  WH +G ++  YRI H C+
Sbjct:   55 LFKYSEIPDFLQGNPYVVKGYRVFLPFSLCLKSLFVWNNETINIWSHLLGFIVFFFLAFYDNFMVLPVLKSSYTDHIIITLGLFCYQFCMLCSTGFHMFACHSERASKRWLAIDLTGISIGVIGCYLPAVHYAFYCLSIWRDIYLFIITCLSISTFVIMQNPRYFSNEWVNTRLMVYVGLVAYGVIPTLHWIYLNGGISSDIVQLFVPKVVIMYSLGVMALVFYLTKFPERFVPGLFDFVGSSHQWWHVIVVAAFTFWHYAGYDILLYRINHPCH 329          
BLAST of Progestin and adipoQ receptor family member 3 vs. TrEMBL
Match: A0A5N5KE44 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00141930 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 1.357e-84
Identity = 131/276 (47.46%), Postives = 189/276 (68.48%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  +P +L+ NP+I  GYR   T K CIKS+F  SNE+VNIW+HL+GF +F    + D +  LP+   S  D++I SIGL C+ +CML SVGYHLF CH SE   + W ++D  GI IG +GCY+PG+++A+YC + W++ Y+   L++ ++    Q+ P Y   +    R+ IF  +  +G++PTVHWI+LS GF SEIV  F+ RV+ +Y+L A++FIFY  K+PER++PG+ ++IGSSHQIWH+LVL+ FY WH S + + +YR TH C
Sbjct:   30 RLYTYEQVPGFLRENPYITDGYRAYLTSKLCIKSLFILSNETVNIWSHLLGFFLFFSLGVYDMIAVLPMVGASREDYVIYSIGLFCFQVCMLCSVGYHLFCCHRSEKTSRRWMALDYAGISIGTLGCYVPGVFYAFYCNNYWRQVYLIMVLAMTLAEFFAQIHPLYLTKKWQKLRSVIFCSVVAYGLIPTVHWIWLSGGFSSEIVQDFIPRVLIMYLLAAVAFIFYVSKVPERYFPGQLNYIGSSHQIWHILVLLMFYWWHQSALFITNYRHTHPC 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Cavefish
Match: paqr3b (progestin and adipoQ receptor family member 3-like [Source:NCBI gene;Acc:103037941])

HSP 1 Score: 261.922 bits (668), Expect = 5.461e-86
Identity = 126/277 (45.49%), Postives = 187/277 (67.51%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
            RL  Y  IPV+LK NP+I  GYR     K C+KSIF  SNE+VNIW+HL+GF++F    + D    LP    S  D++I SIGL C+ +CML SVGYHLF CH SE   + W S+D  GI +G++GCY+PG+++A+YC S W++ Y+   L+L ++V   Q+ P Y   E    R++IF  +A +G++P  HW++L+ GF +EIV +F  RV+ +Y++ A +F+FY  K+PER++PG+ +++G+SHQ+WHVLV++ FY WH + V +  YR +  C 
Sbjct:   29 RLYTYEQIPVFLKENPYITDGYRAHLPSKLCLKSIFVLSNETVNIWSHLLGFLLFFLLGVNDMSSVLPAAGASREDYVIYSIGLFCFQVCMLCSVGYHLFCCHRSEKTSRRWLSLDYAGISVGILGCYVPGVFYAFYCNSLWRQVYLVTVLALILAVFSAQIHPLYHTQEWKTLRSTIFCSVAGYGIIPACHWVWLNGGFHTEIVQVFFPRVMIMYLIAASAFLFYISKVPERYFPGQVNYLGASHQLWHVLVVLMFYWWHQTAVYIMHYRHSQPCQ 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Cavefish
Match: paqr3a (progestin and adipoQ receptor family member 3 [Source:NCBI gene;Acc:103028558])

HSP 1 Score: 254.218 bits (648), Expect = 4.651e-83
Identity = 126/276 (45.65%), Postives = 181/276 (65.58%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  +P +L+ NP+I  GYR   T + CIKSIF  SNE+VNIW+HL+GF +F    + D V  LP+   S  D++I SIGL C+ +CML SVGYHLF CH SE   + W ++D  GI IG +GCY+ G+++A+YC + W++ Y+   L++ + V   Q+ P Y        R+ +F  +A +G++PT HWI+LS GF S IV  F+ RV+ +Y L A +F+FY  K+PER++PG+ +++GSSHQIWH+LV+  FY WH S + +  YR  H C
Sbjct:   30 RLYTYEQVPAFLRENPYITDGYRAYLTSRLCIKSIFMLSNETVNIWSHLLGFFLFFSLGVYDMVSVLPVLGASREDYVIYSIGLFCFQVCMLCSVGYHLFCCHRSEKTSRRWMALDYAGISIGTLGCYVLGVFYAFYCNNYWRQVYLVTVLAMTLGVFFAQIHPHYLTKNWQKLRSIMFFSVAAYGLIPTFHWIWLSGGFSSAIVQNFVPRVLIMYFLAAAAFVFYVSKVPERYFPGQLNYVGSSHQIWHILVVFLFYWWHQSALFITSYRQEHPC 305          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Cavefish
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:103034013])

HSP 1 Score: 113.235 bits (282), Expect = 2.570e-28
Identity = 87/287 (30.31%), Postives = 148/287 (51.57%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLI-----FQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLI-CFYDWHS-SGVELFDYRITHGC 925
            R++ +  +P +LK N F+  G+R    + + C KSIF+   E+ NIWTHL+G + F+   I             F + ++I +  L  I+C+  S  +H   CHSE + + +  +D +GI   ++G ++P +Y+++YC       Y+     L ++ +      F  +P+YRG      R  +F+ L + GVVP++H++      R+  +     +FL  V  LY+ GA     Y  +IPERF+PG+ D    SHQ++H+LV+   F  +H  S ++ F Y    GC
Sbjct:   86 RVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGIFYMFRPNMSFVAPFQEKIVIGMFFLGAILCLSFSWLFHTVYCHSEGVSRVFSKLDYSGIAFLIMGSFVPWLYYSFYCSPQPCFIYLIVVCVLGLAAITVSQCDFFATPQYRG-----VRAGVFVGLGLSGVVPSLHFVITEGFLRATTMGQMGWLFLMAV--LYITGA---CLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSNLQEFRYTAGGGC 362          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Cavefish
Match: adipor1b (adiponectin receptor 1 [Source:NCBI gene;Acc:103027515])

HSP 1 Score: 110.153 bits (274), Expect = 3.564e-27
Identity = 80/283 (28.27%), Postives = 144/283 (50.88%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVI--RLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVL----ICFYDWHSSGVELFDYRITHGCN 928
            R++ Y  +P +LK N ++  G+R    + + C  SIF+   E+ NIW+H++G I+F++   +  +           + ++  +  L  ++C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  Y+     L IS +I     R+        R  +FL L + GV+PT+H+       ++  V      ++   +Y+ GA     Y  +IPERF+PG+ D    SHQI+HVLV+    I FY    S ++ F Y +  GC 
Sbjct:   99 RVIPYQLLPDWLKDNDYLLHGHRPPMPSFRACFGSIFRIHTETGNIWSHMLGLILFLFLGTLTMLRPNVSFMAPLQEKVVFGMFFLGAVLCLCFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSVVCVLGISAIIVAQWDRFATPRHRPTRAGVFLGLGLSGVIPTMHFTIAEGFVKATTVGQMGWFILMGAMYITGA---GLYAARIPERFFPGKCDIWFQSHQIFHVLVVAAAFIHFYG--ISNLQEFRYGLGGGCT 376          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Cavefish
Match: paqr4a (progestin and adipoQ receptor family member 4-like [Source:NCBI gene;Acc:103035550])

HSP 1 Score: 83.1889 bits (204), Expect = 5.146e-18
Identity = 72/263 (27.38%), Postives = 126/263 (47.91%), Query Frame = 2
Query:   89 IKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICM---LSSVGYHLFSCHS--EPMQQFWFSIDLTGIC-IGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVL 859
            +   RLL +++ P +L++N ++ +GYR   +++ CI+S+F   NE  NI+TH I  + F+  L           N  ++   +  +G++ ++ C+   L SV YHLF  H   EP+ +   ++D+ GIC I  +G  LP +Y    C+   +   +   + L+   +   ++ R R      +R   F   A+F       +  L            L+  + +  L  +  +    +IPERF PG FD+  +SHQI HVLV+
Sbjct:    4 LNGPRLLDWANSPPHLQFNKYVLTGYRPISSVQDCIRSLFYLHNELGNIYTHGIPLLCFLVLL---------PLNIPWSQITVTWLGVVHFLACLSPQLGSVVYHLFMNHEGGEPVYKTLLTLDMCGICMINTLGA-LPIVYSTLLCYPFTRTVALVIYILLSSYAIYCAITARSR-----VRRLRSFAWQALF----RFSFFLLRGVGVGGGSPTSLRHFLTMDALAVVGGVINITRIPERFRPGLFDYWCNSHQIMHVLVV 247          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Sea Lamprey
Match: paqr3b (progestin and adipoQ receptor family member IIIb [Source:ZFIN;Acc:ZDB-GENE-050913-128])

HSP 1 Score: 223.787 bits (569), Expect = 6.818e-72
Identity = 116/285 (40.70%), Postives = 180/285 (63.16%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIK------SIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIF--QLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
            RL  Y  +P +LK NP+I  GYR     + C+K      S+F  SNE+VNIW+HL GF++F +  + D ++ LP    S +D++I +I L C+ +CML S GYHLF CH SE   + W ++D  GI +GL+GCY+PG+++A+YC     + ++F    + I +L+F   + P+Y   + +  R  I   ++++GV+PTVHWI L+ G  + IV  F  RV+ +Y+L  ++F+FY  K+PER++PG  +F+GSSHQ WH+LV+  FY WH + V +  YR +  C+
Sbjct:   29 RLYTYEQVPCFLKGNPYITDGYRAYLPSRLCLKRCRCVNSVFIVSNETVNIWSHLFGFLLFFFLGVYDTLVMLPAAQASHDDYIIYTIFLFCFQVCMLCSTGYHLFCCHRSEKTSRRWLALDYAGISVGLLGCYIPGVFYAFYC-----EEFVFLINIVNIMLLVFFAHIHPQYFSPQWYTTRLVILSCVSLYGVIPTVHWIVLNGGPTTTIVQDFSPRVMIMYLLAGVAFVFYVGKVPERYFPGHVNFVGSSHQCWHILVVFMFYWWHQTAVLIMKYRHSTPCH 308          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Sea Lamprey
Match: adipor2 (adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-041210-60])

HSP 1 Score: 120.553 bits (301), Expect = 6.595e-32
Identity = 90/286 (31.47%), Postives = 152/286 (53.15%), Query Frame = 2
Query:  104 LLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSF----NDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVL-ICFYDWHS-SGVELFDYRITHGCN 928
            +L +  +P +LK N ++  G+R    + + C +SIF+   E+ NIWTHLIGF++F+        I L   N +F     + ++     L  I+C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  YM  T  L ++ ++     R+   E    R  +FL L + G+VPT+H++      ++  V     +FL  V  LY+ GA     Y  +IPERF+PG+ D    SHQI+HVLV+   F  +H  S ++ F Y +  GC+
Sbjct:   60 VLSHDLLPDWLKDNDYLLHGHRPPMPSFRACFRSIFRIHTETGNIWTHLIGFLLFLIL----GTIYLLRPNIAFIAPLQEKVVFGTFFLGAILCLCFSWLFHTVYCHSESVSKIFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRIIYMVTTSVLGVAAIVVSQWDRFATPEYRAVRAGVFLGLGLSGIVPTIHFMIAEGFIKAATVGQIGWLFLMAV--LYITGA---ALYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFVHFHGVSNLQEFRYTLGGGCS 336          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Sea Lamprey
Match: adipor1b (adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2896])

HSP 1 Score: 119.013 bits (297), Expect = 4.064e-31
Identity = 93/313 (29.71%), Postives = 163/313 (52.08%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIK--CE------RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSF----NDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVL--ICFYDWHSSGVELFDYRITHGCN 928
            ++LP+  +H ++   +  C+      R++ +  +P +L+ N F+  G+R    + + C +SIF+   E+ NIWTHLIGF +F+    V  VI L   N SF     + ++  +  +  I+C+  S  +H   CHSE + + +  +D +GI + ++G ++P +Y+++YC    +  Y+     L I+ ++     R+   +    R ++FL L   G+VPTVH++ +    R+        +FL  +  LY +GA     Y  +IPERF+PG  D    SHQI+HVLV+   C +    S ++ F Y +  GC 
Sbjct:   64 ITLPLQAHHAMEKMEEFVCKVWQGRWRVIPHDVLPSWLQDNEFLLQGHRPPMPSFRACFRSIFRLHTETGNIWTHLIGFFLFV----VLAVIYLFRPNMSFVAPLQEKVVFGVFFMGAILCLCFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPRLIYLVTICVLGIAAIVVSQWERFSTPQYRVLRAAVFLSLGFSGIVPTVHFMVVEGFMRATTAGQTGWLFLMGL--LYSMGA---ALYAARIPERFFPGMCDIWFHSHQIFHVLVVAAACVHFHGVSKLQEFRYSVGGGCT 367          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003422.1 (pep scaffold:Pmarinus_7.0:GL479692:543133:563138:1 gene:ENSPMAG00000003131.1 transcript:ENSPMAT00000003422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 3.441e-14
Identity = 75/264 (28.41%), Postives = 116/264 (43.94%), Query Frame = 2
Query:   98 ERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHS--EPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVP-TVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWH 880
             RLL ++S P +L++N F+ +GYR   T   C+ S+F   NES NI++H +  + F+  L         L  G  +   + +   L      L SV YHLF  H+    + +    +D+ GIC       L  IY ++ C    Q   M     L  SVL      R     +   R   F   A F +   T  W  L+      +    L  ++ +   GA++      ++PER+ PGRFD+  +SHQI HV+V++     H
Sbjct:    7 PRLLDWASCPPHLRFNKFVLAGYRPVSTGSDCLHSLFYLHNESGNIYSHGLPLLWFLLVLPPS------LPWGRLHTPWLAAAHCLACACPPLGSVFYHLFMNHTGGPAVYRRLLCLDMCGICAITSLGALSIIYCSFLCRPVLQTLGM-----LGYSVLSLIALHRAVSASTNNARLRAFGWQAAFRMACYTCRWAGLATTSLGALRHYVLMDLVAM-AGGAIN----VSRVPERWLPGRFDYWFNSHQIMHVMVVLSILHLH 254          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Sea Lamprey
Match: paqr8 (progestin and adipoQ receptor family member VIII [Source:ZFIN;Acc:ZDB-GENE-030728-3])

HSP 1 Score: 52.373 bits (124), Expect = 3.886e-8
Identity = 66/250 (26.40%), Postives = 110/250 (44.00%), Query Frame = 2
Query:  149 FIKSGYRT-SYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVP-TVHWIYLSNGFRSEIVS---------IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLIC 865
            +I SGYR      +    S+F   NE  N+WTHL+G ++ +    V  + +L              + L       LS+V  HLF   SE     +F +D  G+ +   G  + G YF  YC       ++   + L  + ++  LS       + C R    L   +F V+P  V ++ + +     +V+         +F    +  ++L A+ F F    +PE+  PGRF+ +G SHQI+HVL+ +C
Sbjct:   10 YITSGYRPPGQPWRFYALSLFARHNEIANVWTHLLGTLLVLAR--VGKIPELAATRADIASWPFFLLALSGAAYMALSTVA-HLFHSRSELAHYGFFFLDYVGVALYQYGSAV-GHYF--YCAGPGGFAFLRDDVYLPTTWMLAWLSCAGCCFANLCFRMPHSLGRKLFKVLPCAVAYVVVISPIAHRLVTSSPNHDPAFVFHVAQVAFFLLSAVFFTF---PLPEQLKPGRFNVLGHSHQIFHVLLSLC 250          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Yeast
Match: IZH1 (Membrane protein involved in zinc ion homeostasis; member of the four-protein IZH family; transcription is regulated directly by Zap1p, expression induced by zinc deficiency and fatty acids; deletion increases sensitivity to elevated zinc; IZH1 has a paralog, IZH4, that arose from the whole genome duplication [Source:SGD;Acc:S000002900])

HSP 1 Score: 104.375 bits (259), Expect = 2.176e-26
Identity = 83/269 (30.86%), Postives = 141/269 (52.42%), Query Frame = 2
Query:   92 KCERLLKYSSIPVYLKWNPFIKSGY-RTSYTIKQCIKSIFQFSNESVNIWTHXX-XXXXXXXXXXVDNVIQLPL-KNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYL-PGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRV--------IRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLI 862
            K + L  +  +P + K N  I +GY R + + K+C+ S+F ++NE+VNI+THL+   + F++ + + N   +P+  + S++D+ +I+I L+    C++ S  +H    HSE    FW  +D  GI I LI C + P IYF Y+   ++   +   TL LA    +  L  ++        R   F++    G++P      L+ GF    +   L R+           Y+ GA+ + F   +IPE   PG+FDF GSSHQI+H++V++
Sbjct:   36 KQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGI-ISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLP------LTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGF---RIPETLAPGKFDFFGSSHQIFHIMVVL 294          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Yeast
Match: IZH2 (Plasma membrane receptor for plant antifungal osmotin; involved in zinc ion homeostasis, apoptosis; negatively regulates ZRT1 and other functionally divergent genes through CCCTC promoter motif (IzRE); modulates FET3 activity in iron-independent manner; affects gene expression by influencing balance of competition between Msn2p/Msn4p and Nrg1p/Nrg2p for binding to IzRE; transcription regulated by Zap1p, zinc, fatty acid levels; homolog of mammalian adiponectin receptor [Source:SGD;Acc:S000005362])

HSP 1 Score: 92.8189 bits (229), Expect = 3.293e-22
Identity = 77/268 (28.73%), Postives = 130/268 (48.51%), Query Frame = 2
Query:   98 ERLLKYSSIPVYLKWNPFIKSGY-RTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMF-----FTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS------IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLIC 865
             RL  +  IP + + N FI  GY + + +  +  KS+F   NESVNI++HLI  + F   L++D          ++ DH++I +       C++ S  +H    HS  +      +D  GICI ++   +  +Y+ Y+     +KF +F      T+S  I+  I  L  ++R  E    R  +F+   +  ++P    +Y  +   SEI +      + L  V  LY++GA   + Y  + PE+  PG+FD  G SHQ++H LV+I 
Sbjct:   37 RRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYF-----EKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYS--FSEIWTQIQLFWVLLGGV--LYIIGA---VLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIA 292          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Yeast
Match: IZH3 (Membrane protein involved in zinc ion homeostasis; member of the four-protein IZH family, expression induced by zinc deficiency; deletion reduces sensitivity to elevated zinc and shortens lag phase, overexpression reduces Zap1p activity [Source:SGD;Acc:S000004013])

HSP 1 Score: 69.707 bits (169), Expect = 1.008e-13
Identity = 76/253 (30.04%), Postives = 123/253 (48.62%), Query Frame = 2
Query:   68 NHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQ---FSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHL--IISIGLLCYIICMLSSVGYHLFSCHS-EPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISV--LIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSN-GFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERF 799
            NH   YS+   + L Y  +P   + N +I  GYR   T  + + SIF    + NE+ NIW+HL+G I  IY  I D       +N         I+ + L   + CMLSSV +H F+  S   ++  +  +D +GI I +    L   +   Y  S +   Y + ++SLA+ V  +    SPR+   E+   R   F++LA  GV+  +H I+L++  + + + S    + +  Y++G    +FY   IPERF
Sbjct:  203 NHGKAYSLGETQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMY--SCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGV---VFYGSFIPERF 450          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Nematostella
Match: EDO36328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIY6])

HSP 1 Score: 248.825 bits (634), Expect = 2.355e-81
Identity = 126/285 (44.21%), Postives = 182/285 (63.86%), Query Frame = 2
Query:   77 IQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLP-LKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCN 928
            +Q   K   L  Y  IP +L+ N ++ +GYR    ++ CIKS+F +SNE++NIWTHL+GF++F +  + +N++ LP +K  +  DH++ S  L+ + IC+L S GYHLF+CHSE +   WFS+DL GI +GL  CY+P +Y+AYYC    Q  Y+     L    L  Q  PR+       +R  +F  L  +GVVP+VHW YLS G+   +V IF+ +VI +YVLG L+ +FY  K+PER++PG+ +FIGSSHQ WHVL+L  FY W+ S +   DYR T+ C 
Sbjct:   20 LQQQGKDINLFDYHEIPYFLRGNVYVTNGYRAYLPVRMCIKSLFVWSNETINIWTHLLGFLVFSFLFLYNNIVVLPHIKGATIADHMVFSALLIGFQICLLCSTGYHLFNCHSEKIFHRWFSLDLAGISLGLCSCYIPAVYYAYYCHVGLQTLYLVGVGILTTITLTLQFHPRFLSSVWATRRLLLFCCLVAYGVVPSVHWAYLSGGWDQPVVQIFIPKVIVMYVLGVLALVFYALKVPERYFPGKMNFIGSSHQWWHVLILAAFYWWYRSNLIYLDYRSTNQCT 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Nematostella
Match: EDO36050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS3])

HSP 1 Score: 104.76 bits (260), Expect = 4.249e-26
Identity = 72/252 (28.57%), Postives = 133/252 (52.78%), Query Frame = 2
Query:  107 LKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKN---GSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIY---LSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQI 841
            L +  +P +L+ N F++  +R    + K C KS+F+   E+ NIWTH IGF+ FI  ++   +  +   N     + + L+        I+C+  S  +H   CHS  + + +  +D +GI + ++G ++P +Y+ +YC +  +  YM   +S+ +  ++  L  ++   +  C R  +FL     GVVP +H++    ++   R   V  ++  +  LY+LGA++   Y  ++PERF+PGRF+    SHQI
Sbjct:   26 LSHIELPHWLRDNEFLEDSHRPPLNSFKSCFKSMFKIHTETGNIWTHFIGFLAFIAAMLYMYIRPVSADNPFPKDWTEKLVFGAFFAGAILCLGFSWIFHTVYCHSANVSKVFSRLDYSGIALLIMGSFIPPLYYGFYCDTTTRNVYMGVIVSMGLLSVLVSLWSKFNTPKYRCLRAGVFLTFGCSGVVPAIHFVAAHGVAIAHRQASVG-WMALMGLLYILGAIA---YASRMPERFFPGRFNIWFQSHQI 273          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Nematostella
Match: EDO36051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS3])

HSP 1 Score: 104.76 bits (260), Expect = 4.249e-26
Identity = 72/252 (28.57%), Postives = 133/252 (52.78%), Query Frame = 2
Query:  107 LKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKN---GSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIY---LSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQI 841
            L +  +P +L+ N F++  +R    + K C KS+F+   E+ NIWTH IGF+ FI  ++   +  +   N     + + L+        I+C+  S  +H   CHS  + + +  +D +GI + ++G ++P +Y+ +YC +  +  YM   +S+ +  ++  L  ++   +  C R  +FL     GVVP +H++    ++   R   V  ++  +  LY+LGA++   Y  ++PERF+PGRF+    SHQI
Sbjct:   26 LSHIELPHWLRDNEFLEDSHRPPLNSFKSCFKSMFKIHTETGNIWTHFIGFLAFIAAMLYMYIRPVSADNPFPKDWTEKLVFGAFFAGAILCLGFSWIFHTVYCHSANVSKVFSRLDYSGIALLIMGSFIPPLYYGFYCDTTTRNVYMGVIVSMGLLSVLVSLWSKFNTPKYRCLRAGVFLTFGCSGVVPAIHFVAAHGVAIAHRQASVG-WMALMGLLYILGAIA---YASRMPERFFPGRFNIWFQSHQI 273          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Nematostella
Match: EDO46359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQG1])

HSP 1 Score: 85.1149 bits (209), Expect = 8.311e-19
Identity = 74/284 (26.06%), Postives = 124/284 (43.66%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQF--WFSIDLTGI-CIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVP------TVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            +L      P +L++N F+ +GYR  YT+ +C+ S+    NESVNI++H I  ++ +       +I L             S+          SS  YHLF CH +    +    + D+ GI  +   G  L GI    +CF  W+   +   + ++   L F L  R             F+ L +FGV+        +   YL  G  S+     L   + + +   +  +    ++PE+++PG+FD IG+SHQI HVL +I     H    + F++   + C
Sbjct:   84 KLCSLQCCPSWLQFNKFVLTGYRCDYTVSECLDSLLYVHNESVNIYSHGIPCVLMMI------LIPLTASQACLESSFWFSLHYFACFAPFFSSPIYHLFMCHKQGSTAYNGLLTFDMCGIWAVNTFGA-LCGIRATLFCFPIWRMTALITYILISFISLYFILGARTPKER--------FVPLTVFGVMRYLFIGVRLFLRYLGYGCGSDGA---LPYCVLMDLFACVGGVINIARVPEKWFPGQFDIIGNSHQIMHVLSVISVIFLHLGSSKEFEWMAEYKC 349          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Nematostella
Match: EDO49851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV2])

HSP 1 Score: 84.3445 bits (207), Expect = 1.533e-18
Identity = 85/284 (29.93%), Postives = 133/284 (46.83%), Query Frame = 2
Query:   59 IYNNHNI-QYSIKCERLLKYSSIPVYLKWNPFIKSGYRT-SYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLP---LKNGSFNDHLI---ISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYM------FFTLSLAISVLIFQL--SPRYR-GHESFCKRTSIFLVLAIFGVVP-TVHWIYLSNGFRSEIVS-IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVL 853
            I NN+N+ Q++   E+ L       +    PFI SGYR   ++ KQCI S F   NE++N+W+H++  + F+Y+        LP   L++  F D  +   +S  L    + ++SS   HLF+C S  ++   F  D   I       +  G+ F YY         +      F  +S AIS+    L  + R++     F  RT  F++  +F  +P T   IY  +      V+  + +R +  + L ALS +    +IPERF PG FDF G SH   H+L
Sbjct:    2 INNNNNLKQHTEVLEKTLLGDRAVDFEFREPFIVSGYRRPGFSFKQCIHSAFYAHNETINVWSHILALVGFLYHC-------LPVFCLRSNPFTDPFVYPLLSFSLGISAMFLMSSSA-HLFNCMSAKVRHICFFFDYAAISTY---TFTAGLVFYYYSRPTNTDLKLMNSNCLFLCISAAISLATTYLCCASRHKWVQHKFLLRTGTFVISWLFNTLPFTTRAIYCDSKLECNTVAFAYFKRQVFYFFLAALSNVI---RIPERFIPGLFDFFGQSHHFLHIL 271          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Medaka
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:NCBI gene;Acc:101166647])

HSP 1 Score: 246.899 bits (629), Expect = 3.795e-80
Identity = 119/276 (43.12%), Postives = 184/276 (66.67%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y   P++L+ NP+I  GYR     K C+KSIF  SNE+VNIW+HL+GF++F +  + D    LP    +  D++I +IGL C+ +CML SVGYHLFSCH SE     W ++D  GI +G++GCY+PGI++A+YC + W++ Y+   LS+ ++V   Q+ P Y  ++    R +IF  +A  GV+P +HW++L+ G  S+IV +F  RVI +Y++   +F+FY  KIPER++PG+ +++G+SHQ+WH+LV+  FY WH + V +  +R +  C
Sbjct:   33 RLYTYEQAPLFLRENPYITDGYRAHLPSKLCLKSIFILSNETVNIWSHLLGFLLFFFMGVNDLSSLLPASRANREDYVIYAIGLFCFQVCMLCSVGYHLFSCHRSEKTCMRWLALDYAGISVGILGCYVPGIFYAFYCNAFWRQVYLLTVLSMILAVFCAQVHPSYLSNDWKVIRMTIFSCVAGIGVIPALHWVWLNGGLTSDIVQLFFPRVIVMYLIAGSAFLFYITKIPERYFPGQVNYLGASHQLWHILVVFMFYWWHQTAVHIMHFRHSQPC 308          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Medaka
Match: paqr3a (progestin and adipoQ receptor family member 3 [Source:NCBI gene;Acc:101161163])

HSP 1 Score: 241.891 bits (616), Expect = 2.711e-78
Identity = 116/276 (42.03%), Postives = 181/276 (65.58%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCH-SEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGC 925
            RL  Y  IP +L+ NP+I  GYR     + C+KSIF  SNE+ NIW+HL+GF++F    + +    LP    S  D++I  IGL C+ +CML SVGYH+F CH SE   + W ++D  G+ IG++GCY+PG+++ +YC   W++ Y+   L++ ++V   Q+ P+Y        R+  F ++A +G+VPTVHWI ++ GF SE+V  F+ RV+ +Y++ AL+ +FY  K+PER++PG+ +++GSSHQ+WH+L+++ FY WH S   L  YR +  C
Sbjct:   29 RLYTYEQIPAFLRENPYITDGYRAYLPSRLCVKSIFILSNETGNIWSHLLGFLLFFCLGVYNMASVLPAVGASREDYVIYGIGLFCFQVCMLCSVGYHMFCCHRSEKTSRRWMALDYAGVSIGVLGCYVPGVFYTFYCNDYWRQVYLVTVLAMILAVFFAQIHPQYLSTAWKRLRSLTFGLVAGYGLVPTVHWICITGGFSSELVQAFVPRVLGMYLIAALALVFYVSKVPERYFPGQLNYLGSSHQVWHLLLVLLFYWWHQSSSFLMAYRHSQPC 304          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 111.694 bits (278), Expect = 5.478e-28
Identity = 86/289 (29.76%), Postives = 151/289 (52.25%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSF----NDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLI-----FQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSI--FLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLI-CFYDWHS-SGVELFDYRITHGC 925
            R++ +  +P +LK N F+  G+R    + + C KSIF+   E+ NIWTHL+G + F+       ++ +   N SF     + ++I +  L  I+C+  S  +H   CHSE + + +  +D +GI   ++G ++P +Y+++YC       Y+     L ++ +      F  +P+YRG      R  +F+ L + GVVPT+H++      ++  +    +L  +  LY+ GA     Y  +IPERF+PG+ D    SHQ++H+LV+   F  +H  S ++ F Y    GC
Sbjct:   55 RVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCL----GLMYMFRPNMSFVAPVQEKVVIGVFFLGAILCLSFSWLFHTVYCHSEGVSKVFSKLDYSGIAFLIMGSFVPWLYYSFYCTPQSCFIYLMIVCVLGMAAIFVSQCDFFSTPQYRG-----VRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFLMATLYITGA---CLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSNLQEFRYTAGGGC 331          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 111.694 bits (278), Expect = 1.127e-27
Identity = 87/291 (29.90%), Postives = 152/291 (52.23%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSF----NDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLI-----FQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLI-CFYDWHS-SGVELFDYRITHGC 925
            R++ +  +P +LK N F+  G+R    + + C KSIF+   E+ NIWTHL+G + F+       ++ +   N SF     + ++I +  L  I+C+  S  +H   CHSE + + +  +D +GI   ++G ++P +Y+++YC       Y+     L ++ +      F  +P+YRG      R  +F+ L + GVVPT+H++      ++  +     +FL  +  LY+ GA     Y  +IPERF+PG+ D    SHQ++H+LV+   F  +H  S ++ F Y    GC
Sbjct:   92 RVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCL----GLMYMFRPNMSFVAPVQEKVVIGVFFLGAILCLSFSWLFHTVYCHSEGVSKVFSKLDYSGIAFLIMGSFVPWLYYSFYCTPQSCFIYLMIVCVLGMAAIFVSQCDFFSTPQYRG-----VRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFL--MATLYITGA---CLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSNLQEFRYTAGGGC 368          
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 111.694 bits (278), Expect = 1.127e-27
Identity = 87/291 (29.90%), Postives = 152/291 (52.23%), Query Frame = 2
Query:  101 RLLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSF----NDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLI-----FQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVS----IFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLI-CFYDWHS-SGVELFDYRITHGC 925
            R++ +  +P +LK N F+  G+R    + + C KSIF+   E+ NIWTHL+G + F+       ++ +   N SF     + ++I +  L  I+C+  S  +H   CHSE + + +  +D +GI   ++G ++P +Y+++YC       Y+     L ++ +      F  +P+YRG      R  +F+ L + GVVPT+H++      ++  +     +FL  +  LY+ GA     Y  +IPERF+PG+ D    SHQ++H+LV+   F  +H  S ++ F Y    GC
Sbjct:   92 RVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCL----GLMYMFRPNMSFVAPVQEKVVIGVFFLGAILCLSFSWLFHTVYCHSEGVSKVFSKLDYSGIAFLIMGSFVPWLYYSFYCTPQSCFIYLMIVCVLGMAAIFVSQCDFFSTPQYRG-----VRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFL--MATLYITGA---CLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSNLQEFRYTAGGGC 368          
BLAST of Progestin and adipoQ receptor family member 3 vs. Planmine SMEST
Match: SMESG000021251.1 (SMESG000021251.1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI 931
            MSLPIYNNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI
Sbjct:    1 MSLPIYNNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI 295          
BLAST of Progestin and adipoQ receptor family member 3 vs. Planmine SMEST
Match: SMESG000021251.1 (SMESG000021251.1)

HSP 1 Score: 349.362 bits (895), Expect = 7.158e-122
Identity = 206/295 (69.83%), Postives = 214/295 (72.54%), Query Frame = 2
Query:   47 MSLPIYNNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI 931
            MSLPIYNNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFS + +  +   +  A+S + +           FCK             +P   W                                     P RF     DFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI
Sbjct:    1 MSLPIYNNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCIKSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSIFLQRVIRLYVLGALSFIFY-----------FCK-------------IPERFW-------------------------------------PGRF-----DFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI 229          
BLAST of Progestin and adipoQ receptor family member 3 vs. Planmine SMEST
Match: SMESG000005140.1 (SMESG000005140.1)

HSP 1 Score: 117.472 bits (293), Expect = 5.961e-30
Identity = 86/277 (31.05%), Postives = 147/277 (53.07%), Query Frame = 2
Query:  104 LLKYSSIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSI---FLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHG 922
            L+++  +P +LK N F+   +R    + ++C KSIF+   E+VNIWTHL+G++ F+   +V  ++  P  +  + D  +I    L  I+C+  S  +H   CHS+ + + +  +D  GI    +G ++P +Y+++YC    +  Y    + L    LI  +  ++        R  +F+ L + GVVP +H+I +  GF S I      +L  +  LY+ GA   + Y  +IPER  PGRFD I  SHQI+HV V++     +   + +  YR+T+G
Sbjct:  105 LVQHQHLPAWLKDNNFLVRSHRPELKSYRKCFKSIFRVHTETVNIWTHLLGWLGFLAIAVV--ILCQPADHLPWQDKAVIMCFFLGAILCLGFSWLFHTVYCHSQRVGKIFNKLDYCGIAFLTVGSFIPWLYYSFYCRLIPKLVYCSLIIVLGSFALIVSMFDKFATPPYRPLRAGVFIALGLCGVVPCLHYI-IVEGFWSAIHQSSVGWLSLMALLYITGA---VIYAARIPERILPGRFDIIFQSHQIFHVFVVVAALVHYYGIILITGYRLTNG 375          
BLAST of Progestin and adipoQ receptor family member 3 vs. Planmine SMEST
Match: SMESG000011535.1 (SMESG000011535.1)

HSP 1 Score: 100.523 bits (249), Expect = 1.010e-23
Identity = 76/247 (30.77%), Postives = 127/247 (51.42%), Query Frame = 2
Query:  119 SIPVYLKWNPFIKSGYRTSY-TIKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAWQKFYMFF-----TLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQI 841
            S+P +LK N F+  G+R    + K C  SIF+   E+VNIWTHL+GFI FI   I    +  P+     ++ ++ S   +  I+C+  S  +H   CHSE + + +  +D  GI +  +G  +P +++++YC    Q  Y         + + IS++ +  +P +R   +F     +F+ L + GV+P  H+I L  GF     +  L  ++ +  L       Y  ++PERF+PG+FD    SHQI
Sbjct:  116 SLPGWLKDNDFLLWGHRPQLNSFKACFSSIFRIHTETVNIWTHLLGFIAFIVLAIY--FLTKPMSEMLLSEKVVFSAFFIGAILCLGFSWTFHTVHCHSEKVGRIFNKLDYCGITLLTVGSTIPWLHYSFYCNLLPQIIYTIMISVLGAICMGISLMDYFATPNFRSMRAF-----VFVALGLSGVIPCAHYIIL-EGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 354          
BLAST of Progestin and adipoQ receptor family member 3 vs. Planmine SMEST
Match: SMESG000044081.1 (SMESG000044081.1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.762e-9
Identity = 81/289 (28.03%), Postives = 129/289 (44.64%), Query Frame = 2
Query:   65 NNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYT-IKQCIKSIFQFSNESVNIWTHXXXXXXXXXXXXVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAW----------QKFYMFFTLSLAISVLIFQLSPRYRGHESFCK---RTSIFLVLAIFGVVPTV-HWIY---LSNGFRS--EIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFY 871
            N + I YS+  E+      +P + +  PFI SGYR   +    CIKS+F  +NE+VNIWTHLI  I FI    V  +  L  +  ++     I       I  ++SS+  HLF+  S+  +   F  D   + I   G  L   ++AY    +W            + +   +S  +SV++   + R++   SF +   R S F+   +  + P +  ++Y     N   +  +    F    I       L+ +FY    PER +PG FD +G SHQ++HV   I  Y
Sbjct:    4 NRNKIHYSLNEEQ------VPEHFR-EPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICF-VSEIFYLNFRFDNYYYTPYIIYIATVVIYTLISSLA-HLFNTMSDWARHVCFICDYAAVSIHAHGTGLA--FYAYSLPISWIEKTSNKIFTNNYIIISIISCTVSVVL-SCNTRFQT-ASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTY 279          
The following BLAST results are available for this feature:
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAQR34.531e-7643.84progestin and adipoQ receptor family member 3 [Sou... [more]
PAQR34.531e-7643.84progestin and adipoQ receptor family member 3 [Sou... [more]
PAQR32.450e-6043.64progestin and adipoQ receptor family member 3 [Sou... [more]
PAQR34.722e-6043.64progestin and adipoQ receptor family member 3 [Sou... [more]
ADIPOR16.653e-3129.17adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr-36.780e-5035.87Progestin and AdipoQ Receptor family [Source:UniP... [more]
paqr-36.580e-4937.35Progestin and AdipoQ Receptor family [Source:UniP... [more]
paqr-11.042e-2627.92Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-11.378e-2528.90Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-11.378e-2528.90Progestin and adipoQ receptor-like protein 1 [Sou... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG75306.612e-5935.03gene:FBgn0038256 transcript:FBtr0333277[more]
CG75301.298e-5835.03gene:FBgn0038256 transcript:FBtr0083021[more]
CG75301.298e-5835.03gene:FBgn0038256 transcript:FBtr0083019[more]
CG75301.298e-5835.03gene:FBgn0038256 transcript:FBtr0083020[more]
AdipoR2.070e-2928.78gene:FBgn0038984 transcript:FBtr0084284[more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr3b1.183e-8444.40progestin and adipoQ receptor family member IIIb [... [more]
paqr3b1.183e-8444.40progestin and adipoQ receptor family member IIIb [... [more]
paqr3b1.183e-8444.40progestin and adipoQ receptor family member IIIb [... [more]
paqr3a1.336e-8243.84progestin and adipoQ receptor family member IIIa [... [more]
paqr3a1.336e-8243.84progestin and adipoQ receptor family member IIIa [... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atg4a1.642e-7943.84autophagy related 4A cysteine peptidase [Source:Xe... [more]
adipor16.066e-3028.34adiponectin receptor 1 [Source:NCBI gene;Acc:49330... [more]
rec81.150e-1827.62REC8 meiotic recombination protein [Source:Xenbase... [more]
PAQR92.583e-926.22progestin and adipoQ receptor family member IX [So... [more]
hspa1l2.801e-926.72heat shock protein family A (Hsp70) member 1 like ... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Paqr31.142e-7744.93progestin and adipoQ receptor family member III [S... [more]
Paqr31.142e-7744.93progestin and adipoQ receptor family member III [S... [more]
Paqr36.628e-4541.63progestin and adipoQ receptor family member III [S... [more]
Paqr39.786e-3650.72progestin and adipoQ receptor family member III [S... [more]
Adipor14.759e-3129.17adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6TCG8|PAQR3_MOUSE7.990e-7744.93Progestin and adipoQ receptor family member 3 OS=M... [more]
sp|Q6TCH7|PAQR3_HUMAN2.176e-7543.84Progestin and adipoQ receptor family member 3 OS=H... [more]
sp|Q93ZH9|HHP1_ARATH1.793e-3430.31Heptahelical transmembrane protein 1 OS=Arabidopsi... [more]
sp|Q96A54|PAQR1_HUMAN3.195e-3029.17Adiponectin receptor protein 1 OS=Homo sapiens OX=... [more]
sp|Q91VH1|PAQR1_MOUSE3.329e-3029.17Adiponectin receptor protein 1 OS=Mus musculus OX=... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JGV92.530e-9147.08Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3HQ259.091e-8947.45progestin and adipoQ receptor family member 3 OS=L... [more]
K1PLJ96.245e-8848.19Progestin and adipoQ receptor family member 3 OS=C... [more]
A0A210QNJ31.005e-8747.27Progestin and adipoQ receptor family member 3 OS=M... [more]
A0A5N5KE441.357e-8447.46Uncharacterized protein OS=Pangasianodon hypophtha... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr3b5.461e-8645.49progestin and adipoQ receptor family member 3-like... [more]
paqr3a4.651e-8345.65progestin and adipoQ receptor family member 3 [Sou... [more]
adipor22.570e-2830.31adiponectin receptor 2 [Source:NCBI gene;Acc:10303... [more]
adipor1b3.564e-2728.27adiponectin receptor 1 [Source:NCBI gene;Acc:10302... [more]
paqr4a5.146e-1827.38progestin and adipoQ receptor family member 4-like... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr3b6.818e-7240.70progestin and adipoQ receptor family member IIIb [... [more]
adipor26.595e-3231.47adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adipor1b4.064e-3129.71adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000003422.13.441e-1428.41pep scaffold:Pmarinus_7.0:GL479692:543133:563138:1... [more]
paqr83.886e-826.40progestin and adipoQ receptor family member VIII [... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
IZH12.176e-2630.86Membrane protein involved in zinc ion homeostasis;... [more]
IZH23.293e-2228.73Plasma membrane receptor for plant antifungal osmo... [more]
IZH31.008e-1330.04Membrane protein involved in zinc ion homeostasis;... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO363282.355e-8144.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360504.249e-2628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360514.249e-2628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463598.311e-1926.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498511.533e-1829.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAQR33.795e-8043.12progestin and adipoQ receptor family member 3 [Sou... [more]
paqr3a2.711e-7842.03progestin and adipoQ receptor family member 3 [Sou... [more]
adipor25.478e-2829.76adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
adipor21.127e-2729.90adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
adipor21.127e-2729.90adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021251.10.000e+0100.00SMESG000021251.1[more]
SMESG000021251.17.158e-12269.83SMESG000021251.1[more]
SMESG000005140.15.961e-3031.05SMESG000005140.1[more]
SMESG000011535.11.010e-2330.77SMESG000011535.1[more]
SMESG000044081.11.762e-928.03SMESG000044081.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030065 ID=SMED30030065|Name=Progestin and adipoQ receptor family member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=960bp
GGAATTCGTGTTTATTTTAATTATTTTATAATTTTAATTAATTTGTATGA
GTTTACCTATTTACAACAACCACAATATACAATATTCAATCAAATGTGAA
AGATTGCTTAAATACTCTTCAATACCAGTCTATTTAAAATGGAACCCATT
TATTAAATCGGGATATCGTACTTCTTACACGATTAAACAGTGTATTAAAA
GTATATTTCAGTTTTCAAATGAATCAGTTAATATTTGGACTCATTTAATT
GGATTTATAATTTTTATTTATTATTTAATAGTTGATAATGTGATTCAACT
ACCACTAAAAAATGGAAGTTTTAATGATCATTTGATTATTTCAATTGGAT
TATTATGTTACATAATTTGCATGCTCTCATCAGTTGGGTATCATTTGTTT
TCATGTCACAGTGAGCCGATGCAACAGTTTTGGTTTTCAATAGATTTGAC
GGGAATCTGTATTGGATTAATCGGATGTTATTTGCCGGGCATCTATTTTG
CATATTATTGCTTCTCGGCATGGCAGAAATTTTACATGTTTTTCACGCTT
TCTCTAGCGATATCCGTGTTGATTTTCCAATTAAGTCCCAGGTACAGGGG
TCATGAAAGTTTCTGTAAGCGAACATCCATATTCCTTGTGCTCGCAATAT
TCGGTGTAGTGCCAACAGTGCATTGGATCTATTTGAGTAACGGATTCCGG
TCAGAAATAGTGTCGATATTTCTTCAAAGAGTGATTCGCCTTTATGTTTT
AGGTGCACTTTCGTTTATATTTTATTTTTGTAAGATTCCTGAACGATTTT
GGCCAGGTCGATTCGATTTTATTGGTTCTAGTCATCAAATATGGCATGTT
TTAGTGCTTATTTGCTTTTATGATTGGCATTCAAGTGGTGTAGAACTATT
TGATTACCGCATCACTCATGGATGTAATATTTGATATTTTTATTAGTTGT
TTTAATGAGC
back to top

protein sequence of SMED30030065-orf-1

>SMED30030065-orf-1 ID=SMED30030065-orf-1|Name=SMED30030065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=296bp
MSLPIYNNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYTIKQCI
KSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISI
GLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIY
FAYYCFSAWQKFYMFFTLSLAISVLIFQLSPRYRGHESFCKRTSIFLVLA
IFGVVPTVHWIYLSNGFRSEIVSIFLQRVIRLYVLGALSFIFYFCKIPER
FWPGRFDFIGSSHQIWHVLVLICFYDWHSSGVELFDYRITHGCNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
Vocabulary: INTERPRO
TermDefinition
IPR004254AdipoR/HlyIII-related
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004254AdipoR/Haemolysin-III-relatedPFAMPF03006HlyIIIcoord: 54..275
e-value: 3.2E-50
score: 170.9
IPR004254AdipoR/Haemolysin-III-relatedPANTHERPTHR20855ADIPOR/PROGESTIN RECEPTOR-RELATEDcoord: 16..290
NoneNo IPR availablePANTHERPTHR20855:SF15PROGESTIN AND ADIPOQ RECEPTOR FAMILY MEMBER 3coord: 16..290
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 194..213
NoneNo IPR availableTMHMMTMhelixcoord: 162..181
NoneNo IPR availableTMHMMTMhelixcoord: 228..245