Glutamate receptor

Overview
NameGlutamate receptor
Smed IDSMED30030059
Length (bp)3145
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor (SMED30030059) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor (SMED30030059) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor (SMED30030059) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor (SMED30030059) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030059

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030059SMESG000073268.1 SmedASXL_016881SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30030059SMESG000073268.1 dd_Smed_v4_7562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030059SMESG000073268.1 dd_Smed_v4_7562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30030059SMESG000073268.1 dd_Smed_v6_7562_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030059SMESG000073268.1 OX_Smed_1.0.13048ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 331/852 (38.85%), Postives = 506/852 (59.39%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    N  +   +  + +R +   Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQW---KNSDARDHTRVDWKRPK---YTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 551.206 bits (1419), Expect = 1.255e-180
Identity = 331/852 (38.85%), Postives = 505/852 (59.27%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    N  +   +  + +R +   Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R  +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQW---KNSDARDHTRVDWKRPK---YTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 548.895 bits (1413), Expect = 5.817e-180
Identity = 330/857 (38.51%), Postives = 503/857 (58.69%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT---SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA   +   + +D   + +  +  R  +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  + +++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L     +P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M S  P VF      G  +V+ SK ++AF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS+ R+++NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVE---NFNDVSYRQLLEELDRRQEKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDVPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMK 848          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 548.895 bits (1413), Expect = 5.817e-180
Identity = 330/857 (38.51%), Postives = 503/857 (58.69%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT---SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA   +   + +D   + +  +  R  +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  + +++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L     +P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M S  P VF      G  +V+ SK ++AF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS+ R+++NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVE---NFNDVSYRQLLEELDRRQEKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDVPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMK 848          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 549.28 bits (1414), Expect = 5.835e-180
Identity = 339/892 (38.00%), Postives = 513/892 (57.51%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT---SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  + +++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L     +P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M S  P VF      G  +V+ SK ++AF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS+ R  +NLAVL+L E   + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDVPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCP 879          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 437.958 bits (1125), Expect = 3.146e-137
Identity = 280/832 (33.65%), Postives = 445/832 (53.49%), Query Frame = 3
Query:  519 SFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNI-IKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRR--------IDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS--TRFHT--------NSG--DQVCSPVTNPKY---------CADELKPAITRIKFM----GLTGNVQFNESGFRHNYKIDIIE----ARVKESLKTIGNWSTSHGL-TSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD-------KNGKDTGEFEGFCKDLVNEIA-KMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESN-PDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRR 2870
            S+ M  A+C  L    +A+   +  +    I+ ++DA  +  ++ +   +   +   ++FG    + +RP ++  + DFI  + W  +L L D   A   L  ++ H  +R          DL AD +Q+     +  L   N   + N    I++D    +   +++  +   + ++ +YHY++   D          NG +N + F+       ++N+  +  W    + K +  +S++      +  EAA+  D + +        +++  + FH         N G     C P+++  +             +  A   +K       LTGN++F+  G R N+ + I++     +   + K +  W    G  ++    +      N  K+  + V + LV PF+M  ++          +   +FEGFC DL+  +A K+  F Y I ++         + SW+GMIGEL+   A  VVA LTI   RERVVDFS PFM  G+S+M  KPD +E   F FM+PLS +IWM I FAY+GVSVV+FLVSRF+PYEW V+        +SN+F+++N  WF+L+AFMQQG DI PRS++GRI    WWFFT+IIVSSYTANLAA+LT+E+M  PI+S EDLAKQ+KIKYG+   GS+  FF  S ++I+Q+MW++MES  P VFV +   G ++V+  K  YAF+LE++ NEY N  KPC T K+G NL+S  GYGIATP GS+++D INLA+L L+E+  + +    WW ++ QC   +    D S  S+ L  + G+FY+L GG+ + ++ ++ E  Y+  +E+R+
Sbjct:   80 SWNMVNAVCDELKEGAMALLSSVDGKGREGIRGVSDALEMPLVSLTALSN--DDHQQQQFGNLFEVSVRPPISELLADFIVHKGWGEVLVLIDPVHASLHLPSLWRHLRTRTNTSVKASMFDLPADEKQF-----EAYLMQFNMM-RNNETNRILIDCASPKRLKKLLINIRSAQFNQANYHYVLANYDFLPYDQEMFQNGNINISGFN-------IINKDGREYW----SLKKHLKTSSSLGGGDDVSVEAAVGHDAMLVTWHGFAKCLQANDSLFHGTFRHRRFFNRGFPGIYCDPLSDRSHPNRPFSSFEHGKTIGVAFRNMKIGHKEGTLTGNIEFDRFGNRKNFDVSIVDLVSNTKATFNSKEVLAWRQGVGFFSNRTVAQHSRKSQNDHKDNQVIVLTNLVAPFVMIKRECLEMANLTECQGNNKFEGFCIDLLKLLADKIEEFNYEI-KLGTKAGSKQADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYEWRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQIYQRMWRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANEYENTRKPCDTMKVGANLNS-IGYGIATPFGSDWKDHINLAILALQERGELKKLENKWWYDRGQCDAGITV--DGSSASLNLSKVAGIFYILMGGMVISMLAALGEFLYRSRIEARK 888          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 395.971 bits (1016), Expect = 3.052e-121
Identity = 266/768 (34.64%), Postives = 394/768 (51.30%), Query Frame = 3
Query:  681 STNERFGKN------IIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFE--HTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKH------------------IILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVA-------------VKSTRFHTNSGDQVCSP------------VTNPKYCADELKPAITRIKFMGLTGNVQFNE-SGFRHNYKIDIIEARVK-ESLKTIG---NWSTSHGLT-----SIPRNKSDLTLVNF----SKNRTLR--VSSILVPPFLMRVKDKNG----KDTGEFEGFCKDLVNEIAK-MLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPD-----------------VFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
            S +E  GK       I  + P     ++D+I  + W+ ++Y++D   A   LR +F   H  S +  L  D    + S  +   +++N   +R S +H                  +I+DL+G       ++ ++E    + +YHY+ +  D  E   S      +N TIF   D NN    +F+K++         Y+   +N+     +P  AA   D + +  +AL++A             V+   F+       C P              + K  A+ +K  +   K   LTG +QF++ +G R N+  +I+E +    SL +I     W+   G        +   K D +        SK   LR  V ++LV PF+M  +   G    K    FEG+C DL+N +AK +  F Y +     +++G+   D SW+GMIG L+   AD+ VAPLTIT  RER VDFS PFM  G+S+M  KP+ +E   F FM+PL   IW+    +Y GVS+ +FLVS F+PYE  ++     +  V+NEFT++NS WF+L+AFMQQG DI PR+++GRI    WWFFTLIIVSSYTANLAA+LT+ERM  PI+S EDLA QNKI YGV   GS+  FF +S + +++KMW FM S                    +FV +   G +KV+ SK +YAF+LE + N Y +  +PC T K+G NL++  GYGIAT  G+  R S+NLA+L L EK  + +    WW ++ QC
Sbjct:  126 SKSENIGKTTENNPMIFSVAPSAEQLLIDYIQYKGWRDVVYIHDGKNADRTLRTMFSYLHEKSPKYQLFVD-NYVAPSDEEMFKEFLNEFHRRISTQHTLKSNDSSEEIDEPIPVNVIVDLEGSYRTRAFLRALEESVLVKKEYHYVFSNFDVDETDLSGFHFSLINITIFRIFDKNN---KKFLKTR---AEFHDVYRGGFSNTD---SIPTAAAFAHDAILVAGKALQIAMNEHGKGIFDKSFVRHQLFNRGRKGLYCRPHEDQTESRQFETFEHGKKIAEAIKKVVLTDKDGTLTGRIQFDKVTGKRTNFSAEIVEIKPGVNSLNSIWERFQWAEGEGFLLGGERYVQEKKKDSSQTRKGILPSKPWQLRFNVVTVLVKPFVMLKRRNPGEPELKGNDRFEGYCIDLLNLLAKNITGFEYDVFISDGNKYGSRQADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFK-RGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNT-LGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWWYDRGQC 881          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 363.999 bits (933), Expect = 8.967e-111
Identity = 226/668 (33.83%), Postives = 362/668 (54.19%), Query Frame = 3
Query:  738 AVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDG-VLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIIN-GGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKY-CADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWST------SHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL-VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYE-WGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKS 2708
            AV  FI  E W+ ++ +++  + L  +  +    +      S+   +       G  L++I  K  R     I++++  +++ +  ++Q   +    V YHY+V +MD   +    I      N T F   D N+    E+I      E  R+     S+     + +PY  ++ +D L LL R++K             D+   P     +    ++K         G++G++ +  SG R NY + +   R   S +    WS+      S     I  +   LTL    + + L++S  L  PF+M   +      G +EG+C DL+++IA +L FTYTI +V+D+ +G+   N  W+GM+GEL R +ADL VA LTI+  R  V+DF+ P+M  G+S++F KP  R+ + F FM PLS  +W+    +Y  VSV ++++++ +PYE +  D        V N+F++ NSFWF++ + MQQG ++ PR+ + R++ G+WWFF LI++SSYTANLAA LT  RM  PI++ +DLA Q KIKYG +  GS+  FF+ S+IE +++MWQ M S+P +FV +   G  +VK S  +YA+++ESSM EY  + + C   +IG  +D  KGYGI  P GS YR+ I+ A+L L+EK  + E  E WWK+KS
Sbjct:  138 AVAAFIKREKWKDVVVVFEEPDELLEITDMITAGHFDPDSFSSQLVRLKHGDDYGNELKHIKNKLDRY---RIVINIPLQKALH-FLEQAANMSMCGVLYHYVVMDMDLVTVDIDSIRGIEDCNITSFGVHDVNS----EYI------EDIRQEIVHKSSIRLPKKGVPYTTSIWIDTLRLLIRSMK--------SIQIWDE---PRCGSSWKSGSDIKKRFFENPLAGISGDLHWAPSGERSNYTLHVY--RRTLSFQKFAEWSSRTRRIASSEAVVIANSSEKLTL----EGKHLKISVYLEAPFVMITSN------GSYEGYCIDLLHKIANILKFTYTIQKVRDNAYGSKESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSS--DYAYLMESSMLEYAVE-RDCELMQIGGLIDQ-KGYGIGLPKGSPYRELISTAILRLQEKTELTELKEKWWKDKS 764          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 360.918 bits (925), Expect = 6.952e-109
Identity = 249/717 (34.73%), Postives = 362/717 (50.49%), Query Frame = 3
Query:  762 ENWQRILYLYDSNEALFRLRMIFE--HTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVA-------------VKSTRFHTNSGDQVCSP------------VTNPKYCADELKPAITRIKFMGLTGNVQFNE-SGFRHNYKIDIIEARVK-ESLKTIG---NWSTSHGLT-----SIPRNKSDLTLVNF----SKNRTLR--VSSILVPPFLMRVKDKNG----KDTGEFEGFCKDLVNEIAK-MLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPD-----------------VFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
            + W+ ++Y++D   A   LR +F   H  S +  L  D    + S  +   +++N   +R S +H    LK  +S     +++DE  K R ++H               +  GG                                   S+T+S     +P  AA   D + +  +AL++A             V+   F+       C P              + K  A+ +K  +   K   LTG +QF++ +G R N+  +I+E +    SL +I     W+   G        +   K D +        SK   LR  V ++LV PF+M  +   G    K    FEG+C DL+N +AK +  F Y +     +++G+   D SW+GMIG L+   AD+ VAPLTIT  RER VDFS PFM  G+S+M  KP+ +E   F FM+PL   IW+    +Y GVS+ +FLVS F+PYE  ++     +  V+NEFT++NS WF+L+AFMQQG DI PR+++GRI    WWFFTLIIVSSYTANLAA+LT+ERM  PI+S EDLA QNKI YGV   GS+  FF +S + +++KMW FM S                    +FV +   G +KV+ SK +YAF+LE + N Y +  +PC T K+G NL++  GYGIAT  G+  R S+NLA+L L EK  + +    WW ++ QC
Sbjct:  159 KGWRDVVYIHDGKNADRTLRTMFSYLHEKSPKYQLFVD-NYVAPSDEEMFKEFLNEFHRRISTQHT---LKSNDSS----EEIDEPIKTRAEFHD--------------VYRGGF----------------------------------SNTDS-----IPTAAAFAHDAILVAGKALQIAMNEHGKGIFDKSFVRHQLFNRGRKGLYCRPHEDQTESRQFETFEHGKKIAEAIKKVVLTDKDGTLTGRIQFDKVTGKRTNFSAEIVEIKPGVNSLNSIWERFQWAEGEGFLLGGERYVQEKKKDSSQTRKGILPSKPWQLRFNVVTVLVKPFVMLKRRNPGEPELKGNDRFEGYCIDLLNLLAKNITGFEYDVFISDGNKYGSRQADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFK-RGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNT-LGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWWYDRGQC 812          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 326.635 bits (836), Expect = 1.180e-96
Identity = 181/448 (40.40%), Postives = 274/448 (61.16%), Query Frame = 3
Query: 1416 LTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPR--NKSDLTLVNFSKNRT---LRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS---WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEA--FGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-GVDTPVEVD----SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFME-SNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQ 2711
            LTG+VQF  +G R +     +  R+      +GNWS   G     R  N+ +  +   S++     LRV   L  PF+++  +       ++EGFC DL+NE+ ++L F YTI +V+D  +G  + D    WNG+IG L R+EADL ++ +TIT SR  VVDF+ PFM  G+S++  +  +   +   + F++PLS  +W+ +  +Y  VS  + ++++F+PYEW  ++   E D        N+FT+ NSFWF++ + MQQG D+ PR+ A R++  VWW FT II+SSYTA LAA+LTVERM+ PI+S +DLA Q KI+YGV+ SGS+ +FF  S+I ++++MW  ME S+P VFV +   G  +VK     YA+++ESSM EYY + + C    IG  LDS KGYGIA P GS  RD ++  VL+L+E+  +      WW+++ +
Sbjct:  345 LTGDVQFKSNGERDDIMYHGV-GRINSQFVKLGNWSEKRGWNFDSRYANRWEFDIDPDSEDLEGLHLRVVVYLEEPFVIKTGEN------QYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYG--IEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGG--YAYMMESSMLEYYLE-RDCELQSIGGLLDS-KGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRRE 779          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: GluRIA (gene:FBgn0004619 transcript:FBtr0076982)

HSP 1 Score: 460.685 bits (1184), Expect = 2.845e-145
Identity = 273/808 (33.79%), Postives = 426/808 (52.72%), Query Frame = 3
Query:  495 VYVD--DLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYIT-YSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEH--TNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIIN-GGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAV--KSTRFHTN---------------SGDQVCSPVTN---------PKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLV-------NFSKNRTLRVSSILVPPFLMRVKDKNGKD---TGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGA---LVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----------------------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
             YVD  + +D+F+++  IC      V ++ G + P +  T+ S ++  ++ ++T +      A  S    F    I +RP    A++D I    WQ I+YLYDS++ L RL+ I++     +    +    R  + + +   L  +     R S+K I+LD   E +K  I+Q + ++K  R  YHYL++ +       S ++  G +N T F  +D N   + +F  S+   E + +S   ++     L  +  +AAL+ D + +L  A    +  K  +F +N               +G    S + +         P    +++   + +++  GL+G ++F+E G R NY + ++E  V  +L+ +  W    GL  +  +    +         ++ +N T  VSS+L  P+L   +   G+       FEG+CKDL + +A  L   Y I  V+D  +GA        W+GM+GEL+R EAD+ ++ +TIT+ RERV+DFS PFM  G+S+M  KP  + P  F F+ PLS++IW+ +  +Y+GVS VL+ V+RF PYEW +    + DS                          NEFT+ NSFW+SL+AFMQQG DI+P S+AGRI   VWWFFT+I++SSYTANLAA+LTVERM  PIK+ EDL  Q  + YG +  GS+ EFF  S+I +  KMW++M +N    V     G  +V+ SK +YA ++ES  NEY N   PC T K+G N+D+ KG+G+ATP GS  R  +N AVL LKE   +      WW +K++C
Sbjct:   77 AYVDVINTADAFKLSRLICNQFSRGVYSMLGAVSPDSFDTLHSYSNTFQMPFVTPWFPEKVLAPSSGLLDFA---ISMRPDYHQAIIDTIQYYGWQSIIYLYDSHDGLLRLQQIYQELKPGNETFRVQMVKRIANVTMAIEFLHTLEDLG-RFSKKRIVLDCPAEMAKEIIVQHVRDIKLGRRTYHYLLSGLVMDNHWPSDVVEFGAINITGFRIVDSNRRAVRDFHDSRKRLEPSGQSQSQNAGGPNSLPAISAQAALMYDAVFVLVEAFNRILRKKPDQFRSNHLQRRSHGGSSSSSATGTNESSALLDCNTSKGWVTPWEQGEKISRVLRKVEIDGLSGEIRFDEDGRRINYTLHVVEMSVNSTLQQVAEWRDDAGLLPLHSHNYASSSRSASASTGDYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTVERMVAPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDT-KGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTEC 879          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 447.588 bits (1150), Expect = 5.577e-142
Identity = 280/813 (34.44%), Postives = 445/813 (54.74%), Query Frame = 3
Query:  345 KRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNII-KTKVVY-VDDLS--DSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRP---LVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYH-YLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADE--LKPAITRIKFM------GLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSH----GLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDK---NGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL--VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNK 2705
            ++ Q +P+I+ +G +F   D    ++     + A     NA+ +I+ ++K+V  ++ +S  DSF     +C LL   V A+FGP    T   +QS+ D   + ++     +    ES        ++ L P    ++ A VD +    W+    +Y++N+ + RL+ + +        ++   RQ S S   G  + + ++ K +++ HI+LD   E   + +++Q  ++     DYH YLVT +D   +       GG N T F  +  N  ++++ ++ QW  +      +     S  L  +  E AL+ D + L  +AL     S +   +           P  C  +   +   + I +M      GLT  ++F+  GFR ++ +DI+E      ++ IG W+++       T     K      N  KN+TL V++IL  P+ MR +     +G D  +FEG+  DL++EI+K L F Y I  V D  +G+L  +   WNGMI EL+   ADL +A LTIT  RE+ VDF+TPFM  G+S+++ KP  + P  F F+ PLS D+W+ +  AYLGVSV+LF++++F PYEW   T    + KV ++FT+ N  WF++ + MQQG D  P++L+ R+V G+WWFFTLI++SSYTANLAA+LTVERM++PI+S EDLAKQ +IKYG +  GS+  FF +S+I  +Q+MW FMES  P VF  +   G ++V   K  YAF++ES+  EY  + + C  T++G  LD+ K YGIATPP S YR +IN  +L+L+E+ ++      WWK K
Sbjct:   21 RKAQSLPDIIKIGGLFHPAD----DHQELAFRQAVDRI-NADRSILPRSKLVAQIERISPFDSFHAGKRVCGLLNIGVAAIFGPQSSHTASHVQSICDNMEIPHLENRWDYRLRRESC-------LVNLYPHPNTLSKAYVDIVRHWGWKTFTIIYENNDGIVRLQELLKAHGMTPFPITV--RQLSDS---GDYRPLLKQIKNSAEAHIVLDCSTERI-HEVLKQAQQIGM-MSDYHSYLVTSLDLHTVNLDEFRYGGTNITGFRLI--NEKIVSDVVR-QWSID------EKGLLRSANLTTVRSETALMYDAVHLFAKALHDLDTSQQIDIH-----------PISCDGQSTWQHGFSLINYMKIVEMKGLTNVIKFDHQGFRTDFMLDIVEL-TPAGIRKIGTWNSTLPDGINFTRTFSQKQQEIEANL-KNKTLVVTTILSNPYCMRKESAIPLSGND--QFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGE-KVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTE-RNCELTQVGGMLDT-KSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEK 787          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 399.823 bits (1026), Expect = 3.091e-123
Identity = 274/797 (34.38%), Postives = 415/797 (52.07%), Query Frame = 3
Query:  360 IPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL---SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPY---EAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKY-----CADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT-SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV--NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSK-VSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPD-VFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKN 2702
            +P ++ VGAIF   +R S   +AF  K A    +  +  +  T++VY  +     DSF+    +C  L + V A+FGP        +QS+ +A  + +I       Y S+     F  N+     L+  A  D +   NW ++  +Y+ +  LF L     H+++        A  Y    S    + + R  ++     II+D      K+   + + +L+ +   YHY+ T  D             +N T F  +D ++    E I      + N             +   PY   E+AL+ D +      L     +   H N   +  S  ++  +       +++  AIT     GLTG VQF E G R+ +K+DI++ + +E ++ +G W    G+  S P    D  + N     TL V +    P++M  +DKN      FEGFC DL+  IA  + F Y I  V D+ +G  +   +SWNG++ ELM   ADL VA +TI  +RE V+DF+ PFM  G+ ++F  P  +    F FM PL+ +IW+ +  AY+ VS  LF+++RF+PYEW    P   ++  V N+F+I NSFWF    F++QG  ++P++ + RIVGG W+FF LII+SSYTANLAA+LTVERM +PI+S  DLA+Q +I YG +  GS+  FF +S+I I+QKMW++ME+    VFV     G  +V   +  YAF++ES+M +Y  Q + C  T+IG  LDS KGYGIATP GS +RD I+LA+LEL+EK  I   Y+ WWKN
Sbjct:   39 LPPVIRVGAIFTEDERESSIESAF--KYAIYRINKEKTLLPNTQLVYDIEYVPRDDSFRTTKKVCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSK----EFSINLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLM----HSSTE-----TKAEMYIRQASPDSYRQVLRAIRQKEIYKIIVDTNPSHIKS-FFRSILQLQMNDHRYHYMFTTFDLETYDLEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHN---------GLDTINGSPYIQTESALMFDSVYAFANGLHFL--NLDNHQNFYIKNLSCTSDQTWNDGISLYNQINAAITD----GLTGTVQFVE-GRRNIFKLDILKLK-QEKIQKVGYWHPDDGVNISDPTAFYDSNIANI----TLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVM--EGSYAFLMESTMLDYAVQ-RDCNLTQIGGLLDS-KGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKN 794          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 399.823 bits (1026), Expect = 3.091e-123
Identity = 274/797 (34.38%), Postives = 415/797 (52.07%), Query Frame = 3
Query:  360 IPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL---SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPY---EAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKY-----CADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT-SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV--NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSK-VSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPD-VFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKN 2702
            +P ++ VGAIF   +R S   +AF  K A    +  +  +  T++VY  +     DSF+    +C  L + V A+FGP        +QS+ +A  + +I       Y S+     F  N+     L+  A  D +   NW ++  +Y+ +  LF L     H+++        A  Y    S    + + R  ++     II+D      K+   + + +L+ +   YHY+ T  D             +N T F  +D ++    E I      + N             +   PY   E+AL+ D +      L     +   H N   +  S  ++  +       +++  AIT     GLTG VQF E G R+ +K+DI++ + +E ++ +G W    G+  S P    D  + N     TL V +    P++M  +DKN      FEGFC DL+  IA  + F Y I  V D+ +G  +   +SWNG++ ELM   ADL VA +TI  +RE V+DF+ PFM  G+ ++F  P  +    F FM PL+ +IW+ +  AY+ VS  LF+++RF+PYEW    P   ++  V N+F+I NSFWF    F++QG  ++P++ + RIVGG W+FF LII+SSYTANLAA+LTVERM +PI+S  DLA+Q +I YG +  GS+  FF +S+I I+QKMW++ME+    VFV     G  +V   +  YAF++ES+M +Y  Q + C  T+IG  LDS KGYGIATP GS +RD I+LA+LEL+EK  I   Y+ WWKN
Sbjct:   39 LPPVIRVGAIFTEDERESSIESAF--KYAIYRINKEKTLLPNTQLVYDIEYVPRDDSFRTTKKVCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSK----EFSINLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLM----HSSTE-----TKAEMYIRQASPDSYRQVLRAIRQKEIYKIIVDTNPSHIKS-FFRSILQLQMNDHRYHYMFTTFDLETYDLEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHN---------GLDTINGSPYIQTESALMFDSVYAFANGLHFL--NLDNHQNFYIKNLSCTSDQTWNDGISLYNQINAAITD----GLTGTVQFVE-GRRNIFKLDILKLK-QEKIQKVGYWHPDDGVNISDPTAFYDSNIANI----TLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVM--EGSYAFLMESTMLDYAVQ-RDCNLTQIGGLLDS-KGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKN 794          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 382.489 bits (981), Expect = 6.130e-117
Identity = 279/846 (32.98%), Postives = 433/846 (51.18%), Query Frame = 3
Query:  360 IPNIVLVGAIFDSLD--RNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEES----KNRIIQQMDELKKDRVDYHYLVTEMDAR-----EIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESN--RKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDS-KVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFY 2846
            +P +V +GAIF +     NS     + +       S   +  +   V YV+   DSF+    +C+L+   V AVF P        I S+ DA  +  I  S AH          F  N+   + LV  A  D I   NW R   L++    +  L     H  SR        RQ S       L     K   N    II+D          KN + QQM+E K     YHYL T  D       + K +F+     N T F  +D  +  + + +K   L   +  +K Y   + + ++   L  E AL+ D + +    L+   +S   H+ +   +     N       L   +  +++ GLTG +QF + G R  +K+D+I+ + + S+  +G W T HG  +I   +  +     S N TL V +IL  P++M    KN      F GFC D++  I++ + F Y +  V D ++GA   ++  WNGM+ +LM+ +ADL V  +TIT +RE V+DF+ PFM  G+S++F  P       F FM PL+ +IW+ +  AY  VS+ +++V + +P EW      ++++  + N+F++ +SFWF++  FMQQ  DI PR+++ RI+   W FF+LIIV+SYTANLAA+LT ERM NPI++ EDLA Q +I YG ++SGS+  FF +S IE ++K+W+ M++  P  F      G  +V  ++  YAF++ES+M +Y  Q + C  T+IG  LD+ KGYGIATP GS +RD I+LA+LEL+E+  I   Y+ WWKN  +      +       S+ L  I G+F +L  G+ +  +++ FE +Y
Sbjct:   19 VPPLVRIGAIFSNQPGMYNSELAFRYAIHRLNMDKSLLPETTVDYYVEYVNRF-DSFETVQKVCKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIGRS-AHD---------FSINVYPSKQLVNYAFNDVIQYLNWTRFGILHEKENGIINL-----HQLSRSFHGEVHMRQVSRDSYVSALNEFKGKEIHN----IIIDTNSNGISILLKNILQQQMNEYK-----YHYLFTSFDLETYDLEDFKYNFV-----NITSFRLVDTADVGVKQILKDIGLYSHHIFKKPYL--NLHIKKSTILESEPALMFDSVYVFAIGLQTLEQS---HSLTLLNISCEEENSWDGGLSLINYLNAVEWKGLTGPIQFKD-GQRVQFKLDLIKLK-QHSIVKVGEW-TPHGHLNI--TEPSMFFDAGSMNVTLVVITILETPYVMMHYGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRV--NQGNYAFLMESTMLDYIVQ-RDCNLTQIGGLLDT-KGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWY 820          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 337/883 (38.17%), Postives = 513/883 (58.10%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKS-AGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L      T  NA +      V +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  +T S    + +E   +     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E  +N I++Q+  + K    YHY+V  +  ++I     ++GG N T F  +D++ P++ + ++ +W  + +++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGN+QF+  G R NY +D+ E +     + IG W+    L  +   +++L++ N S  +NRT+ V++I+  P++M  K+    +  E FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E        +  NEF IFNS WFSL AFMQQG D +PRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS  R  +NLAVL+L E   + +    WW +K +C        D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E+++ K  F    R     S+  S   N  ++ P  P
Sbjct:   19 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNL-VPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLVTPS----FPAEGETQF----VLQLRPSIRGALLSLLDHYDWSRFVFLYDTDRGYAVLQAIMEKAGQNGWQVSAICVE---NFNDASYRRLLEDLDRRQEKKFVIDLEAERLQN-ILEQIVSVGKHVKGYHYIVANLGFKDISLERFMHGGANVTGFQLVDFSKPMVIKLMQ-RW-NKLDQREYPGSESPPRYTSSLTYDGVLVM--AEAFRNLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRIQGLTGNIQFDHYGRRVNYTMDVFELK-SNGPRKIGYWNDLDKLVLV---QNELSMGNDSAMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGSDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKKLKLTFSEAMRNKARLSITGSLGENGRVLTPDCP 875          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 336/884 (38.01%), Postives = 507/884 (57.35%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  + +++ Y  S    +    L Y+  +++   E  +   +  V  +R    +GD + +P   P     +++  + ++   GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L     +       +  +NRT+ V++I+  P++M  K+    +  E +EG+C DL +EIAK + F Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E    +      NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS  R  +NLAVL+L E   + +    WW +K +C        D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPTEGESQF----VLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEAER-LNNMLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGIAGDCLANPAA-PWNQGIDMERTLKQVHLQGLTGNVQFDHYGRRVNYTMDVFELK-SNGPRRIGYWNDADKLVLTQDHALLPNETSGMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRTPVNLAVLKLSESGILDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRNEAKRMKLTFTEAMRNKARLSITGSVGENGRVLTPDCP 881          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 337/884 (38.12%), Postives = 510/884 (57.69%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  + +++ Y  S    +    L Y+  +++   E  +   +  V  +R    +GD + +P   P     +++  + ++   GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L     +       +  +NRT+ V++I+  P++M  K+    +  E +EG+C DL +EIAK + F Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E    +      NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS  R ++NLAVL+L E+  + +    WW +K +C      E D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPTEGESQF----VLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEAERLNN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGIAGDCLANPAA-PWNQGIDMERTLKQVHLQGLTGNVQFDHYGRRVNYTMDVFELK-SNGPRRIGYWNDADKLVLTQDHALLPNETSGMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRSAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGGEKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRNEAKRMKLTFTEAMRNKARLSITGSVGENGRVLTPDCP 881          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 337/884 (38.12%), Postives = 510/884 (57.69%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE-FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  + +++ Y  S    +    L Y+  +++   E  +   +  V  +R    +GD + +P   P     +++  + ++   GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L     +       +  +NRT+ V++I+  P++M  K+    +  E +EG+C DL +EIAK + F Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E    +      NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS  R ++NLAVL+L E+  + +    WW +K +C      E D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPTEGESQF----VLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEAERLNN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGIAGDCLANPAA-PWNQGIDMERTLKQVHLQGLTGNVQFDHYGRRVNYTMDVFELK-SNGPRRIGYWNDADKLVLTQDHALLPNETSGMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRSAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGGEKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRNEAKRMKLTFTEAMRNKARLSITGSVGENGRVLTPDCP 881          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 544.273 bits (1401), Expect = 3.512e-178
Identity = 334/880 (37.95%), Postives = 516/880 (58.64%), Query Frame = 3
Query:  294 LILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDL--TLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVD---SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC----LDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            +ILS +L+P     L        P++ + G      D+   EY+AF +      F  AE  +      ++D+L  ++SF +    C      V A+FG    ++V+TI S  +   + +IT S    + ++  N+     ++++RP +   ++  +    W++  YLYDS+  L  L+ + +    R+  ++A +         D   + + +  +  +++ +ILD + ++ K+ I++Q+  + +    YHY++      +   S I  GG N + F  +D+++P++ +F   +W  E+  +   P + +  R     Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++++E +    +K IG W+    +  +   KSDL        +N+T+ V++IL  P++M  K+     D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   +     S+ +NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  S+I +F KMWQ+M+S  P VFV N   G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+++NLAVL+L E+  + +    WW +K +C     D V    +   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:    5 MILSGLLLPA----LWGLALGGSPSVQIGGLFPRGADQ---EYSAFRIGMV--QFGTAEFRLTP----HIDNLEVANSFAITNCFCSQFSRGVYAIFGFYDKKSVNTITSFCETLHVSFITPS----FPADGLNQF----VLQMRPDIKGPLISLVEYYKWEKFAYLYDSDRGLSTLQAVLDTAAERKWQVTAINVGNLKDEWKDEAYRSLFQDLENKNERRVILDCEQDKVKD-IMEQVITIGRHVKGYHYIIANFGFVDGDLSKIQYGGANVSGFQIVDFDDPLVAKF-DQRW--EALEEKEYPGADSRIR-----YTSALTYDAVQVMTEAFRFLHKQRIDISRRGNNGDCLANPAV-PWAQGVEIERALKQVRVDGLTGNIQFDQYGRRVNYTVNVMELKNSGPVK-IGYWNE---MDKMAVTKSDLFPNDTMGMENKTVIVTTILEAPYVMLKKNAELFTDNERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDKVSHCRERKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMK 848          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 331/855 (38.71%), Postives = 502/855 (58.71%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    S     + +  +V   ++SDSF+M    C      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E     + Q + +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW      K+Y          +K  Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG ++SGS+KEFF  S+I +F+KMW +M S  P VFV     G ++V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES++ K
Sbjct:   22 PNHIQIGGLFP--NQQSQEHAAFRF--ALSQLSEPPKLLPQIDIV---NISDSFEMTYTFCSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRLLFQDLDKSKDRQIVIDCESERLNAILTQVVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQW------KNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK 841          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 322/807 (39.90%), Postives = 484/807 (59.98%), Query Frame = 3
Query:  507 DLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            ++SDSF+M    C      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+ +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW     R+     S  S     + Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG ++SGS+KEFF  S+I +F+KMW +M S  P VFV     G ++V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R ++NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES++ K
Sbjct:   61 NISDSFEMTYTFCSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRLLFQDLDKSKDRQIVIDCESER-LNAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQWKNYDGREQPHLGSNTS----TIKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK 840          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 550.821 bits (1418), Expect = 1.087e-180
Identity = 325/808 (40.22%), Postives = 487/808 (60.27%), Query Frame = 3
Query:  507 DLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTS-VKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            ++SDSF+M    C      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+  L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW      K+Y          +K  Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG ++SGS+KEFF  S+I +F+KMW +M S  P VFV     G ++V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R ++NLAVL+L E+  + +    WW +K +C     S++  S+TS + L ++ G+FY+L GGL L +++++ E  YK   ES++ K
Sbjct:   60 NISDSFEMTYTFCSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVN---ILTTTEEGYRLLFQDLDKSKDRQIVIDCESERL-NAILTQV--LEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQW------KNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGEC----GSKDSGSKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK 833          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 547.354 bits (1409), Expect = 4.246e-180
Identity = 318/796 (39.95%), Postives = 477/796 (59.92%), Query Frame = 3
Query:  540 ICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            IC      V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+ +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW     R+     S  S     + Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG ++SGS+KEFF  S+I +F+KMW +M S  P VFV     G ++V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES++ K
Sbjct:   49 ICSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRLLFQDLDKSKDRQIVIDCESER-LNAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQWKNYDGREQPHLGSNTS----TIKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK 817          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 541.576 bits (1394), Expect = 1.445e-177
Identity = 316/788 (40.10%), Postives = 475/788 (60.28%), Query Frame = 3
Query:  564 VIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW-------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            V A+FG    +TV+ + S   A  + +IT S        +T+ +F   +++LRP + +A++  I    W++ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +   ++  + I++D + E   N I+ Q+ +L+K+ + YHY++  +   +I        G N T F  ++Y + +++  I  QW      K+Y          +K  Y +AL  DG+ ++  A + +++  R       N+GD + +P   P     +++ A+ +++  GL+GNVQFNE G R NY + ++E +  E ++ I +W+    L  +  +          +NRT  V++IL  P++M  K+ +   G D   FEG+C +L  EIAK + F Y +  VKD ++GA  +D  +WNGM+GEL+   ADL VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW       G + P    +  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG ++SGS+KEFF  S+I +F+KMW +M S  P VFV     G ++V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES++ K
Sbjct:   30 VYAIFGFYDRKTVNMLTSFCGALHVCFITPS-----FPVATSNQF---VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRLLFQDLDKSKDRQIVIDCESERL-NAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSR-IMQQW------KNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQ-SLRKQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRLEGLSGNVQFNEKGRRTNYTLHVLELK-HEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPT---TDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK 788          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 340/892 (38.12%), Postives = 516/892 (57.85%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  + +++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M S  P VF      G  +V+ SK ++AF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS+ R+++NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCP 879          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 340/892 (38.12%), Postives = 516/892 (57.85%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  + +++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M S  P VF      G  +V+ SK ++AF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS+ R+++NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCP 879          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 331/852 (38.85%), Postives = 501/852 (58.80%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T   R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 331/852 (38.85%), Postives = 500/852 (58.69%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T   R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R  +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 550.821 bits (1418), Expect = 1.012e-180
Identity = 340/892 (38.12%), Postives = 513/892 (57.51%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  + +++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M S  P VF      G  +V+ SK ++AF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS+ R  +NLAVL+L E   + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCP 879          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P19490|GRIA1_RAT (Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2)

HSP 1 Score: 552.747 bits (1423), Expect = 1.670e-180
Identity = 331/852 (38.85%), Postives = 502/852 (58.92%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T  +R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDSRDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|Q38PU8|GRIA1_MACFA (Glutamate receptor 1 OS=Macaca fascicularis OX=9541 GN=GRIA1 PE=2 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 3.110e-180
Identity = 331/852 (38.85%), Postives = 506/852 (59.39%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    N  +   +  + +R +   Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQW---KNSDARDHTRVDWKRPK---YTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P42261|GRIA1_HUMAN (Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2)

HSP 1 Score: 551.977 bits (1421), Expect = 3.110e-180
Identity = 331/852 (38.85%), Postives = 506/852 (59.39%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP + +A++  I    WQ+ +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +  + I  QW    N  +   +  + +R +   Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+ +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAK-IMQQW---KNSDARDHTRVDWKRPK---YTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P23818|GRIA1_MOUSE (Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 5.757e-180
Identity = 331/852 (38.85%), Postives = 500/852 (58.69%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND--SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE----VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            PN + +G +F   ++ S E+ AF    A    +     + +  +V   ++SDSF+M    C      V A+FG    RTV+ + S   A  + +IT S    +  +++N+     +++LRP +  A++  I    WQ  +Y+YD++  L  L+ + +    +   ++A       + ++   + + +  ++  ++ +++D + E   N I+ Q+ +L+K+ + YHY++  +   +I  +     G N T F  ++Y + +    I  QW T   R   +         ++  Y +AL  DG++++  A + +++  R       N+GD + +P   P     +++ A+ +++F GLTGNVQFNE G R NY + +IE +  + ++ IG W+          +       +  +NRT  V++IL  P++M  K+ N   G D   +EG+C +L  EIAK + ++Y +  V D ++GA   D  +WNGM+GEL+   AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   E      S  SNEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG + +GS+KEFF  S+I +F+KMW +M+S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R  +NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   ES+R K
Sbjct:   22 PNNIQIGGLFP--NQQSQEHAAFRF--ALSQLTEPPKLLPQIDIV---NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS----FPVDTSNQF----VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTA---VNILTTTEEGYRMLFQDLEKKKERLVVVDCESER-LNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR-IMQQWRTSDARDHTRVD------WKRPKYTSALTYDGVKVMAEAFQ-SLRRQRIDISRRGNAGDCLANPAV-PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKD-KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|Q9Z2W8|GRIA4_MOUSE (Glutamate receptor 4 OS=Mus musculus OX=10090 GN=Gria4 PE=1 SV=2)

HSP 1 Score: 550.821 bits (1418), Expect = 7.078e-180
Identity = 340/892 (38.12%), Postives = 513/892 (57.51%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA----DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    + +E  ++     +++LRP +  A++  +    W   ++LYD++     L+ I E        +SA    +    S+ Q   +L+ ++R+     +K  ++D + E  +N I++Q+  + K    YHY++  +  ++I     I+GG N T F  +D+N P++ + +  +W  + +++ Y  S T  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + +G W+    L  I   P   +D   +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   D+  WNGM+GEL+  +A++ +APLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P +     S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M S  P VF      G  +V+ SK ++AF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS+ R  +NLAVL+L E   + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPS----FPTEGESQF----VLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQ---LLEELDRRQ----EKKFVIDCEIERLQN-ILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLM-DRW-KKLDQREYPGSETPPKYTSALTYDGVLVM--AETFRSLRRQKIDISR-RGNAGDCLANPAA-PWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK-STGPRKVGYWNDMDKLVLIQDAPTLGNDTAAI---ENRTVVVTTIMESPYVMYKKNHEMFEGND--KYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCP 879          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267GZ97 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005451g1 PE=3 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 409/886 (46.16%), Postives = 565/886 (63.77%), Query Frame = 3
Query:  375 LVGAIFDSLDRNSPEYTAFNL---KSAGKTFSNAEDNII---KTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERF-------------GKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDG-------VLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTN----SQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAIT-RIK-FMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLT---LVNFSKNRTLRVSSILVPPFLMRVKDKNGKDT-----GEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGA-LVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMM 2909
            L+G IF    + S  + AF+    +    ++ + +  ++   +  V YV+DL DSFQM+ AIC+L+    I +FGP+H +T+  + S+TD   + YIT S      S+    R              G+ I++LRP++  AVV+ I  E W+RI +LYDS  AL RLR IFE    +   +SAD R  +    DG       VL+YIN KS   + K + LDL+  E + RI  ++  ++ +R+DYHYL+   D  E+  +  ++GG+N T F+ L++++P    F    W +++  ++Y P++ +    S R+  +P   AL++DG     +A +  +   R ++    + C P   P + A+ +      R+  F G+TG VQF+++G+R NY++  IEA V+  L+ I  WS  +G   + RN S       + FS NRT  V+SIL  PFLM  ++ +   T       F GFC DL+  +AK + F Y I  V D ++G   VND+WNGMIGEL R EAD+ VAPLTITS RE+VVDFSTP+ME GLS+MFLKP + E + FGFMKPLSK+IWMCI FAYLGVSVVLF+VSRF+PYEW ++   +   KV+N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVVN+GSSKEFF NS ++ F++MWQFME+NP+VFV  +  G D+V  S  +YAF+LES+MNEYY+Q + C T K+G NLDSG+GYGIATP GS+ R+ INL VL+ KEK  I      WW + S+C D  +     S  S++LR + GLFY+L  G   G++LS+ E  Y+CAL ++RKK++F  V   M+
Sbjct:   39 LIGGIFQMDSQESASHAAFDFAFDQLMLNSWFDPQGTLLYRYEKVVEYVEDLEDSFQMSSAICRLISRGAIVIFGPVHYKTIPMVLSITDYFEVAYITTSFVDKLPSDRILHRRALFNGIADRRQPQGRFIVRLRPVITPAVVELIDHEKWERIFFLYDSKSALLRLREIFERYKGKESTISADIRDLT----DGGPGAAATVLRYINEKSM-ETLKRVFLDLEDREVQQRIFDEIKAIRGNRLDYHYLIMGSDINEVNQTMFLHGGVNITGFTVLNFSDPTFARFRDEFWFSDARLRAY-PTALDKLDPSSRI--VPLSVALMIDGFSAFFKAHQ-KLTPQRRNSRDHKEACMPPETPAFPAENITAVFKGRVSGFPGVTGWVQFDQAGYRENYRVQGIEAGVRSELQPISIWS--NGQFRLTRNYSKSRKGFHLPFS-NRTRIVTSILGEPFLMVRQNSSLDGTPLVGNDRFVGFCADLIKLLAKDIGFDYVIKPVADGKYGDDSVNDTWNGMIGELYRLEADIAVAPLTITSKREKVVDFSTPYMEVGLSIMFLKPTNPESDQFGFMKPLSKEIWMCIAFAYLGVSVVLFVVSRFSPYEWHLNQESDKADKVTNDFSIFNSLWFTLSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNAGSSKEFFRNSSVQEFRRMWQFMEANPNVFVNTVKEGVDRVLNSNNDYAFLLESTMNEYYSQ-ENCRTIKVGSNLDSGRGYGIATPSGSDLREIINLKVLQFKEKGEITRLKSTWW-DASKCQDQNQDSKKSSAQSLELRSVIGLFYILIVGTVFGVILSIMEFVYRCALLAKRKKRKFKEVMNEML 910          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A158R8F8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5365 PE=3 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 393/895 (43.91%), Postives = 559/895 (62.46%), Query Frame = 3
Query:  354 QPIPNIVLVG--AIFDSLDRNSPEYTAFNL--KSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSF---------------SQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVA--------VKSTRFHTN-----SGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLT---SIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDT-GEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGV---------DTPVEVD--------SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKS-ENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
             P  +I+  G  AIF    RN+ EY AF     SA   + N +   IK K+V+V D+ DSFQMA AIC+L+   V+A+F P++P T+  ++S+T  +R+++ T +D HH+ + +++     NIIKL+PL A A++DF+    W+ +LYLY+S EA +RLR + E    R    + D RQ  +               ++S G+ Q++N ++    +K I++DL   ES  + I  +  +   R D H+L+   D + I  S +  GG+N T  + +D+++  L  +       E N ++     TN      L  EAAL++DG++ L +AL++         +  +  H+N     +G+  C P + P + A ++   + +   +   G ++F                        +G W++  G+    S  +N S+ + V+ +K R   VSSIL+ PF+M  KD NG    GE+EGFC DLV ++A+M+ F Y +  V D QFG+LVN SW+GM+GEL+R EAD+VVAPLTITS RERVVDF+TPFMEFGLSVM+ K D   P+   FM+PLS +IWMCI+FAYLGVSVVLFLVSR +P EWG          D  +E D        S   + F+IFNSFWF+LS F+QQGGDI PRSL+GRIVGG WWFFTLIIVSSYTANLAAYLTVERM NPI+SYEDLA+Q+K+KYG++ SGS+++FF  S I+IFQ+MW+FMESNP+   P +  G ++V  S ++YAFILES+MNEY+NQ +PCTT K+GPNLDSGKGYG+ATPPGS+ RD +NLAVLELKE + I + Y  WW+ + +C    KS + + + +S+ L  + GLFYLL G L +G++L++ E  Y+CA+ ++R K
Sbjct:   59 HPTLSIIRAGRSAIFQMDARNTTEYNAFKSYPSSASLLWQNFQ---IKEKIVHVKDIHDSFQMASAICELVAEGVVAIFAPVYPETLTIVKSMTTQHRVLFFTTADPHHFGTGTSDLSGAANIIKLKPLKAPAILDFMMHAEWEDVLYLYESEEAAYRLRWVLEKAIKRSPTFTVDFRQLRWDPEPPVNGEEAGGGGAESTGLRQHVNSRTNTFYRKSILVDLSKRESTAKFIAAIGSIMPQRADLHFLIVGGDIKCINDSSLQFGGINMTALADIDFDSVALKSY-----KAELNPRARLADMTNGN----LSTEAALLIDGMKSLVQALRLLNEDVYAGRLSKSGLHSNGETSPTGNLPCQPSSPPPFTAPQIMEKLQQTNQLSTGGKLKF---------------------FLQLGEWNSLDGIVMRVSTDKNDSEAS-VDLNKVRI--VSSILLSPFMMEKKDVNGNPIKGEYEGFCVDLVQKLAEMIKFKYKMKAVSDGQFGSLVNGSWDGMVGELLRREADIVVAPLTITSDRERVVDFTTPFMEFGLSVMYQKIDRPHPDPLSFMEPLSTEIWMCISFAYLGVSVVLFLVSRLSPAEWGAPLNKSKTLADPNLEGDECDGEMTISHTDSIFSIFNSFWFALSTFVQQGGDIVPRSLSGRIVGGAWWFFTLIIVSSYTANLAAYLTVERMTNPIQSYEDLARQSKVKYGIIKSGSTRDFFEKSSIKIFQQMWKFMESNPEALAPTVKAGVERVINSNKDYAFILESTMNEYFNQRRPCTTVKVGPNLDSGKGYGVATPPGSDLRDRLNLAVLELKEMDWIAQLYRLWWEERGECGKMAKSADKNTATSSLGLDSVYGLFYLLAGALVIGIVLAILEFIYRCAVNAKRTK 917          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267FKB2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023176g1 PE=3 SV=1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 414/937 (44.18%), Postives = 558/937 (59.55%), Query Frame = 3
Query:  375 LVGAIFDSLDRNSPEYTAFNL-------------KSAG-KTFS-----NAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNER----------------------------FGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYS-----FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKV--AVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIK------FMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTG-----EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNK-SQCLDFVKSE-NDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMM------HHSVEKSQMNSEIIE 2954
            L+G IF +    S  Y AFN              + AG  +FS         +  +  V +V++  DSFQ++ AIC+L+   V+A+FGP H +T+  +QS+TD   ++Y+T S       +    R                             GK +I+L+P++  A++  I  ENW+R  +LYDS  AL RLR +FE  N+R   +SAD R  +      + +  VL YI++KSK  + K + LD+  +E + ++  ++  ++  R +YHYL+   D  E+  +   +GG+N T FS L+ +NP    F    W  E   + +     N Q +  +P  AAL++DG+E L RA +   AV+ TR   +     C P   P Y A  L  AI   +      F GLTG V+FN +G+R  +++ + EA VK  L  I  WS   G  +T     K  L L NFS NRT  V+SIL  PFLM   + +   T       F GFC D + ++A+ + F Y I  V D  FG   N+ +WNGMIGEL R EAD+ VAPLTITS RE+ VDFSTP+ME GLSVMFL+P   E + FGFMKPLS +IWMCI FAYLGVSVVLF+VSRF+PYEW +         +V N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVVNSGSSK+FF  S  + F++MWQFME+NP+VFV  +  G ++V  S  +YAF+LES+MNEYY+Q + C T K+G NL+SG+GYGIATP GS+ RD INL VL+LKEK  I      WW  K   C +  K +    S  S++L+ + GLFY+L  G A G++LS+ E  Y+CAL ++RKK+ F  V R M+        +VE    +S++I+
Sbjct:   59 LIGGIFKNSSLQSASYAAFNFAIEQLRLRSDSGDRLAGPASFSWFGPLGGRRDRYEAAVEFVENPEDSFQISSAICRLVSRGVLAIFGPAHYKTLPMVQSMTDNLAVLYLTNSFVDQLQPDRIVHRRQKTSSGGGASRASGGGGSSSGRGGSRVHGKFLIRLKPVITQALIAIIDHENWERFFFLYDSQSALLRLRELFEAYNNRDATISADIRDLTDNSDRSAAAATVLNYIDKKSK-ETLKRVFLDVSDQELQRKLFAEIRSIRSSRFNYHYLIMGSDMNELNMTSFRHGGVNITGFSLLNASNPKFRRFRDEFWSQEERLRRWPTKFDNLQGV--VPLSAALMLDGMEALVRAHEQLPAVRQTRRQADD----CLPTLTPAYPAASLSGAIKSARHGAGAGFEGLTGWVEFNRTGYRDRFRVQVFEAGVKSELLPISEWSRDGGFRITRSKLRKKGLRL-NFS-NRTRVVTSILSEPFLMLRGNTSFDGTPLVGNERFTGFCADFIKQLARKIGFDYVIKPVADGNFGDDSNNGTWNGMIGELYRQEADIAVAPLTITSKREKAVDFSTPYMEVGLSVMFLRPTKAESDRFGFMKPLSMEIWMCIAFAYLGVSVVLFVVSRFSPYEWYMSQESGGPPGRVINDFSIFNSLWFALSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNSGSSKDFFRESTSQDFRRMWQFMEANPNVFVDTIQEGVNRVLNSNNDYAFLLESTMNEYYSQ-QNCRTMKVGGNLESGRGYGIATPSGSDLRDPINLNVLQLKEKGDISALQTKWWYEKQGSCPNQEKDDAKKNSAQSLELQSVAGLFYILVAGTAFGVVLSLLEFGYRCALLAKRKKRSFREVARDMLILSTRGRLTVECPHESSDLID 985          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267ENE6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023176g3 PE=3 SV=1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 415/937 (44.29%), Postives = 558/937 (59.55%), Query Frame = 3
Query:  375 LVGAIFDSLDRNSPEYTAFNL-------------KSAG-KTFS-----NAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNER----------------------------FGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYS-----FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKV--AVKSTRFHTNSGDQVCSPVTNPKYCADELKPAI------TRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTG-----EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNK-SQCLDFVKSE-NDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMM------HHSVEKSQMNSEIIE 2954
            L+G IF +    S  Y AFN              + AG  +FS         +  +  V +V++  DSFQ++ AIC+L+   V+A+FGP H +T+  +QS+TD   ++Y+T S       +    R                             GK +I+L+P++  A++  I  ENW+R  +LYDS  AL RLR +FE  N+R   +SAD R  +      + +  VL YI++KSK  + K + LD+  +E + ++  ++  ++  R +YHYL+   D  E+  +   +GG+N T FS L+ +NP    F    W  E   + +     N Q +  +P  AAL++DG+E L RA +   AV+ TR   +     C P   P Y A  L  AI      T   F GLTG V+FN +G+R  +++ + EA VK  L  I  WS   G  +T     K  L L NFS NRT  V+SIL  PFLM   + +   T       F GFC D + ++A+ + F Y I  V D  FG   N+ +WNGMIGEL R EAD+ VAPLTITS RE+ VDFSTP+ME GLSVMFL+P   E + FGFMKPLS +IWMCI FAYLGVSVVLF+VSRF+PYEW +         +V N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVVNSGSSK+FF  S  + F++MWQFME+NP+VFV  +  G ++V  S  +YAF+LES+MNEYY+Q + C T K+G NL+SG+GYGIATP GS+ RD INL VL+LKEK  I      WW  K   C +  K +    S  S++L+ + GLFY+L  G A G++LS+ E  Y+CAL ++RKK+ F  V R M+        +VE    +S++I+
Sbjct:   68 LIGGIFKNSSLQSASYAAFNFAIEQLRLRSDSGDRLAGPASFSWFGPLGGRRDRYEAAVEFVENPEDSFQISSAICRLVSRGVLAIFGPAHYKTLPMVQSMTDNLAVLYLTNSFVDQLQPDRIVHRRQKTSSGGGAGRASGGGGSSSGRGGSRVHGKFLIRLKPVITQALIAIIDHENWERFFFLYDSQSALLRLRELFEAYNNRDATISADIRDLTDNSDRSAAAATVLNYIDKKSK-ETLKRVFLDVSDQELQRKLFAEIRSIRSSRFNYHYLIMGSDMNELNMTSFRHGGVNITGFSLLNASNPKFRRFRDEFWSQEERLRRWPTKFDNLQGV--VPLSAALMLDGMEALVRAHEQLPAVRQTRRQADD----CLPTLTPAYPAASLSGAIKSARHGTGAGFEGLTGWVEFNRTGYRDRFRVQVFEAGVKSELLPISEWSRDGGFRITRSKLRKKGLRL-NFS-NRTRVVTSILSEPFLMLRGNTSFDGTPLVGNERFTGFCADFIKQLARKIGFDYVIKPVADGNFGDDSNNGTWNGMIGELYRQEADIAVAPLTITSKREKAVDFSTPYMEVGLSVMFLRPTKAESDRFGFMKPLSMEIWMCIAFAYLGVSVVLFVVSRFSPYEWYMSQESGGPPGRVINDFSIFNSLWFALSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNSGSSKDFFRESTSQDFRRMWQFMEANPNVFVDTIQEGVNRVLNSNNDYAFLLESTMNEYYSQ-QNCRTMKVGGNLESGRGYGIATPSGSDLRDPINLNVLQLKEKGDISALQTKWWYEKQGSCPNQEKDDAKKNSAQSLELQSVAGLFYILVAGTAFGVVLSLLEFGYRCALLAKRKKRSFREVARDMLILSTRGRLTVECPHESSDLID 994          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A267F5K3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023176g2 PE=3 SV=1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 413/937 (44.08%), Postives = 557/937 (59.45%), Query Frame = 3
Query:  375 LVGAIFDSLDRNSPEYTAFNL-------------KSAG-KTFS-----NAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNER----------------------------FGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYS-----FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKV--AVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIK------FMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTG-----EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNK-SQCLDFVKSE-NDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMM------HHSVEKSQMNSEIIE 2954
            L+G IF +    S  Y AFN              + AG  +FS         +  +  V +V++  DSFQ++ AIC+L+   V+A+FGP H +T+  +QS+TD   ++Y+T S       +    R                             GK +I+L+P++  A++  I  ENW+R  +LYDS  AL RLR +FE  N+R   +SAD R  +      + +  VL YI++KSK  + K + LD+  +E + ++  ++  ++  R +YHYL+   D  E+  +   +GG+N T FS L+ +NP    F    W  E   + +     N Q +  +P  AAL++DG+E L RA +   AV+ TR   +     C P   P Y A  L  AI   +      F GLTG V+FN +G+R  +++ + EA VK  L  I  WS   G  +T     K  L L NFS NRT  V+SIL  PFLM   + +   T       F GFC D + ++A+ + F Y I  V D  FG   N+ +WNGMIGEL R EAD+ VAPLTITS RE+ VDFSTP+ME GLSVMFL+P   E + FGFMKPLS +IWMCI FAYLGVSVVLF+VSRF+PYEW +         +V N+F+IFNS WF+LSAFMQQGGDISPRSL+GRIVG VWWFFTLIIVSSYTANLAA+LTVERM+ PI+SYEDLAKQ KIKYGVVNSGSSK+FF  S  + F++MWQFME+NP+VFV  +  G ++V  S  +YAF+LES+MNEYY+Q + C T K+G NL+SG+GYGIATP GS+ RD INL VL+LKEK  I      WW  K   C +  K +    S  S++L+ + GLFY+L  G A G++LS+ E  Y+CAL ++RKK+ F  V   M+        +VE    +S++I+
Sbjct:   59 LIGGIFKNSSLQSASYAAFNFAIEQLRLRSDSGDRLAGPASFSWFGPLGGRRDRYEAAVEFVENPEDSFQISSAICRLVSRGVLAIFGPAHYKTLPMVQSMTDNLAVLYLTNSFVDQLQPDRIVHRRQKTSSGGGAGRASGGGGSSSGRGGSRVHGKFLIRLKPVITQALIAIIDHENWERFFFLYDSQSALLRLRELFEAYNNRDATISADIRDLTDNSDRSAAAATVLNYIDKKSK-ETLKRVFLDVSDQELQRKLFAEIRSIRSSRFNYHYLIMGSDMNELNMTSFRHGGVNITGFSLLNASNPKFRRFRDEFWSQEERLRRWPTKFDNLQGV--VPLSAALMLDGMEALVRAHEQLPAVRQTRRQADD----CLPTLTPAYPAASLSGAIKSARHGAGAGFEGLTGWVEFNRTGYRDRFRVQVFEAGVKSELLPISEWSRDGGFRITRSKLRKKGLRL-NFS-NRTRVVTSILSEPFLMLRGNTSFDGTPLVGNERFTGFCADFIKQLARKIGFDYVIKPVADGNFGDDSNNGTWNGMIGELYRQEADIAVAPLTITSKREKAVDFSTPYMEVGLSVMFLRPTKAESDRFGFMKPLSMEIWMCIAFAYLGVSVVLFVVSRFSPYEWYMSQESGGPPGRVINDFSIFNSLWFALSAFMQQGGDISPRSLSGRIVGSVWWFFTLIIVSSYTANLAAFLTVERMSTPIQSYEDLAKQTKIKYGVVNSGSSKDFFRESTSQDFRRMWQFMEANPNVFVDTIQEGVNRVLNSNNDYAFLLESTMNEYYSQ-QNCRTMKVGGNLESGRGYGIATPSGSDLRDPINLNVLQLKEKGDISALQTKWWYEKQGSCPNQEKDDAKKNSAQSLELQSVAGLFYILVAGTAFGVVLSLLEFGYRCALLAKRKKRSFREVAHDMLILSTRGRLTVECPHESSDLID 985          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:103035012])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 341/886 (38.49%), Postives = 511/886 (57.67%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLK----SAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            P+ V +G +F  +     EYTAF L     +     S A  N++     +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  IT S    +  E  ++     +++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E   N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D+ NP++ + ++ +W  + +++ Y  S +  +    L Y+  +++   E  +   +  V  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L  I          +  +NRT+ V++I+  P++M  K+     G D   +EG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  D   S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS  R ++NLAVL+L E+  + +    WW +K +C      E D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   24 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVP----HVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITPS----FPIEGESQF----VLQLRPSIRGALLSILDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQVSAICVE---NFNDASYRQLLEDLDRRQEKTFVIDLEPERLTN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFGNPMVIKLLQ-RW-NKLDQREYPGSDSPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRLQGLTGNVQFDHYGRRVNYTMDVFELK-NNGPRRIGYWNDADKLVLIQDQALLPNETSGMENRTVVVTTIMEGPYVMLKKNWEMYEGND--RYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRSAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGGEKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRNEAKRMKLTFTEAMRNKARLSITGSVGENGRVLTPDCP 881          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 544.273 bits (1401), Expect = 1.077e-178
Identity = 313/802 (39.03%), Postives = 472/802 (58.85%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTK---VVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFS--KNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS-----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
            P+ V +G +F  +     EYTAF L        N   N  +     V +VD++  ++SF +  A C      V A+FG    R+VHT+ S   A  +  I+ S    + +E   +     +++LRP +  A++  +   +W R +++YD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E  +  I++Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  + +++ Y  S +  +    L Y+A L++   E  +   +  +  +R   N+GD + +P   P     +++  + +++  GLTGN+QF+  G R NY +D+ E R     K IG W+    L  +   +++L   N S  +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E           NEF IFNS WFSL AFMQQG D +PRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+++NLAVL+L E+  + +    WW +K +C
Sbjct:   18 PSSVQIGGLF--IRNTDQEYTAFRL---AIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLISPS----FPAEGETQF----VLQLRPNLRGALISILDHYDWNRFVFIYDTDRGYAILQAIMEKAGQNGWQVSAICVE---NFNDAGYRRLLEDLDRRQEKKFVIDLEAERLQT-ILEQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPMVIKLMQ-RW-NKLDQREYPGSESPPKFSSSLTYDAVLVM--AEAFRNLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRIQGLTGNIQFDHYGRRVNYTMDVFELRSNGPQK-IGYWNDIDKLVLV---QNELGAGNGSAMENRTVIVTTIMEGPYVMLKKNWEMYEGND--QYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGSESAPADQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 789          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria2a (glutamate receptor 2-like [Source:NCBI gene;Acc:103028119])

HSP 1 Score: 543.117 bits (1398), Expect = 5.685e-178
Identity = 326/839 (38.86%), Postives = 501/839 (59.71%), Query Frame = 3
Query:  417 EYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDL--TLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVD---SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC----LDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            EY+AF +      F  AE  +      ++D+L  ++SF +    C      V A+FG    ++V+TI S  +   + +IT S    + ++  N+     ++++RP +   ++  +    W++  YLYDS+  L  L+ + +    R+  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I++Q+  + +    YHY++      +   S I  GG N + F  +D+++P++ +F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++I+E +    +K IG W+    +  +   KSDL        +N+T+ V++IL  P++M  K+     D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   +     S+ +NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  S+I +F KMWQ+M+S  P VFV N   G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+++NLAVL+L E+  + +    WW +K +C     D V    +   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:   41 EYSAFRVGMV--QFGTAEFRLTP----HIDNLEVANSFAITNCFCSQFSRGVYAIFGFYDKKSVNTITSFCETLHVSFITPS----FPADGLNQF----VLQMRPDIKGPLISLVEYYKWEKFAYLYDSDRGLSTLQAVLDTAAERKWQVTAINVGNLKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMEQVITIGRHVKGYHYIIANFGFLDGDLSKIQYGGANVSGFQIVDFDDPLVAKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVKVMTEAFRFLHKQRIDISRRGNNGDCLANPAV-PWAQGVEIERALKQVRVDGLTGNIQFDQYGRRVNYSVNIMELKNSGPVK-IGYWNE---VDKMVVTKSDLFPNDTMGMENKTVIVTTILEAPYVMLKKNSELFTDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGASESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDKVSHCRECKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMK 850          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria2a (glutamate receptor 2-like [Source:NCBI gene;Acc:103028119])

HSP 1 Score: 538.88 bits (1387), Expect = 1.767e-176
Identity = 335/878 (38.15%), Postives = 513/878 (58.43%), Query Frame = 3
Query:  291 LLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDL--TLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVD---SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTS-VKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            ++ LS  L+P     L        P++ + G      D+   EY+AF +      F  AE  +      ++D+L  ++SF +    C      V A+FG    ++V+TI S  +   + +IT S    + ++  N+     ++++RP +   ++  +    W++  YLYDS+  L  L+ + +    R+  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I++Q+  + +    YHY++      +   S I  GG N + F  +D+++P++ +F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++I+E +    +K IG W+    +  +   KSDL        +N+T+ V++IL  P++M  K+     D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   +     S+ +NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  S+I +F KMWQ+M+S  P VFV N   G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R  +NLAVL+L E+  + +    WW +K +C    K      +TS + L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:    6 MMSLSGFLLPA----LWGLALGGSPSVQIGGLFPRGADQ---EYSAFRVGMV--QFGTAEFRLTP----HIDNLEVANSFAITNCFCSQFSRGVYAIFGFYDKKSVNTITSFCETLHVSFITPS----FPADGLNQF----VLQMRPDIKGPLISLVEYYKWEKFAYLYDSDRGLSTLQAVLDTAAERKWQVTAINVGNLKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMEQVITIGRHVKGYHYIIANFGFLDGDLSKIQYGGANVSGFQIVDFDDPLVAKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVKVMTEAFRFLHKQRIDISRRGNNGDCLANPAV-PWAQGVEIERALKQVRVDGLTGNIQFDQYGRRVNYSVNIMELKNSGPVK-IGYWNE---VDKMVVTKSDLFPNDTMGMENKTVIVTTILEAPYVMLKKNSELFTDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGASESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRTPVNLAVLKLSEQGVLDKMKNKWWYDKGECGS--KDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMK 845          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria2a (glutamate receptor 2-like [Source:NCBI gene;Acc:103028119])

HSP 1 Score: 538.88 bits (1387), Expect = 3.177e-176
Identity = 330/863 (38.24%), Postives = 507/863 (58.75%), Query Frame = 3
Query:  417 EYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS---TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDL--TLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVD---SKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQM-NSEIIEP 2957
            EY+AF +      F  AE  +      ++D+L  ++SF +    C      V A+FG    ++V+TI S  +   + +IT S    + ++  N+     ++++RP +   ++  +    W++  YLYDS+  L  L+ + +    R+  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I++Q+  + +    YHY++      +   S I  GG N + F  +D+++P++ +F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K         N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++I+E +    +K IG W+    +      KSDL        +N+T+ V++IL  P++M  K+     D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  +   +     S+ +NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG +++GS+KEFF  S+I +F KMWQ+M+S  P VFV N   G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+++NLAVL+L E+  + +    WW +K +C        +   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P
Sbjct:   44 EYSAFRVGMV--QFGTAEFRLTP----HIDNLEVANSFAITNCFCSQFSRGVYAIFGFYDKKSVNTITSFCETLHVSFITPS----FPADGLNQF----VLQMRPDIKGPLISLVEYYKWEKFAYLYDSDRGLSTLQAVLDTAAERKWQVTAINVGNLKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMEQVITIGRHVKGYHYIIANFGFLDGDLSKIQYGGANVSGFQIVDFDDPLVAKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVKVMTEAFRFLHKQRIDISRRGNNGDCLANPAV-PWAQGVEIERALKQVRVDGLTGNIQFDQYGRRVNYSVNIMELKNSGPVK-IGYWNEVDKMVV---TKSDLFPNDTMGMENKTVIVTTILEAPYVMLKKNSELFTDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGASESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGESKE-KTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKVTFTDAMRSKARLSITGSTGENGRVLTP 876          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 416.387 bits (1069), Expect = 1.238e-134
Identity = 228/464 (49.14%), Postives = 302/464 (65.09%), Query Frame = 3
Query: 1584 SKNRTLRVSSILVPPFLMRVKDKN---GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS---------------------------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFM-ESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            + NRT+ V++IL  P+ M  K+     G D  ++EG+C DL  EIA    F Y    V D  +GA   D+  WNGM+GEL+   AD+ +APLTI+  RE V+DFS PFM  G+S+M  KP   +P    F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  D   +V+   +                           NEF IFNS WFSL AFMQQG +ISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S +DLAKQ +I YG ++SGS+KEFF  S+I +++KMW FM ++ P VFV     G  +V+ SK +YA++LES+ NEY  Q KPC T K+G NLDS KGYGIATP GS  RD++NLAVL+L E+  + +    WW +K +C        D   +++ L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:   28 TGNRTVIVTTILDAPYFMLKKNHEQFEGND--KYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKD-KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRTEAKRMK 487          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 316.235 bits (809), Expect = 1.365e-99
Identity = 153/296 (51.69%), Postives = 204/296 (68.92%), Query Frame = 3
Query: 1815 NEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKV-SNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWK 2699
            ++ADL VAPLTI   RE+ +DFS PFM  G+S+++ KP+   P  F F+ PLS DIWM I  AYLGVS VLF+++RF+PYEW    P   DS V  N FT+ NSFWF + A MQQG ++ P++L+ RIVGG+WWFFTLII+SSYTANLAA+LTVERM +PI S +DLAKQ +I+YG V  GS+  FF  S+I  ++KMW FM S     + N   G  +V  +  +YA ++ES+  EY  Q + C  T+IG  +D+ KGYGI TP GS YRD I +A+L+L+E+ ++    E WW+
Sbjct:    8 HKADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTT--DYAMLMESTNIEYVTQ-RNCNLTQIGGLIDN-KGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWR 299          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 2.722e-55
Identity = 97/192 (50.52%), Postives = 127/192 (66.15%), Query Frame = 3
Query: 2043 FNPYEWGVDTPVEVDSKV-SNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPG 2612
            F+PYEW    P   DS V  N FT+ NS WF + A MQQG ++ PR+L+ RIVGG+WWFFTLI++SSYTANLAA+LTVERM +PI S +DLAKQ KI+YG V  GS+  FF  SRI  ++KMW FM S +    V N   G  +   +  ++A ++ES+  E+  Q + C  T+IG  +DS KGYG+  P G
Sbjct:    1 FSPYEWKNPHPCNPDSDVLENNFTMLNSLWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQTALVKNNEEGIHRALTT--DFAMLMESTTIEHVTQ-RYCNLTQIGGLIDS-KGYGVGMPLG 188          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 183.341 bits (464), Expect = 7.296e-48
Identity = 208/867 (23.99%), Postives = 379/867 (43.71%), Query Frame = 3
Query:  372 VLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVD--DLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRF----HTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKS---DLTLVNFSKNRTLRVSSILVPPFLMRVKDK---NGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFM-KPLSKDIWMCITFAYLGVSVVLFLVSRFNPYE-WG---VDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGV-VNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYY--NQLKPC-TTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFR 2900
            VL+G +F    ++  E++AF         +  E ++     VY D  DL +SF    A C      V A+F  +  R+  ++ S   A  +  +T S     A +     F   +I+L+P +   ++  I    W + +YLYD++  L+ L+ + +    R   + A + +     S+  L+ + R      +++I+LD +     + ++Q ++ +      +HY++  +   ++       GG N + F  +D   P +  F+  +W  +S      P            Y +AL  DG+ ++ +A + A+   RF      N+GD + +P   P     +++ A+  +   GLT N+QFNE G R NY + ++E R     K +G+    H    + R+++   D    +  +N+T+ V++IL  P+ M  K+     G D   FEG+C DL  EIA+ + F Y    V D  +G+   ++  WNGM+GEL+   A+  V PL    +    VD      E   +          P    F+ + L   +  C+ F +L +SV +F    +  YE W    V          +    +F+  WF   A  Q+  +  P+    R V  ++ F  +++VSS+   +  + T+  M+      +     N I   V + S S+ E+            W F    +P++   +     + V+      A +L+   N++   +Q + C    K+G   +  K YGI     S  R  +NLAVL+L E   + +    WW +K +C     +++    +++ L ++ G+FY+L GGL L +++++ E   K   E+RR +  F    R
Sbjct:    1 VLLGGLFTR--QSDQEHSAFRFGILQHNSNLNESDVPFGLTVYTDTIDLPNSFTFTKAFCSQFSRGVFAMFSVLDRRSASSLTSFCAALHVSMVTPS-----APQEPPSPF---LIELQPPLGWPLLHLIDRYEWGKFVYLYDTDRGLWLLQSVVQEATRRGWAMMALSIE---GLSEEALRQLLRDLAVRGERNIVLDCETYRVTSTLLQVVN-VGNHVKGFHYIIANLGFLDVDLDVFRYGGANVSGFQMVDRMAPQVIAFL-DKWHKQS------PHVYPGSDSLHFKYTSALAYDGVFVISQAFR-ALYKQRFDLHREGNAGDCLANPAV-PWGKGVDIQRALKNVHINGLTNNIQFNELGQRSNYTLGVMELRPTGPTK-LGSIMCVHPGGILVRHQALGEDGINSSLHQNKTVIVTTILDAPYFMYRKNYEQLTGND--RFEGYCADLGEEIARHVGFNYRWKLVPDGAYGSRDTETKIWNGMVGELVYGHAEQTVDPLCAILAFSVYVDLICSLTELASTAFIKAIQKASPNVSMFLHRVLPLSVCTCMYFLHL-LSVCVFGKPYWRTYESWTAEQVSGSRGDGGGRTRAHALFSLAWF--HAVCQERRNYIPQVSVRRAVQAIYAFINMLLVSSFLPGIVFFFTLWSMSYQFSGCKSC--NNYIADAVGLRSSSTXEWPRKVTYPHCLNPWHFNRVLSPNIRSKSTAGQVNGVRKETGWIARLLDGCCNQWVQPHQRERCDPIKKVGNYFN--KTYGIYFTHFSTPRTRVNLAVLKLSELGTLDKLKNKWWYDKGEC-GAKDAQSKDKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCCKSRAEARRYQVSFAEALR 833          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 2.972e-38
Identity = 83/225 (36.89%), Postives = 128/225 (56.89%), Query Frame = 3
Query: 1626 PFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVND-SWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIK 2297
            PF+M  ++  GK   +F+GF  D+++ ++K L F+Y I    D  +G    D +W+GMIGEL+   AD+ ++ LTIT  RE VVDF+  +M++ + V   +P D     F  + PL    W C+  A   V ++++L++R  P      +P           ++  S W    +FMQQG ++S  SL+ R+V GVWW F  I+VSSYTA+L A LT+ RM+ PI+
Sbjct:    5 PFVMLAENVLGKPK-KFQGFSVDVMDALSKSLGFSYEIFMPADLSYGLPQADGTWSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSVGVAARRPADSA-GLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTPRREPRHSP-----------SLPASLWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTINRMDPPIR 216          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 261.151 bits (666), Expect = 5.757e-78
Identity = 139/367 (37.87%), Postives = 222/367 (60.49%), Query Frame = 3
Query: 1626 PFLMRVKDKNG-KDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLG-VSVVLFLVSRFNPYEWGVDTPVEVDSK-VSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVER-MNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
            PF+M   + +  K    + GF KDL+  +++ LNF Y I   K+  +G+ V   W G+IGEL+R EAD+ + P+TIT+ RE V+DFS PF++F ++++  +P   E   F F+ P  + +W+  T   +G VS++++ + RF+P   G  T  E   +   +EF++ NS WF++++ +QQGGD +PRS +GR++   +W FTLI++S+YTANLAAY T ER + + I S EDL  Q+ +KYGV   GS   FFS S+++I+  M+Q M+S  + FV     G  K +   + +A++ +    +YYN  KPC T  +  NL   K Y +A    S + + I++A+LEL+E+  I +    WW + S+C
Sbjct:   10 PFMMIKPNASLLKGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYGSKVEGQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLT-TLGVVGLVSLIVWFLDRFSPQ--GYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQ-ETFVNGTQYGVLKAR--TQPFAYLTDQPSLDYYNMRKPCNTMLV-KNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWDDSSEC 369          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 240.736 bits (613), Expect = 2.765e-66
Identity = 163/543 (30.02%), Postives = 270/543 (49.72%), Query Frame = 3
Query: 1254 IVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTN----------PKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLV-------------NFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGA--LVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEF-------TIFNSFWFSLSAFMQQGGDIS-PRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFME----SNPDVFVPNMTIGYDKVKYS-KREYAFILESSMNEYYNQLKPCTTTKIGPNLDS----GKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTS 2756
            ++D + ++ +A++ AV++       GDQV S              P      L   I +++  G  G + F++ GF  N  IDII  +  E    +G W+T  GL       SD T+V             N   +RT+RV S    PF M V + +      FEG   DL++ ++++L+F YTI+   D + G    V  +W+G+I EL++  ADL V P+TITS R +V+DF+ PFM  G+ V+    +  +P  F F++P   D+W+ I  A LG+ VV +L S  +P+ +       ++ +V   +       +  NS W S + ++ QG D + P S +GR    VWWF   I+ ++YTAN+AA+LT  RM  PI+  EDL+ Q +I YG V +  ++ FF +S ++ +Q MW++M+      PD         Y  ++ + K +YAFI ++ + EY  +   C   K+    D+       YG A P  S Y + +++ +L+L +        E W   ++ C    ++E   +++S
Sbjct:  256 VIDSVLVIAKAIQNAVQA-------GDQVTSGNAGLFCNLTRRNPPSISGITLNKYIQKVQTAGFMGFLSFSQDGFLANPSIDIINVKENE-FDKVGEWNTKDGLMM----DSDKTVVWMSGGPGTPRDSENVLADRTIRVVSFKGSPFTMPVGNVS-SSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPY-FRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDT--------YTAIERTLKGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSGIAKTMIEEWMIERTPCAPLDEAEEQDAKSS 776          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 227.639 bits (579), Expect = 4.680e-62
Identity = 150/499 (30.06%), Postives = 255/499 (51.10%), Query Frame = 3
Query: 1353 TNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGL--------------TSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGE----FEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL--VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPE-AFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW------GVDTPVEVDS-KVSNEFTIFNSFWFSLSAFMQQGGD-ISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEY--YNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDF---VKSENDIS 2747
            T P+     L   I+++   G+   + F+ +    +   D++  R     + +G W+   GL                +P + + +      +NRTL+V +I   PF+      NG+  GE     EG+C +L+ ++++ML F + ++ V D+ FGA   V   WNG++ E++   ADL V  LTI+  R++V+DF+ P+M+ GL+V+ +KPD  E +  F  ++P   D+WM I    + V   L+L S F+P+ +         T +E    K+ +  ++  + W ++  ++ Q  D + P S +GRI   V+WF  LI++S+YTANLAA+LT++R  +PI S +DLA+Q  I YG V +   + FF ++ +  F  MWQ+M  +   FV N   G +KV      YAFI +S++ E+  +NQ+  C T     ++    GYG      S Y   ++ A+L+L+    +      W K   +C +     KSEN ++
Sbjct:  356 TEPRPDGATLLDYISQVNTTGVMNQLGFDSNRSPVDVAFDVVNLRAF-GFQKVGYWNVEEGLHLDNKKEIVWPSGRVYVPTDSTHIL-----ENRTLKVVTIAEAPFIFAQTQTNGQ--GETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVL-IKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYMRYH-HTFVNNSAEGIEKVM--NENYAFIWDSAVLEFVAHNQIS-CGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQLT 841          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 192.586 bits (488), Expect = 1.703e-50
Identity = 153/523 (29.25%), Postives = 254/523 (48.57%), Query Frame = 3
Query: 1275 LKRALKVAVKSTRFHTNSGDQVCSPVTNPK-----YCADELKPAITRIKF-MGLTGNVQFNESGFRHNYKIDIIEARVKES--LKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRT-------LRVSSILVPPFLM--------RVKDKN----------GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL--VNDS----WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQG-GDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIK---YGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
            LK A  ++  + +   N+G  + +P  + +         EL  A+  +    G TG + FN  G R N    ++  R   S  +  +G +   H    +  N+S +   N +   T       LRV +++  PF+         R  D +          G  +    GFC DL+  + + +NFTY++   +D  +G+L  VN S    WNGM+GE+++ +ADL+VA LTI + R   ++FS PF   GL+++ +K +++      F++P    +W+ +  +   V+V+L+L+ RF+P+       +    K      + ++ WFS    +  G G+ +PRS + R++G VW  F +IIV+SYTANLAA+L ++R    +   +D   +N  K   Y  V + S   +F   ++E+   M+ FME      V     G +KVK  + + AFI +S +  YY   K CT T  G  L    GYGI  P GS + ++I+LA+L   E   + E  E  W + S+C
Sbjct:  277 LKDATVISATALQNLANAGKTLTTPTASCRETQQWSSGQELFNALVNVSLPRGTTGPIAFNSDGDRKNAVYRLMNRRQSSSDAVDVVGLYENGH----VSINESIIWPGNLNTTPTGVFLSNHLRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTIL-VKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFG---RFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYF-RRQVEL-SSMYTFMEG---YNVKTAKEGIEKVKNGELK-AFIWDSPV-LYYEASKDCTLTTAG-ELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEEL-ETTWIDASKC 782          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 179.489 bits (454), Expect = 1.869e-50
Identity = 89/255 (34.90%), Postives = 147/255 (57.65%), Query Frame = 3
Query: 1950 FGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
            F F+ P  KD+W C       V+++++++ RF+PY +  +     + +  +EF++ NS WF+  + +QQGGD +PRS +GR++   +W FTLI++S+YTANLAA+ T +   + I S EDL  Q+  KYGV   GS   FF  S++ I++KM+  M S  + FV     G ++ + +   +A++ +    +YYNQ KPC T  +  NL   K Y +     S + D I++A+L+L+E+  +      WW   S+C
Sbjct:    2 FAFLMPFQKDLWACCCLVVGAVTILMWILDRFSPYGFRAEAKNTGEGE-GDEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKM-STLNTFVKGTDEGVNRSRTTP--FAYLTDQPSLDYYNQRKPCNTMLV-KNLLDAKSYALGLQRNSEWTDGISVAILQLREEGEVERIRYKWWDAMSEC 251          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 332/852 (38.97%), Postives = 500/852 (58.69%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            P+ V +G +F  +     EYTAF L       S          V +VD++  ++SF +  A C      V A+FG    R+V+T+ S   A  +  +T S    + +E      G+  ++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   S +D   + +     R  ++  ++DL+ E  ++ I+ Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  + +++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++ A+ +++  GLTGN+QF+  G R NY +D+ E R     + IG W+    L  +    S L   +  +NRT+ V++I+  P++M  K+     G D  +FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  ++        NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+++NLAVL+L E+  + +    WW +K +C        D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:   30 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVNTLTSFCGALHISLVTPS----FPTEGE----GQFTLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIMERAGQNAWQVSAICVE---SFNDAAYRRLLEDLDRRQERKYVIDLEPERLQS-ILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQ-RW-NKLDQREYPGSESPPKYTSSLTYDGVLVM--AEAFRSLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERALKQVRIQGLTGNIQFDHYGRRVNYTMDVFELR-SNGPRKIGYWNDIDKLVLVQNENSLLNDSSAMENRTVVVTTIMEGPYVMLKKNWELYEGND--QFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMK 857          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 333/855 (38.95%), Postives = 499/855 (58.36%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTK---VVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKK 2876
            P+ V +G +F  +     EYTAF L        N   N  +     V +VD++  ++SF +  A C      V A+FG    R+V+T+ S   A  +  +T S    + +E      G+  ++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   S +D   + +     R  ++  ++DL+ E  ++ I+ Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  + +++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++ A+ +++  GLTGN+QF+  G R NY +D+ E R     + IG W+    L  +    S L   +  +NRT+ V++I+  P++M  K+     G D  +FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  ++        NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R  +NLAVL+L E   + +    WW +K +C        D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E++R K
Sbjct:   30 PSSVQIGGLF--IRNTDQEYTAFRL---AIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVNTLTSFCGALHISLVTPS----FPTEGE----GQFTLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIMERAGQNAWQVSAICVE---SFNDAAYRRLLEDLDRRQERKYVIDLEPERLQS-ILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQ-RW-NKLDQREYPGSESPPKYTSSLTYDGVLVM--AEAFRSLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERALKQVRIQGLTGNIQFDHYGRRVNYTMDVFELR-SNGPRKIGYWNDIDKLVLVQNENSLLNDSSAMENRTVVVTTIMEGPYVMLKKNWELYEGND--QFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMK 857          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 315/798 (39.47%), Postives = 470/798 (58.90%), Query Frame = 3
Query:  363 PNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVS------NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQC 2714
            P+ V +G +F  +     EYTAF L       S          V +VD++  ++SF +  A C      V A+FG    R+V+T+ S   A  +  +T S    + +E      G+  ++LRP +  A++  +   +W R ++LYD++     L+ I E        +SA   +   S +D   + +     R  ++  ++DL+ E  ++ I+ Q   + K    YHY++  +  ++I     ++GG N T F  +D++ P++ + ++ +W  + +++ Y  S +  +    L Y+  L++   E  +   +  +  +R   N+GD + +P   P     +++ A+ +++  GLTGN+QF+  G R NY +D+ E R     + IG W+    L  +    S L   +  +NRT+ V++I+  P++M  K+     G D  +FEG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  ++        NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS  R+++NLAVL+L E+  + +    WW +K +C
Sbjct:   30 PSSVQIGGLF--IRNTDQEYTAFRLAIFLHNTSPNATEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVNTLTSFCGALHISLVTPS----FPTEGE----GQFTLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIMERAGQNAWQVSAICVE---SFNDAAYRRLLEDLDRRQERKYVIDLEPERLQS-ILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQ-RW-NKLDQREYPGSESPPKYTSSLTYDGVLVM--AEAFRSLRRQKIDISR-RGNAGDCLANPAA-PWNQGIDMERALKQVRIQGLTGNIQFDHYGRRVNYTMDVFELR-SNGPRKIGYWNDIDKLVLVQNENSLLNDSSAMENRTVVVTTIMEGPYVMLKKNWELYEGND--QFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC 803          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:101175340])

HSP 1 Score: 547.74 bits (1410), Expect = 2.345e-180
Identity = 326/829 (39.32%), Postives = 485/829 (58.50%), Query Frame = 3
Query:  525 QMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSI---PRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKD---KNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVE-VDSKVS----NEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS-QMNSEIIEPCVP 2966
            Q+   +C      V A+FG    R+VHT+ S   A  +  IT S      S+ T        ++LRP +  A++  +   +W + ++LYD++     L+ I E        +SA   +   + +D   + +     R  +K  ++DL+ E  +N +++Q+  + K    YHY++  +  ++I     ++GG N T F  +D++NP++ + ++ +W  + +++ Y  S    +    L Y+  +++   E  +   +  V  +R   N+GD + +P   P     +++  + +++  GLTGNVQF+  G R NY +D+ E +     + IG W+ +  L  I   P   +D T +   +NRT+ V++I+  P++M  K+     G D  ++EG+C DL +EIAK +   Y I  V D ++GA   ++  WNGM+GEL+  +A++ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW  + P E  D + S    NEF IFNS WFSL AFMQQG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ  I YG ++SGS+KEFF  S+I +++KMW +M+S  P VF      G  +V+ SK +YAF+LES+MNEY  Q KPC T K+G NLDS KGYG+ATP GS  R  +NLAVL+L E   + +    WW +K +C        D S  ++ L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     S+  S   N  ++ P  P
Sbjct:   16 QLETLLCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFT--------LQLRPPIRGALLSLLDHYDWNKFVFLYDTDRGYAILQAIMEKAGQNNWQISAICVE---NFNDANYRRLLEDLDRRQEKKFVIDLEAERLQN-MLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQ-RW-NKLDQREYPGSDAPPKYTSALTYDGVMVM--AEAFRNLRRQKVDISR-RGNAGDCLANPAA-PWNQGIDMERTLKQVRLQGLTGNVQFDHYGRRVNYTMDVFELK-NNGPRRIGYWNDADKLVLIQDSPLLPNDTTGI---ENRTVIVTTIMEGPYVMLKKNWEMYEGND--QYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGQPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDS-KGYGVATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRNEAKRMKLTFTEAMRNKARLSITGSVGENGRVLTPDCP 819          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 543.117 bits (1398), Expect = 7.454e-178
Identity = 331/842 (39.31%), Postives = 499/842 (59.26%), Query Frame = 3
Query:  498 YVDDL--SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSA-DARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKS----TRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHG--LTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKN-GKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS--WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGV----DTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMES-NPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTS-VKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQM-NSEIIEPCVP 2966
            ++D+L  ++SF +    C      V A+FG    ++V+TI S      + +IT S          N++F   II++RP +   ++  I    W +  YLYDS+  L  L+++ +    ++  ++A +       + D   + + +  +   ++ +ILD + ++ K+ I+ Q+  + +    YHY++  +   +   S I  GG N + F  +D+++P++++F   +W  E+  +   P + +     K+ Y +AL  D ++++  A +   K     TR   N+GD + +P   P     E++ A+ +++  GLTGN+QF++ G R NY ++I+E +    +K IG W+      LT +    +D T +   +N+T+ V++IL  P++M  K+ +   D   +EG+C DL  EIAK   F Y +  V D ++GA   ++  WNGM+GEL+  +AD+ VAPLTIT  RE V+DFS PFM  G+S+M  KP   +P  F F+ PL+ +IWMCI FAY+GVSVVLFLVSRF+PYEW      D  ++ +   +NEF IFNS WFSL AFM+QG DISPRSL+GRIVGGVWWFFTLII+SSYTANLAA+LTVERM +PI+S EDLAKQ +I YG ++SGS+KEFF  S+I +F KMW +M S  P VFV     G  +V+ SK +YA++LES+MNEY  Q KPC T K+G NLDS KGYGIATP GS+ R  +NLAVL+L E+  + +    WW +K +C    K      +TS + L ++ G+FY+L GGL L +++++ E  YK   E++R K  F    R     SV  S   N  ++ P  P
Sbjct:   60 HIDNLEVANSFAVTNCFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPS-----FPLDGNQQF---IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDTAAEKKWQVTAINVGNLKDERKDEAYRSLFQDLENKKERRVILDCEQDKVKD-IMDQVITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFDDPLVSKF-DQRW--EALEEKEYPGADS-----KIRYTSALTYDAVQVMTEAFRYLHKQRIDFTR-RANTGDCLANPAV-PWAQGVEIERALKQVRVEGLTGNIQFDQHGKRVNYSVNIMELKNNGPVK-IGYWNEVDKMVLTKLGEPSNDTTGM---ENKTVIVTTILEAPYVMLKKNADLFVDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNES-TNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEGVQRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS-KGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGEC--GAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKMTFGDAMRNKARLSVTGSTGENGRVMTPEFP 874          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000073268.1 (SMESG000073268.1)

HSP 1 Score: 1849.71 bits (4790), Expect = 0.000e+0
Identity = 910/912 (99.78%), Postives = 912/912 (100.00%), Query Frame = 3
Query:  273 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQMNSEIIEPCVPLREDEIKPKVEYSF 3008
            MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDD+SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTES+RKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRGLFYLLTGGLALGLMLSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQMNSEIIEPCVPLREDEIKPKVEYSF
Sbjct:    1 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRGLFYLLTGGLALGLMLSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQMNSEIIEPCVPLREDEIKPKVEYSF 912          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000073268.1 (SMESG000073268.1)

HSP 1 Score: 1716.44 bits (4444), Expect = 0.000e+0
Identity = 826/829 (99.64%), Postives = 828/829 (99.88%), Query Frame = 3
Query:  273 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSV 2759
            MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDD+SDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTES+RKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTS 
Sbjct:    1 MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDNIIKTKVVYVDDISDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSA 829          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000073692.1 (SMESG000073692.1)

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 490/872 (56.19%), Postives = 639/872 (73.28%), Query Frame = 3
Query:  372 VLVGAIFDSLDRNSPEYTAFNLKSAGKTFSNAEDN--IIKTKVVYVDDLSDSFQMAGAICQLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQ---KLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIP-RNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGKDT-GEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWG---VDTPVEVDSKV--SNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKS-ENDISQTSVKLRDIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQMNSEI 2948
            + +GAIF   D NS  Y A+  K A     N  D+      K V+VDD SDSFQ++GAICQLLV   +A+ GPIH RT++ I+SLT+   ++Y+T SD H Y+SE+ + +    IIKLRP VA A+ DFI  + W R+LY+YDS +ALFRLRM+FE TN+   +L+ADAR +       ++ YI+ +SK+ ++K I+LDL  +ESK + + Q+     +R+D+HY++T  D  E+  S++I GG+NFT FS +DY N V+ EF++  W     +   +  S  S  L     L  +AALI+DG+ +LK+ L+ ++   +   +  D+ C+P TNPK+ A +L P   +I + GLTGNV FN +GFRH + ++I E+RVK++L  IGNW+  +GL  I    +  ++     +N+T  V+ ILVPPFL +VKD NGK   G++EGFC DL+ EIA+ +NF++ I +V+D  +G+LVN +WNGMIGEL+  +ADL VAPLTITSSRERVVDFSTPFMEFGLSVMFL+   + PE FGFMKPLS+DIWMCI +AYLGVSVVLF+VSRFNP+EW    +DT    + K+  SNEF+IFNSFWFSLSAFMQQGGD+SPRSL+GRIVGGVWWFFTLIIVSSYTANLAAYLTVERM++PIKSYEDLAKQNKIKYGVV+SGSSKEFF NS+IEIF+KMW FMESNP+VFV N+++G +KV  S+REYAFILESSMN+YYN  +PC TTK+G NLDSGKGYGIATPPGS+ RDSINLAVLELKEKN+IP+  + WW+N+S+C   V+S EN I++ SV+  DIRGLF LL GGLALG+ LS+ EL YKC LES+RK K F   F+ ++  S ++ Q   +I
Sbjct:   32 ITIGAIFGGGDENSATYAAY--KWATMNSENLRDDRYFYNFKTVFVDDTSDSFQISGAICQLLVDSAVAIIGPIHRRTMNIIRSLTNHYDILYLTISDPHIYSSETEHSKKALKIIKLRPTVAEALADFIFEQKWSRMLYIYDSEDALFRLRMLFELTNANNYELNADARMFPNDAKTELINYIDVQSKKYAKKQIVLDLDNQESKRKTLDQLKNTISNRLDFHYVLTNSDFLELNHSYLIYGGVNFTAFSLIDYENDVVLEFLEKHWKNNIYKSHIKKESLFSDTLSFNDILQADAALIIDGIYVLKKVLQSSIPHQKPTQSISDEPCTPETNPKWTATQLLPKFYKIVYQGLTGNVSFNSTGFRHKFTLNIQESRVKQNLMKIGNWTQEYGLHRIDISAEHSISGQPLRRNKTRIVTGILVPPFLSKVKDSNGKPIPGKYEGFCVDLITEIARDVNFSFIIREVEDGAYGSLVNGTWNGMIGELISKKADLAVAPLTITSSRERVVDFSTPFMEFGLSVMFLQAQQKPPEIFGFMKPLSRDIWMCIAYAYLGVSVVLFMVSRFNPHEWSDKNMDTNDNKERKINTSNEFSIFNSFWFSLSAFMQQGGDLSPRSLSGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMSSPIKSYEDLAKQNKIKYGVVDSGSSKEFFLNSKIEIFKKMWLFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIATPPGSDLRDSINLAVLELKEKNKIPQMIKQWWENQSKCKKQVESNENSITKNSVRFDDIRGLFILLLGGLALGISLSILELVYKCTLESKRKSKSFMVTFKELVDQSKKREQNYDDI 901          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000013939.1 (SMESG000013939.1)

HSP 1 Score: 424.476 bits (1090), Expect = 2.138e-132
Identity = 268/793 (33.80%), Postives = 424/793 (53.47%), Query Frame = 3
Query:  516 DSFQMAGAIC-QLLVSEVIAVFGPIHPRTVHTIQSLTDANRLIYITYSDAHH--YASESTNERFGKN-------IIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRR--IDLSADARQYS---FSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVT-----EMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALK------VAVKSTRFHTNSGDQV-CSPVTNP-----------KYCADELKPAITRIKF---------MGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFL-MRVKDKNGKDTG--EFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALVNDS------WNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQN-KIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIG-PNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLD 2720
            DS ++   IC Q  V +V+A+FG       + IQ + D  +++ I +    H  Y S+ TN +F K+       +I + P + +++VD++    W    Y+ ++ + L+RL+   +  +S++  ++L+ D R  S    +  D  L+ ++     + +K +++D+   ++ + I+ ++  +  +R +Y +++      E+D  E K S +   G    I     Y N       K  WL   N      SS +        YE AL+VD L++   A+       V+ K    + N  D   C  V  P           +Y  + +  ++ +I            GLTG ++F E+G R ++ + I++ ++++    IGNWS   G+  I      +      KN+T+RV +I + PFL ++   +N K  G   +EGFC DL+N  A  L F Y IH V D+ FG  +  +      WNG+IGE++   AD+VVAPLTI+ SR RVV FS PF+ FGLSV+  KP  ++   F F +PLS  +W C   A L VS  L++++R +PYEW ++ P +   K++ +FT FN  WFS++AF+QQG D++P+S   RI+  VWWFFTLI+++ YTANLAA+LT+  M  PI  + DL      I+YG +NSGS+K FF  + +E F+ M  FM+ NP VF   +  G  KV+ SK  YAF+LES MNEY+N   PC T  +G P  D+  GYGIATP   +  ++I  A+L+L+EK  + + Y+ WW  K +C D
Sbjct:   70 DSTEVMSKICNQTSVEKVVAIFGN---NLSYIIQEIRDLTQILQIPFFTTDHVIYESDKTN-KFSKSFKPKTNYLIHMHPPILDSMVDYLIKHEWYTFSYICNTGQGLYRLQNTIKIIHSKKDYVELNVDVRYISDPRLATKD--LRNLDAYLSSHHEKRVLIDIDTPKNLDLILHRIVLMGMNRPEYQFVILTASMDEIDLTEFKYSGVEIIGFKILIDQSQKYFN------FKKIWLPWINNSRPLMSSYSM-------YEVALMVDALQIFTSAMDRIIENPVSRKHLLSYLNKEDTTNCYTVRTPGRRKIIGYHNRRY--EIINSSLGQIILEKILNENYQSGLTGTLKFEENGLRKDFSVQILKVKLEKGPVKIGNWSMKKGVV-IDNLYEKVYTKEMIKNQTVRVVTIALKPFLQLKTPKENEKLEGNERYEGFCVDLLNLTASFLGFKYEIHLVNDNSFGVKIGQNPNGTEIWNGLIGEILNGTADMVVAPLTISLSRARVVHFSEPFLTFGLSVIIKKPGKKKAGIFSFFRPLSYPVWGCYFAACLVVSCGLYIIARMSPYEWNINNPYDPHQKITRDFTFFNCVWFSIAAFVQQGVDVAPKSPGARILSSVWWFFTLIMIAYYTANLAAFLTISLMIPPINDWPDLVSPGVGIEYGTINSGSTKNFFMTTNLEPFRTMGLFMKQNPHVFRKTIEEGVKKVRSSKGNYAFLLESRMNEYFNNRYPCDTMMVGTPYGDN--GYGIATPKNYSLNENITDAILKLREKQELTKLYKKWWIEKGECND 838          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000014610.1 (SMESG000014610.1)

HSP 1 Score: 410.223 bits (1053), Expect = 2.336e-127
Identity = 282/845 (33.37%), Postives = 443/845 (52.43%), Query Frame = 3
Query:  540 IC-QLLVSEVIAVFGPIHPRTVHTIQSLTDA-NRLIYITYSDAHHYASESTNERFGKNIIKLRPLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRR--IDLSADARQYS---FSQSDGVLQYINRKSKRNSQ-KHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESNRKSYQPSSTNSQRLQKLPYEAALIVDGLEL-------------LKRAL-----------KVAVKSTRFHTNSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILVPPFLMRVKDKNGK---DTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV------NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLKPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDTPVEVDS-KVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQN-KIKYGVVNSGSSKEFFSNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNEYYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRIPEFYEFWWKNKSQCLDFVKSENDISQTSVKLR-----DIRXXXXXXXXXXXXXXXXSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKS 2930
            IC Q    ++IA FG         I  ++   N   +IT    + + S + + R    I +L     + +V+F+  + W    Y+ +  + L RL+ + E  +SR+  I+L+ D R  S    +  D  L+ +N      SQ K I++D+  +E+   ++ ++  +  +R +Y+Y++T ++  ++  +     G+N T F  ++        F  ++W ++S        STN + +     +AAL+ D ++L             L++AL           ++  K   +   SG       T  K  A+ +   ++  +  GLTGN++F + G+R N+ +  +   +   L  IG+W+   GL    R+ + +T V   KN+T+RV SI+ PPFL   + KNG+       FEGFC D++N+ A+ML F Y+IH V D+ FG ++       + WNG++GE++   AD+ VAPLTI  +R RVV FS P++ FG+SVM  KP  + P  F FM+PL+ ++W     A L VS  L++++R +PYEW +    E D  ++   FT +NS WFS +A +QQG D++P+S   RI+  VWWFFTLI+ + YTANL A+LT+  M  PI  + DL K    I++G ++SGS+KEFF  + +E F++M   M+ NP VF   +  G  +V  SK +YAF+LES MNEYYN  +PC T  +G      KGYGIAT      +D IN AVL+L+E   +   Y+ WW  K  C D          T  KLR     ++ G+FY+LT GL   L+ S+FE +Y     +RR  K+    F   MH     S
Sbjct:   71 ICEQASHHKLIAFFGGNFSYVSQDINDISSILNLPFFITDDRNYKFTSFNQSLRKPNYIFQLSFPTTDPLVEFLIQQKWVTFSYICNCGQCLHRLQRLIEKIHSRKDYIELNVDVRYISDVRLASKD--LRNLNAYLDSVSQHKRILIDMDTQENLELLLYRIVLMGMNRPEYYYVITNVELEDLDLTDFKYSGVNITGFKIINREEKAFRSF-HNEWNSQS-------KSTNLRTVT----QAALMQDAMDLFTGTIEKMLQSPSLRKALLNPNYMNCYTLRMPDKRKIYGYQSGTYEIKRSTVGKMIAEAI---LSGTRKEGLTGNIEFTDQGYRKNFNVTFMTMEMDVGLIPIGHWNDKVGLNLSNRDGNKVT-VEMIKNQTIRVVSIISPPFLQLKQPKNGETLEGNDRFEGFCVDMLNQTAQMLGFKYSIHLVNDNSFGQVIRYLSNKTEIWNGIVGEILNGTADMAVAPLTINLARARVVSFSEPYLTFGISVMIKKPGRKNPGIFSFMRPLADNVWGSYFAACLIVSCGLYVITRLSPYEW-ITYETETDGVRIKRNFTFYNSVWFSFAALVQQGVDLAPKSPGARILSSVWWFFTLIMTAYYTANLVAFLTISLMITPINDFGDLIKPGIGIEFGSLDSGSTKEFFLTTSLEPFRQMGIIMKRNPMVFTKTVDEGVKRVLKSKGKYAFLLESRMNEYYNNREPCETMVVGSPFGD-KGYGIATSLDYPMKDEINDAVLKLRENQYLDTLYKHWWIQKGGCSD--------ESTQSKLRPLTLINVAGVFYILTAGLTFALLTSLFEFYY----NARRSFKKQTDSFSEFMHQRARLS 883          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA10.000e+038.85glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA11.255e-18038.85glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA45.817e-18038.51glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA45.817e-18038.51glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA45.835e-18038.00glutamate ionotropic receptor AMPA type subunit 4 ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-13.146e-13733.65Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
glr-23.052e-12134.64Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-38.967e-11133.83GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-26.952e-10934.73Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-41.180e-9640.40GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluRIA2.845e-14533.79gene:FBgn0004619 transcript:FBtr0076982[more]
KaiR1D5.577e-14234.44gene:FBgn0038837 transcript:FBtr0083987[more]
CG111553.091e-12334.38gene:FBgn0039927 transcript:FBtr0333701[more]
CG111553.091e-12334.38gene:FBgn0039927 transcript:FBtr0089195[more]
Ekar6.130e-11732.98gene:FBgn0039916 transcript:FBtr0110906[more]
back to top
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a0.000e+038.17glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
gria4b0.000e+038.01glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria4b0.000e+038.12glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria4b0.000e+038.12glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria2a3.512e-17837.95glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf3ip20.000e+038.71TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip20.000e+039.90TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.087e-18040.22TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip24.246e-18039.95TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.445e-17740.10TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gria40.000e+038.12glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria40.000e+038.12glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria10.000e+038.85glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria10.000e+038.85glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria41.012e-18038.12glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
back to top
BLAST of Glutamate receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19490|GRIA1_RAT1.670e-18038.85Glutamate receptor 1 OS=Rattus norvegicus OX=10116... [more]
sp|Q38PU8|GRIA1_MACFA3.110e-18038.85Glutamate receptor 1 OS=Macaca fascicularis OX=954... [more]
sp|P42261|GRIA1_HUMAN3.110e-18038.85Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GR... [more]
sp|P23818|GRIA1_MOUSE5.757e-18038.85Glutamate receptor 1 OS=Mus musculus OX=10090 GN=G... [more]
sp|Q9Z2W8|GRIA4_MOUSE7.078e-18038.12Glutamate receptor 4 OS=Mus musculus OX=10090 GN=G... [more]
back to top
BLAST of Glutamate receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GZ970.000e+046.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A158R8F80.000e+043.91Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A267FKB20.000e+044.18Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267ENE60.000e+044.29Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267F5K30.000e+044.08Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4b0.000e+038.49glutamate receptor 4 [Source:NCBI gene;Acc:1030350... [more]
gria4a1.077e-17839.03glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
gria2a5.685e-17838.86glutamate receptor 2-like [Source:NCBI gene;Acc:10... [more]
gria2a1.767e-17638.15glutamate receptor 2-like [Source:NCBI gene;Acc:10... [more]
gria2a3.177e-17638.24glutamate receptor 2-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria1b1.238e-13449.14glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.11.365e-9951.69pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000002503.12.722e-5550.52pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
GRIA47.296e-4823.99glutamate ionotropic receptor AMPA type subunit 4 ... [more]
ENSPMAT00000000621.12.972e-3836.89pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412915.757e-7837.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466332.765e-6630.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302034.680e-6230.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355451.703e-5029.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412931.869e-5034.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a0.000e+038.97glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4a0.000e+038.95glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4a0.000e+039.47glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4b2.345e-18039.32glutamate receptor 4 [Source:NCBI gene;Acc:1011753... [more]
gria2b7.454e-17839.31glutamate ionotropic receptor AMPA type subunit 2 ... [more]
back to top
BLAST of Glutamate receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073268.10.000e+099.78SMESG000073268.1[more]
SMESG000073268.10.000e+099.64SMESG000073268.1[more]
SMESG000073692.10.000e+056.19SMESG000073692.1[more]
SMESG000013939.12.138e-13233.80SMESG000013939.1[more]
SMESG000014610.12.336e-12733.37SMESG000014610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030059 ID=SMED30030059|Name=Glutamate receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=3145bp
TTTCAATTTTACTGCAAGTTGCTATTTTTGTTTATTTTAGTGGATGTTAA
AATAATTTCAAACCATTCCAAGTGCGCTCAGATCGAAGCTGTAGTATTAA
CAGAGAAAAATTGTTAAATGATTGAATCAGAAATATTACGTATCTGCTGA
CGTTAAACTAATGAAACATCAATAAAGTGGATAGGAAATTTTTGCTGTCT
TTACAAATAACAAATCAAGATGAGATTGAGTCGTTTTGAAGTACAAGAAA
TCGTTAAATATTGATTTTTTCTATGGAAGTTCGGTTTGGATTGCTTATCT
TATCGGCCATATTGATACCATGTCAACCAGAACAATTGCTGAGAAAACGT
CGACAACCAATACCGAATATCGTCCTTGTTGGTGCTATTTTCGATTCCTT
GGATAGAAACTCACCTGAATACACTGCATTTAATCTAAAAAGTGCAGGAA
AAACATTCAGCAATGCGGAAGACAACATTATTAAGACTAAAGTGGTATAT
GTCGACGATTTATCAGATAGTTTTCAAATGGCTGGAGCAATTTGTCAACT
TTTAGTAAGTGAAGTAATAGCCGTTTTCGGGCCAATTCATCCAAGAACAG
TTCATACTATACAAAGTTTAACAGATGCCAACCGTTTGATATACATTACA
TACAGCGATGCTCATCATTATGCTAGTGAAAGCACAAACGAAAGATTCGG
AAAGAATATCATTAAATTGCGACCATTAGTTGCAAATGCTGTGGTAGATT
TCATTCATTCAGAAAATTGGCAAAGGATTCTTTACCTATATGATTCTAAT
GAAGCTTTATTTCGATTACGAATGATATTTGAGCATACAAATTCAAGGCG
GATTGATCTAAGTGCCGATGCTAGGCAGTATTCCTTCAGTCAGTCTGATG
GAGTTTTGCAGTATATAAATCGTAAAAGCAAACGAAATTCTCAGAAACAT
ATAATTTTGGATTTAAAGGGAGAAGAATCCAAAAATAGAATCATTCAACA
AATGGATGAGTTGAAAAAAGATAGAGTTGATTATCATTATCTTGTTACTG
AAATGGATGCCAGAGAAATTAAAAGTTCTTTCATTATCAATGGAGGCATG
AATTTCACTATATTTTCCCCATTGGATTATAATAACCCAGTTCTTAATGA
GTTTATCAAATCTCAGTGGCTCACAGAAAGCAATAGAAAATCATATCAAC
CTTCATCCACTAATTCTCAACGATTACAAAAATTGCCATATGAAGCAGCG
TTAATAGTTGACGGTCTTGAATTACTAAAAAGAGCTTTGAAAGTCGCCGT
TAAGAGTACGCGCTTTCACACAAATTCCGGGGACCAGGTTTGCAGTCCAG
TGACCAATCCAAAATACTGTGCTGATGAATTAAAACCAGCCATAACAAGA
ATAAAATTTATGGGACTAACGGGTAATGTTCAATTTAACGAATCCGGTTT
TAGGCACAATTACAAAATTGATATAATCGAAGCAAGAGTTAAGGAATCTT
TAAAAACGATCGGAAATTGGAGTACGAGCCATGGTTTAACATCCATCCCA
AGAAATAAATCAGATCTTACATTAGTCAATTTCTCTAAGAATCGAACTTT
GCGAGTTTCCAGTATTCTTGTTCCTCCATTTCTTATGAGAGTCAAAGATA
AAAATGGAAAAGATACCGGAGAATTCGAAGGGTTTTGCAAAGATTTAGTA
AATGAAATCGCAAAAATGTTGAATTTTACTTATACAATTCATCAAGTGAA
AGATGACCAATTTGGGGCTTTGGTCAATGACAGCTGGAATGGTATGATTG
GAGAGTTGATGCGTAATGAAGCCGATTTGGTAGTAGCTCCTTTAACAATT
ACATCAAGTAGAGAAAGAGTGGTCGATTTTTCAACTCCATTTATGGAATT
CGGACTTAGTGTCATGTTTTTAAAACCAGATGATCGTGAGCCAGAAGCTT
TCGGATTCATGAAACCACTCAGCAAGGACATTTGGATGTGCATTACCTTT
GCCTACTTAGGTGTCAGTGTTGTTTTGTTTTTAGTGAGTCGCTTTAATCC
GTATGAATGGGGAGTTGACACCCCTGTCGAGGTTGATTCAAAAGTATCGA
ATGAATTTACTATTTTTAATAGTTTTTGGTTTTCTCTTAGTGCATTTATG
CAACAAGGCGGAGATATTTCTCCTAGATCGTTAGCTGGGAGAATAGTTGG
CGGTGTTTGGTGGTTTTTCACGCTGATAATTGTCAGCTCATACACCGCAA
ACCTAGCCGCATATCTTACGGTTGAGAGAATGAATAACCCCATAAAATCT
TATGAAGATTTAGCAAAACAAAATAAGATTAAATATGGAGTAGTCAATTC
AGGTTCATCCAAGGAATTTTTCTCAAATTCTAGAATTGAAATTTTTCAAA
AAATGTGGCAATTTATGGAATCTAATCCAGACGTTTTTGTCCCTAATATG
ACTATTGGTTATGATAAGGTTAAATATTCTAAAAGGGAGTACGCTTTCAT
CTTGGAGTCATCAATGAATGAATATTATAATCAACTGAAGCCTTGTACAA
CCACAAAGATCGGACCGAATCTTGACAGTGGAAAGGGTTACGGGATCGCT
ACCCCACCTGGCTCAAATTACCGTGATTCGATAAACCTAGCTGTTTTAGA
ACTCAAAGAGAAAAATCGTATTCCTGAGTTTTATGAATTTTGGTGGAAAA
ATAAAAGTCAGTGTTTAGACTTTGTAAAATCAGAAAATGATATTTCTCAA
ACTTCAGTAAAATTAAGAGATATCAGGGGTTTATTTTATTTATTAACAGG
CGGCTTAGCGTTAGGATTGATGTTATCTGTTTTCGAATTGTTCTATAAAT
GTGCGCTGGAATCTCGGCGTAAAAAAAAACGATTTTGGTCCGTTTTCCGA
ATCATGATGCATCATTCCGTAGAAAAAAGTCAAATGAATTCAGAGATTAT
AGAACCTTGCGTCCCACTTAGGGAAGACGAAATAAAACCGAAAGTTGAGT
ATTCATTTTAACATAGGGCGAAATCCCGAAACCGACGATATTCTGTTTTT
TTAGTTGTGGCCAATATTTCCTCCACAAAATATTGTTTTCTGTTTGAATT
TTTTATTTATTGTAATTATAATGTTTATTAAAATTTAAACTTGAC
back to top

protein sequence of SMED30030059-orf-1

>SMED30030059-orf-1 ID=SMED30030059-orf-1|Name=SMED30030059-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=913bp
MEVRFGLLILSAILIPCQPEQLLRKRRQPIPNIVLVGAIFDSLDRNSPEY
TAFNLKSAGKTFSNAEDNIIKTKVVYVDDLSDSFQMAGAICQLLVSEVIA
VFGPIHPRTVHTIQSLTDANRLIYITYSDAHHYASESTNERFGKNIIKLR
PLVANAVVDFIHSENWQRILYLYDSNEALFRLRMIFEHTNSRRIDLSADA
RQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKD
RVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWL
TESNRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHT
NSGDQVCSPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKID
IIEARVKESLKTIGNWSTSHGLTSIPRNKSDLTLVNFSKNRTLRVSSILV
PPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGAL
VNDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFL
KPDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEWGVDT
PVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFT
LIIVSSYTANLAAYLTVERMNNPIKSYEDLAKQNKIKYGVVNSGSSKEFF
SNSRIEIFQKMWQFMESNPDVFVPNMTIGYDKVKYSKREYAFILESSMNE
YYNQLKPCTTTKIGPNLDSGKGYGIATPPGSNYRDSINLAVLELKEKNRI
PEFYEFWWKNKSQCLDFVKSENDISQTSVKLRDIRGLFYLLTGGLALGLM
LSVFELFYKCALESRRKKKRFWSVFRIMMHHSVEKSQMNSEIIEPCVPLR
EDEIKPKVEYSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0005216ion channel activity
GO:0004872receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
IPR001828ANF_lig-bd_rcpt
IPR028082Peripla_BP_I
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 570..595
score: 30.77
coord: 641..668
score: 60.71
coord: 485..513
score: 27.59
coord: 834..858
score: 36.4
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 442..810
e-value: 4.6E-83
score: 291.9
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 567..845
e-value: 2.0E-52
score: 177.0
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 452..514
e-value: 2.7E-24
score: 96.7
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 442..552
e-value: 2.6E-38
score: 130.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 554..855
e-value: 9.2E-141
score: 470.8
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 467..827
e-value: 9.2E-141
score: 470.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 149..417
e-value: 6.3E-69
score: 235.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 37..395
e-value: 6.3E-69
score: 235.0
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 544..773
e-value: 9.2E-141
score: 470.8
NoneNo IPR availablePANTHERPTHR18966:SF157GLUTAMATE RECEPTOR 1coord: 95..881
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 95..881
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.588
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 569..666
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 439..813
NoneNo IPR availableTMHMMTMhelixcoord: 645..667
NoneNo IPR availableTMHMMTMhelixcoord: 836..858
NoneNo IPR availableTMHMMTMhelixcoord: 570..589
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 75..404
e-value: 2.9E-30
score: 105.6
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 73..427