GLOBIN domain-containing protein

Overview
NameGLOBIN domain-containing protein
Smed IDSMED30030057
Length (bp)638
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GLOBIN domain-containing protein (SMED30030057) t-SNE clustered cells

Violin plots show distribution of expression levels for GLOBIN domain-containing protein (SMED30030057) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GLOBIN domain-containing protein (SMED30030057) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GLOBIN domain-containing protein (SMED30030057) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030057

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30030057SMESG000048632.1 SMESG000022262.1 dd_Smed_v4_2237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30030057SMESG000048632.1 SMESG000022262.1 dd_Smed_v4_2237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030057SMESG000048632.1 SMESG000022262.1 dd_Smed_v4_2237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30030057SMESG000048632.1 SMESG000022262.1 dd_Smed_v4_2237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30030057SMESG000022262.1 SMESG000048632.1 Contig2760GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30030057SMESG000048632.1 SMESG000022262.1 dd_Smed_v4_2237_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30030057SMESG000048632.1 SMESG000022262.1 dd_Smed_v4_2237_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GLOBIN domain-containing protein vs. Ensembl Zebrafish
Match: xgb (x globin [Source:ZFIN;Acc:ZDB-GENE-050125-1])

HSP 1 Score: 49.2914 bits (116), Expect = 5.346e-7
Identity = 36/129 (27.91%), Postives = 57/129 (44.19%), Query Frame = 3
Query:  225 LGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFA--------ATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEG 587
            +G I+F RLF  HP+   +F  F  +  L+ +  S EL+AH LR M+ +      LD  E L  +   +G SH   +    ++         A  P+L++     L     +EA K +      I+ EG
Sbjct:   50 VGIIMFVRLFETHPECKDVFFLFRDVEDLERLRTSRELRAHGLRVMSFIEKSVARLDQLERLETLALELGKSHYRYNAPPKYYGYVGAEFICAVRPILKDRWTPEL-----EEAWKTLFQYVTSIMREG 173          
BLAST of GLOBIN domain-containing protein vs. UniProt/SwissProt
Match: sp|P80721|GLB_PAREP (Globin-3 OS=Paramphistomum epiclitum OX=54403 PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 6.695e-11
Identity = 40/145 (27.59%), Postives = 68/145 (46.90%), Query Frame = 3
Query:  144 MTLTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPII 578
            MTLT   ++IL KE    V      +  G   +  LF AHP +I  F R +G ++++ ++QS  +K +A     ++  + + + N  E+  +    G  H  R VT D F +  P+  +     +K  E K AV+  L    P++
Sbjct:    1 MTLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYIIHFSRLEG-HTIENVMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAAVEKFLKHVFPMM 144          
BLAST of GLOBIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q575T0|CYGB1_ORYLA (Cytoglobin-1 OS=Oryzias latipes OX=8090 GN=cygb1 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 8.272e-10
Identity = 36/122 (29.51%), Postives = 65/122 (53.28%), Query Frame = 3
Query:  150 LTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLR-SVTCDHFAATVPVLQEILVE 512
            LT   R ++   W ++  N +     G  +  RLF   P   + F +F  +   +E+ +S++L+ HA R MN++N + E+LDN++++  +L  VG +H +R  V   +F     V+ E+L E
Sbjct:   17 LTDKERVMIQDSWAKVYQNCDDA---GVAILVRLFVNFPSSKQYFSQFKHIEDAEELEKSSQLRKHARRVMNAINTLVESLDNSDKVSSVLNAVGKAHAIRHKVDPVYFKILSGVILEVLGE 135          
BLAST of GLOBIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7M413|GLBA2_OLIMA (Extracellular giant hemoglobin major globin subunit A2 OS=Oligobrachia mashikoi OX=55676 GN=ghbA2 PE=1 SV=2)

HSP 1 Score: 52.7582 bits (125), Expect = 1.207e-7
Identity = 32/112 (28.57%), Postives = 54/112 (48.21%), Query Frame = 3
Query:  150 LTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATV 485
             T+ +R ++ ++W E       + LLG  ++  LFA  PD   LF R +G +     I S+E +AH+LR +  L+    +LD+   L  +L  +   H  R +    + A V
Sbjct:   18 CTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVNGND-----IDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFV 124          
BLAST of GLOBIN domain-containing protein vs. UniProt/SwissProt
Match: sp|P18202|GLB_TUBTU (Globin, extracellular monomeric OS=Tubifex tubifex OX=6386 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.704e-7
Identity = 31/115 (26.96%), Postives = 51/115 (44.35%), Query Frame = 3
Query:  183 EWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSK 527
            +W E       ++  G  L+  +F   P+   LF+R DG N+      S E +AHA R +  L+     LD+       L H+   H  R++  D++   V  L  +L + L +K
Sbjct:   13 QWAEAFGTSHHRLDFGLKLWNSIFRDAPEIRGLFKRVDGDNAY-----SAEFEAHAERVLGGLDMTISLLDDQAAFDAQLAHLKSQHAERNIKADYYGVFVNELLAVLPDYLGTK 122          
BLAST of GLOBIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7M416|GLB1_LIOJA (Globin-1 OS=Liolophura japonica OX=13599 PE=1 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.472e-7
Identity = 31/115 (26.96%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  225 LGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLK---SKEAKEAVKFVLT 560
             G+ LF ++F  +P +++ F  + G  SLDEI  S ++  H  + +N L      +++A  +   LK  G +HK RS+  ++F   +PV+     + +    +   K+A+K   T
Sbjct:   24 CGKALFIKMFEMNPGWVEKFPAWKG-KSLDEIKASDKITNHGGKVINELANWINNINSASGI---LKSQGTAHKGRSIGIEYFENVLPVIDATFAQQMGGAYTAAMKDALKAAWT 134          
BLAST of GLOBIN domain-containing protein vs. TrEMBL
Match: A0A0X3PJM2 (Globin OS=Schistocephalus solidus OX=70667 GN=GLB PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.738e-23
Identity = 52/146 (35.62%), Postives = 85/146 (58.22%), Query Frame = 3
Query:  150 LTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEG 587
            LT   +  L  EW ++  NKE K  LG  +FR LF  +P +I+LF+RF  + +LD I+QS   KAHA+RF+ +++ + E LD+   L ++LK +   H+ R +T + F  T+ V  + L   LKS +A+ A++ +   A  +I + 
Sbjct:    4 LTEVQKTQLCVEWKQICKNKEDKYALGTEVFRLLFTKYPHYIRLFKRFRDLPNLDSIMQSAAFKAHAMRFIGAIDAIMENLDDESCLVELLKRLAEEHRPRGITENDFYKTLDVAYDALSPALKSDDARVALRQLFDTALSVIRQS 149          
BLAST of GLOBIN domain-containing protein vs. TrEMBL
Match: A0A448WCB0 (GLOBIN domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS1751 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.201e-15
Identity = 36/104 (34.62%), Postives = 66/104 (63.46%), Query Frame = 3
Query:  267 DFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPII 578
            ++++LF++F  + SL+E+ Q+    AHALRF+N++  + E LD    L ++L+ +  SH+   VT +HF  T+ + Q+++   L S+ ++ ++K VL  A PII
Sbjct:    3 EYLQLFQQFRDLKSLEEVKQTHHFSAHALRFINAITEILECLDAENILSNVLEKLAQSHQKHKVTIEHFKVTLAIAQQVISPLLSSESSRNSLKMVLDEATPII 106          
BLAST of GLOBIN domain-containing protein vs. TrEMBL
Match: A0A183T8X6 (GLOBIN domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS12924 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.164e-13
Identity = 37/111 (33.33%), Postives = 64/111 (57.66%), Query Frame = 3
Query:  246 RLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPII 578
            RLF  +P +I+LF+RF  + +LD I+QS   KAHA+RF+ +++ + E LD+   L ++LK +   H  R +  + F   + +  + L   LKS   + A++ +   AA +I
Sbjct:    7 RLFTKYPHYIRLFKRFRDLPNLDSIMQSAAFKAHAMRFIGAIDDIMENLDDDSCLVELLKRLAEEHHPRGIRENDFCRALDIAYDALSPVLKSNNTRAALRQLFNDAAHVI 117          
BLAST of GLOBIN domain-containing protein vs. TrEMBL
Match: A0A4Z2DI85 (Ataxia telangiectasia mutated (Atm) isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000693 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 7.176e-13
Identity = 37/146 (25.34%), Postives = 80/146 (54.79%), Query Frame = 3
Query:  141 KMTLTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPII 578
            KM +       L  E   ++   +KKI +G+ +FR+L   +P+F+K+++    + +L + + S  L    +R+++S+  + E  ++ E+L   +K++   H    +T  HF + +P+  + +V  +K  + KE+++FVL+   P+I
Sbjct:    5 KMRMEQRKHSSLLYELQTILSTNDKKIEVGKAIFRQLLITNPNFMKVYKPIQSV-TLPQALNSDYLTTLGIRYVDSIIHIVENFNDEEKLQQTIKYLADKHANCGLTVAHFVSILPIFTDTIVSYMKIDDNKESMQFVLSTVFPMI 149          
BLAST of GLOBIN domain-containing protein vs. TrEMBL
Match: A0A183TC19 (GLOBIN domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS14015 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.031e-12
Identity = 30/81 (37.04%), Postives = 53/81 (65.43%), Query Frame = 3
Query:  240 FRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAAT 482
            +R+LF  +P +I+LF+RF  + +LD I+QS   KAHA+RF+ +++ + E LD+   L ++LK +   H+ R +T + F  +
Sbjct:   11 YRQLFTKYPHYIRLFKRFRDLPNLDSIMQSAAFKAHAMRFIGAIDAIMENLDDESCLVELLKRLAEEHRPRGITENDFYVS 91          
BLAST of GLOBIN domain-containing protein vs. Ensembl Cavefish
Match: cygb1 (cytoglobin-1-like [Source:NCBI gene;Acc:103043687])

HSP 1 Score: 67.3958 bits (163), Expect = 7.988e-14
Identity = 41/122 (33.61%), Postives = 66/122 (54.10%), Query Frame = 3
Query:  150 LTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLR-SVTCDHFAATVPVLQEILVE 512
            LT G + I+   WT++  NK+     G  +  RLF + P   + F +F      +E+  S +LK HALR M++LN + E +++ E+   +LK V  SH ++ SV   +F     V+ E+LVE
Sbjct:   17 LTGGEQAIIQNTWTKVYQNKDAA---GVAVLMRLFTSFPSSKQFFSQFRDTEDPEELKSSVQLKKHALRVMSALNTLVENVNDEEKTAAVLKVVAKSHAIKHSVEPRYFKLLTGVILEVLVE 135          
BLAST of GLOBIN domain-containing protein vs. Ensembl Cavefish
Match: cygb1 (cytoglobin-1-like [Source:NCBI gene;Acc:103043687])

HSP 1 Score: 61.6178 bits (148), Expect = 7.832e-12
Identity = 36/109 (33.03%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  150 LTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLR-SVTCDHF 473
            LT G + I+   WT++  NK+     G  +  RLF + P   + F +F      +E+  S +LK HALR M++LN + E +++ E+   +LK V  SH ++ SV   +F
Sbjct:   17 LTGGEQAIIQNTWTKVYQNKD---AAGVAVLMRLFTSFPSSKQFFSQFRDTEDPEELKSSVQLKKHALRVMSALNTLVENVNDEEKTAAVLKVVAKSHAIKHSVEPRYF 122          
BLAST of GLOBIN domain-containing protein vs. Ensembl Cavefish
Match: xgb (neuroglobin-like [Source:NCBI gene;Acc:107197725])

HSP 1 Score: 49.2914 bits (116), Expect = 4.846e-7
Identity = 34/106 (32.08%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  141 KMTLTAGSREILWKEWTELVPNKEKKIL-----LGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSH 443
            ++T T G  E L +E   ++    K I      +G I+F RLF  HP+   +F  F  +  L+ +  S EL+AH LR M+ +      LD  E L  +   +G SH
Sbjct:   14 QVTETRGEEETLSEEQISMIKESWKLIQEDIAKVGIIMFVRLFETHPECKDVFFLFRDVQDLERLRTSRELRAHGLRVMSFIEKSVARLDQLERLDMLAVELGKSH 119          
BLAST of GLOBIN domain-containing protein vs. Ensembl Sea Lamprey
Match: CYGB (cytoglobin [Source:HGNC Symbol;Acc:HGNC:16505])

HSP 1 Score: 54.299 bits (129), Expect = 5.810e-10
Identity = 29/94 (30.85%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  246 RLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCD--HFAATVPVLQEILVENLK 521
            RLF  HP   + F  F  + + D++  S +L+ HA R M SL+    +L   EEL  +L+ VG+SH  ++   D  ++     ++ ++L+E  K
Sbjct:    1 RLFTGHPASKQYFPMFKDLETADDLKASAKLRWHAGRVMGSLDKAVRSLRKPEELIKILRAVGLSHARKATPVDVKYYHILGGIIMDVLLETFK 94          
BLAST of GLOBIN domain-containing protein vs. Ensembl Nematostella
Match: EDO43572 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY39])

HSP 1 Score: 58.151 bits (139), Expect = 4.271e-11
Identity = 31/114 (27.19%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  144 MTLTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATV 485
            ++LT   + I+ + W  + P +    ++G+ LF R F  HP +  LF  F G+ S D++  +  L  HA R M ++     ++DN +     L+ +G  H  R++   H  A++
Sbjct:   25 ISLTPEEKAIILETWKLIEPYQR---IVGKTLFLRFFKEHPTYQDLFPEFRGL-SRDDLKSTRVLYGHASRVMKAIETAVASMDNIQAFSAYLEDLGARHNKRALKAAHLMASI 134          
BLAST of GLOBIN domain-containing protein vs. Ensembl Nematostella
Match: EDO37414 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFV0])

HSP 1 Score: 52.7582 bits (125), Expect = 5.979e-9
Identity = 34/142 (23.94%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  123 QNSINFKMTLTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVK 548
            Q ++   M L+   + ++ + W  + P K+    +G+  F R F  +PD+  LF  F  + S +E+ ++  L  HA R M ++     ++D+       L+ +G  HK R++   +  A    L + L   L+S+  +E  +
Sbjct:    9 QANLPRTMPLSEAQKYLVRETWETIEPQKQT---VGKKAFLRFFDMNPDYQNLFPEFKSL-SYEELQKANALHGHAKRVMKAVENAVMSIDDVMSFSAYLEELGRRHKTRALKPSYLEAMHGALMDTLRNLLQSQWTEETAE 146          
BLAST of GLOBIN domain-containing protein vs. Ensembl Nematostella
Match: EDO48922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV8])

HSP 1 Score: 49.2914 bits (116), Expect = 1.539e-7
Identity = 26/94 (27.66%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  246 RLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSK 527
            R F  +PD+ KLF  F  ++ + E+ Q+  L  HA R M ++      +D+AE     L+++G  HK R++   +  A      + + + LK++
Sbjct:   91 RFFEMNPDYQKLFPEFATLDQV-ELEQANALHGHAKRVMKAVENAVSAMDDAESFAAYLENLGARHKARALKPAYLDAMQVAYTDTIQDLLKTQ 183          
BLAST of GLOBIN domain-containing protein vs. Ensembl Medaka
Match: cygb1 (cytoglobin-1 [Source:NCBI gene;Acc:100049376])

HSP 1 Score: 59.3066 bits (142), Expect = 9.230e-11
Identity = 36/122 (29.51%), Postives = 65/122 (53.28%), Query Frame = 3
Query:  150 LTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLR-SVTCDHFAATVPVLQEILVE 512
            LT   R ++   W ++  N +     G  +  RLF   P   + F +F  +   +E+ +S++L+ HA R MN++N + E+LDN++++  +L  VG +H +R  V   +F     V+ E+L E
Sbjct:   17 LTDKERVMIQDSWAKVYQNCDDA---GVAILVRLFVNFPSSKQYFSQFKHIEDAEELEKSSQLRKHARRVMNAINTLVESLDNSDKVSSVLNAVGKAHAIRHKVDPVYFKILSGVILEVLGE 135          
BLAST of GLOBIN domain-containing protein vs. Ensembl Medaka
Match: cygb1 (cytoglobin-1 [Source:NCBI gene;Acc:100049376])

HSP 1 Score: 59.3066 bits (142), Expect = 9.230e-11
Identity = 36/122 (29.51%), Postives = 65/122 (53.28%), Query Frame = 3
Query:  150 LTAGSREILWKEWTELVPNKEKKILLGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLR-SVTCDHFAATVPVLQEILVE 512
            LT   R ++   W ++  N +     G  +  RLF   P   + F +F  +   +E+ +S++L+ HA R MN++N + E+LDN++++  +L  VG +H +R  V   +F     V+ E+L E
Sbjct:   17 LTDKERVMIQDSWAKVYQNCDDA---GVAILVRLFVNFPSSKQYFSQFKHIEDAEELEKSSQLRKHARRVMNAINTLVESLDNSDKVSSVLNAVGKAHAIRHKVDPVYFKILSGVILEVLGE 135          
BLAST of GLOBIN domain-containing protein vs. Ensembl Medaka
Match: xgb (neuroglobin [Source:NCBI gene;Acc:101172860])

HSP 1 Score: 47.3654 bits (111), Expect = 2.269e-6
Identity = 30/100 (30.00%), Postives = 46/100 (46.00%), Query Frame = 3
Query:  225 LGQILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSH--------KLRSVTCDHFAATVPVLQE 500
            +G I+F RLF  HP+   +F  F  +  L+ +  + EL+AH LR M+ +      LD  E L  +   +G SH            V  +   A  P+L+E
Sbjct:   49 VGIIMFVRLFETHPECKDVFFLFRDVEDLERLRTNRELRAHGLRVMSFIEKSVARLDQPERLEALAVELGKSHYHYNAPPKYYNYVGAEFICAVQPILKE 148          
BLAST of GLOBIN domain-containing protein vs. Planmine SMEST
Match: SMESG000022262.1 (SMESG000022262.1)

HSP 1 Score: 243.047 bits (619), Expect = 2.883e-81
Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 3
Query:  249 LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 596
            LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE
Sbjct:  135 LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 250          
BLAST of GLOBIN domain-containing protein vs. Planmine SMEST
Match: SMESG000022262.1 (SMESG000022262.1)

HSP 1 Score: 243.432 bits (620), Expect = 3.333e-81
Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 3
Query:  249 LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 596
            LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE
Sbjct:  150 LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 265          
BLAST of GLOBIN domain-containing protein vs. Planmine SMEST
Match: SMESG000048632.1 (SMESG000048632.1)

HSP 1 Score: 238.424 bits (607), Expect = 1.728e-79
Identity = 115/116 (99.14%), Postives = 115/116 (99.14%), Query Frame = 3
Query:  249 LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 596
            LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVT DHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE
Sbjct:  135 LFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTFDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 250          
BLAST of GLOBIN domain-containing protein vs. Planmine SMEST
Match: SMESG000048630.1 (SMESG000048630.1)

HSP 1 Score: 182.956 bits (463), Expect = 1.440e-59
Identity = 84/117 (71.79%), Postives = 100/117 (85.47%), Query Frame = 3
Query:  246 RLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 596
            RLF  HP++IKLF+RF+ M+SLDEII S+ +KAH+LRF+NSLNGVFETLD  EELGDMLKHVG SHKLR+VTC+HF ATVP+L E+L ENLKS + KE VK +L +AAPIILEGC E
Sbjct:    3 RLFTIHPEYIKLFKRFENMSSLDEIISSSAMKAHSLRFINSLNGVFETLDTPEELGDMLKHVGSSHKLRNVTCNHFVATVPILNEVLAENLKSCKVKEMVKNILNIAAPIILEGCSE 119          
BLAST of GLOBIN domain-containing protein vs. Planmine SMEST
Match: SMESG000022261.1 (SMESG000022261.1)

HSP 1 Score: 182.956 bits (463), Expect = 1.440e-59
Identity = 84/117 (71.79%), Postives = 100/117 (85.47%), Query Frame = 3
Query:  246 RLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGVFETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKEAKEAVKFVLTLAAPIILEGCRE 596
            RLF  HP++IKLF+RF+ M+SLDEII S+ +KAH+LRF+NSLNGVFETLD  EELGDMLKHVG SHKLR+VTC+HF ATVP+L E+L ENLKS + KE VK +L +AAPIILEGC E
Sbjct:    3 RLFTIHPEYIKLFKRFENMSSLDEIISSSAMKAHSLRFINSLNGVFETLDTPEELGDMLKHVGSSHKLRNVTCNHFVATVPILNEVLAENLKSCKVKEMVKNILNIAAPIILEGCSE 119          
The following BLAST results are available for this feature:
BLAST of GLOBIN domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xgb5.346e-727.91x globin [Source:ZFIN;Acc:ZDB-GENE-050125-1][more]
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLOBIN domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P80721|GLB_PAREP6.695e-1127.59Globin-3 OS=Paramphistomum epiclitum OX=54403 PE=1... [more]
sp|Q575T0|CYGB1_ORYLA8.272e-1029.51Cytoglobin-1 OS=Oryzias latipes OX=8090 GN=cygb1 P... [more]
sp|Q7M413|GLBA2_OLIMA1.207e-728.57Extracellular giant hemoglobin major globin subuni... [more]
sp|P18202|GLB_TUBTU1.704e-726.96Globin, extracellular monomeric OS=Tubifex tubifex... [more]
sp|Q7M416|GLB1_LIOJA2.472e-726.96Globin-1 OS=Liolophura japonica OX=13599 PE=1 SV=1[more]
back to top
BLAST of GLOBIN domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PJM21.738e-2335.62Globin OS=Schistocephalus solidus OX=70667 GN=GLB ... [more]
A0A448WCB05.201e-1534.62GLOBIN domain-containing protein OS=Protopolystoma... [more]
A0A183T8X65.164e-1333.33GLOBIN domain-containing protein OS=Schistocephalu... [more]
A0A4Z2DI857.176e-1325.34Ataxia telangiectasia mutated (Atm) isoform 1 OS=S... [more]
A0A183TC193.031e-1237.04GLOBIN domain-containing protein OS=Schistocephalu... [more]
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cygb17.988e-1433.61cytoglobin-1-like [Source:NCBI gene;Acc:103043687][more]
cygb17.832e-1233.03cytoglobin-1-like [Source:NCBI gene;Acc:103043687][more]
xgb4.846e-732.08neuroglobin-like [Source:NCBI gene;Acc:107197725][more]
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CYGB5.810e-1030.85cytoglobin [Source:HGNC Symbol;Acc:HGNC:16505][more]
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO435724.271e-1127.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374145.979e-923.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489221.539e-727.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GLOBIN domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cygb19.230e-1129.51cytoglobin-1 [Source:NCBI gene;Acc:100049376][more]
cygb19.230e-1129.51cytoglobin-1 [Source:NCBI gene;Acc:100049376][more]
xgb2.269e-630.00neuroglobin [Source:NCBI gene;Acc:101172860][more]
back to top
BLAST of GLOBIN domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022262.12.883e-81100.00SMESG000022262.1[more]
SMESG000022262.13.333e-81100.00SMESG000022262.1[more]
SMESG000048632.11.728e-7999.14SMESG000048632.1[more]
SMESG000048630.11.440e-5971.79SMESG000048630.1[more]
SMESG000022261.11.440e-5971.79SMESG000022261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030057 ID=SMED30030057|Name=GLOBIN domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=638bp
AATTGATACAAAAATGATAAAAGAGATAAAGTCACATGATGATTGGATAA
AATTGATTGGATGCACACAATTGGTTTACAATGCACACTCATCATTTGTT
ATTCAAATCATGCATCAATATTCAAAATTCTATTAATTTTAAAATGACCC
TTACTGCTGGCTCAAGAGAGATTTTATGGAAAGAATGGACCGAATTAGTG
CCAAACAAGGAAAAGAAAATTCTATTAGGGCAAATTTTATTTAGAAGATT
ATTTGCGGCGCATCCTGATTTTATTAAATTGTTCCGACGATTTGATGGAA
TGAATTCATTGGATGAAATTATTCAATCAACCGAATTAAAAGCGCACGCT
CTAAGATTCATGAACTCTTTGAATGGAGTTTTTGAAACATTGGACAATGC
AGAAGAACTTGGAGATATGCTAAAACATGTTGGAGTCAGTCATAAATTGA
GGAGTGTAACATGTGATCATTTCGCGGCTACTGTTCCAGTATTGCAAGAA
ATTTTGGTAGAAAATTTAAAATCCAAAGAAGCAAAAGAAGCGGTTAAATT
TGTTCTGACTTTAGCAGCACCCATAATATTAGAAGGATGCCGAGAATAAT
AAATTTATTCTCAATTTTTACTGTAAACAATTTTATAT
back to top

protein sequence of SMED30030057-orf-1

>SMED30030057-orf-1 ID=SMED30030057-orf-1|Name=SMED30030057-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=173bp
MHTHHLLFKSCINIQNSINFKMTLTAGSREILWKEWTELVPNKEKKILLG
QILFRRLFAAHPDFIKLFRRFDGMNSLDEIIQSTELKAHALRFMNSLNGV
FETLDNAEELGDMLKHVGVSHKLRSVTCDHFAATVPVLQEILVENLKSKE
AKEAVKFVLTLAAPIILEGCRE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000971Globin
IPR012292Globin/Proto
IPR009050Globin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0020037heme binding
GO:0019825oxygen binding
GO:0005344oxygen transporter activity
GO:0005506iron ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005833hemoglobin complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015671oxygen transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000971GlobinPFAMPF00042Globincoord: 15..112
e-value: 3.3E-17
score: 63.0
IPR000971GlobinPROSITEPS01033GLOBINcoord: 3..127
score: 17.778
IPR012292Globin/ProtoglobinGENE3DG3DSA:1.10.490.10coord: 2..147
e-value: 4.5E-30
score: 106.2
NoneNo IPR availablePANTHERPTHR46458FAMILY NOT NAMEDcoord: 2..135
NoneNo IPR availableCDDcd01040Mb_likecoord: 22..133
e-value: 4.67613E-21
score: 80.9834
IPR009050Globin-like superfamilySUPERFAMILYSSF46458Globin-likecoord: 3..146