PX domain-containing protein

Overview
NamePX domain-containing protein
Smed IDSMED30030056
Length (bp)1839
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PX domain-containing protein (SMED30030056) t-SNE clustered cells

Violin plots show distribution of expression levels for PX domain-containing protein (SMED30030056) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PX domain-containing protein (SMED30030056) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PX domain-containing protein (SMED30030056) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030056

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30030056SMESG000021527.1 dd_Smed_v4_8533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PX domain-containing protein vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 221.861 bits (564), Expect = 2.065e-64
Identity = 154/454 (33.92%), Postives = 243/454 (53.52%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID +L     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YEI+GIT  LA + F+ G+ ++  G  F    LQ+Y++ ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  + V  S  S+K + + +          G  + G  +     W  +  LDLS+N +  +D S+ L  K+  + L++N L+ V +L  L NL  L+LS NKL  +           L  +LGNI  L+L+ N L S   +  LYSL+ L+L  N+IE++EE+ S+ +L CLE + LL NP+ I   YR   L  FGER +E+ LD     E E   ++   +I ++  +K+K  N
Sbjct:   30 YTVYIIQVTDGSHE--WTVKHRYSDFHDLHEKLVAERKIDKNL----LPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLE---------GLHTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDYRTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSN 468          
BLAST of PX domain-containing protein vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 221.476 bits (563), Expect = 1.301e-63
Identity = 154/454 (33.92%), Postives = 243/454 (53.52%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID +L     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YEI+GIT  LA + F+ G+ ++  G  F    LQ+Y++ ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  + V  S  S+K + + +          G  + G  +     W  +  LDLS+N +  +D S+ L  K+  + L++N L+ V +L  L NL  L+LS NKL  +           L  +LGNI  L+L+ N L S   +  LYSL+ L+L  N+IE++EE+ S+ +L CLE + LL NP+ I   YR   L  FGER +E+ LD     E E   ++   +I ++  +K+K  N
Sbjct:   30 YTVYIIQVTDGSHE--WTVKHRYSDFHDLHEKLVAERKIDKNL----LPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLE---------GLHTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDYRTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSN 468          
BLAST of PX domain-containing protein vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 221.861 bits (564), Expect = 5.701e-61
Identity = 154/454 (33.92%), Postives = 243/454 (53.52%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID +L     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YEI+GIT  LA + F+ G+ ++  G  F    LQ+Y++ ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  + V  S  S+K + + +          G  + G  +     W  +  LDLS+N +  +D S+ L  K+  + L++N L+ V +L  L NL  L+LS NKL  +           L  +LGNI  L+L+ N L S   +  LYSL+ L+L  N+IE++EE+ S+ +L CLE + LL NP+ I   YR   L  FGER +E+ LD     E E   ++   +I ++  +K+K  N
Sbjct:   30 YTVYIIQVTDGSHE--WTVKHRYSDFHDLHEKLVAERKIDKNL----LPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLE---------GLHTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDYRTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSN 468          
BLAST of PX domain-containing protein vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 221.861 bits (564), Expect = 5.701e-61
Identity = 154/454 (33.92%), Postives = 243/454 (53.52%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID +L     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YEI+GIT  LA + F+ G+ ++  G  F    LQ+Y++ ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  + V  S  S+K + + +          G  + G  +     W  +  LDLS+N +  +D S+ L  K+  + L++N L+ V +L  L NL  L+LS NKL  +           L  +LGNI  L+L+ N L S   +  LYSL+ L+L  N+IE++EE+ S+ +L CLE + LL NP+ I   YR   L  FGER +E+ LD     E E   ++   +I ++  +K+K  N
Sbjct:   30 YTVYIIQVTDGSHE--WTVKHRYSDFHDLHEKLVAERKIDKNL----LPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLE---------GLHTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDYRTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSN 468          
BLAST of PX domain-containing protein vs. Ensembl Human
Match: KIF16B (kinesin family member 16B [Source:HGNC Symbol;Acc:HGNC:15869])

HSP 1 Score: 53.9138 bits (128), Expect = 1.525e-7
Identity = 27/76 (35.53%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  191 CWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLN 418
            C +   A +E E+K    D  W+  +RYS F ++H++L      L  + FPPKK F N   + + +RR  LE+YL 
Sbjct:   78 CGQGKDAHFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAERRSHLEKYLR 153          
BLAST of PX domain-containing protein vs. Ensembl Celegans
Match: F13E9.1 (pep chromosome:WBcel235:IV:10864331:10873632:1 gene:WBGene00008750.1 transcript:F13E9.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13E9.1)

HSP 1 Score: 168.703 bits (426), Expect = 1.711e-45
Identity = 138/469 (29.42%), Postives = 231/469 (49.25%), Query Frame = 2
Query:  146 QQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEF--LQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILL---------KKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQ----FEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDV-QHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASIS 1504
            Q D  F+          +  + +Y I+I        W+  +RYS+F    +H  L +     K+ + PPKK   N  ++F+ +RR ELE+Y+  LL         K     P     F D++QYEIH I ++L+ +    GD  ++        FEF+ +++++I +RL+   PT    +   D  + ++F+ RVR +K+ G    VGTSNIV N L++ +     +  L + + ++  + G ++++ET++ + V  S+       I DLL     D   G      + W  +E +DLS N ++  D SM L  +VR + ++ N + ++  +L  L +L  L+LS N L  +   + +         LGNI  L LS N +     +  LYSL  L+  GN I+ ++ ++ +  L CLE L+L  NPI     YR   LELFGER +E+KLD R  +  E   ++  ++
Sbjct:   12 QMDANFNAKILNFRMIDEGKYTVYRIQITVDT--YTWTVERRYSDFDAYDVHRFLDR-----KKSFLPPKKRLGNKDLEFIEERRLELEKYVRALLELEVWYQKQKNVHSLPLITAKFFDFHQYEIHSIVDDLSLRLGNLGDGWLESSQTSPKYFEFTPIELHAITERLRLPEPTAPDVNMVADIGNTIDFLHRVRALKIRGQKGYVGTSNIVWNSLDMSLYFCKGLKALWIADSDVCRINGIKSIRETLRRLVVHYSMKK-----IKDLL-FDEEDLETGMLVEEMDTWKCLEEVDLSFNEIKCFDESMKLLPEVRVLNVSYNSITEIGSNLAFLSSLTELDLSNNTLTKIDGWNEK---------LGNIKKLILSENAIEDLSGLGKLYSLEYLDAKGNNIQNLDAVQGIGKLPCLEILLLRDNPIRKLVEYRTKVLELFGERSSELKLDGRRPEARELDTVRVRMA 458          
BLAST of PX domain-containing protein vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 52.373 bits (124), Expect = 7.439e-7
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 2
Query:  197 KSDHAIYEIEIK---SKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNI-----LLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFF 526
            K  +A+Y + +    +  +   W+  +RYS+F  LH+ L +    L  + FP KK+FNNL  +FL KR + L  YL+      LL+ +P     + +F+   +Y     +N L +KF 
Sbjct:  263 KQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKY---ANSNPLTKKFM 377          
BLAST of PX domain-containing protein vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 52.373 bits (124), Expect = 7.439e-7
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 2
Query:  197 KSDHAIYEIEIK---SKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNI-----LLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFF 526
            K  +A+Y + +    +  +   W+  +RYS+F  LH+ L +    L  + FP KK+FNNL  +FL KR + L  YL+      LL+ +P     + +F+   +Y     +N L +KF 
Sbjct:  263 KQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKY---ANSNPLTKKFM 377          
BLAST of PX domain-containing protein vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 51.9878 bits (123), Expect = 9.007e-7
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 2
Query:  197 KSDHAIYEIEIK---SKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNI-----LLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFF 526
            K  +A+Y + +    +  +   W+  +RYS+F  LH+ L +    L  + FP KK+FNNL  +FL KR + L  YL+      LL+ +P     + +F+   +Y     +N L +KF 
Sbjct:  163 KQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKY---ANSNPLTKKFM 277          
BLAST of PX domain-containing protein vs. Ensembl Celegans
Match: snx-13 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6])

HSP 1 Score: 51.9878 bits (123), Expect = 9.007e-7
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 2
Query:  197 KSDHAIYEIEIK---SKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNI-----LLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFF 526
            K  +A+Y + +    +  +   W+  +RYS+F  LH+ L +    L  + FP KK+FNNL  +FL KR + L  YL+      LL+ +P     + +F+   +Y     +N L +KF 
Sbjct:  163 KQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKTFNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKY---ANSNPLTKKFM 277          
BLAST of PX domain-containing protein vs. Ensembl Fly
Match: CG11807 (gene:FBgn0033996 transcript:FBtr0087363)

HSP 1 Score: 151.369 bits (381), Expect = 2.671e-39
Identity = 138/500 (27.60%), Postives = 240/500 (48.00%), Query Frame = 2
Query:  131 MAKCIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIP-PASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVT----GSSSA---------VGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXI--------GDLLSIGNGDWVF-----------GRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPT-LRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNK 1528
            MA   +Q  + +V   K +    S    Y  +IK +   + W   +RY +F  LHE L   + S+ +   PPKK   N    FL +RR++LE YL  LL  F    P +L  F+D+N+Y+I  +  +LA+ F ++GD ++    ++  S L++Y+I++RL    P +L      DF HV++F  ++  + VT     +S A         +  SNI+ N+L  +++ F ++  L+ + ++ + +   E LK T++ + V ++        +         D+ S+     +            G   V  + W ++  LDL+ N L  +D S+    K+R + L+ N +  VQ+L              +L L+  S N I E       +GN+  L L+ N++ +   +  L SL+ L+L  N+IEE++E+  +A L  LE+L L GNP+     YR   L  F ER  EI LD    ++   ++L  ++  S +L++K
Sbjct:    1 MACYYRQHADTTVTVPKFSNESSSGGVTY-YDIKVRVGKVEWLVERRYRDFANLHEKLVG-EISISKKLLPPKKLVGNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSFNLNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLA----------ELPQLQLLSLSGNLIAECVDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLDNEPGNQ---QELDTALVLSALLQSK 485          
BLAST of PX domain-containing protein vs. Ensembl Fly
Match: CG11807 (gene:FBgn0033996 transcript:FBtr0310140)

HSP 1 Score: 151.369 bits (381), Expect = 2.671e-39
Identity = 138/500 (27.60%), Postives = 240/500 (48.00%), Query Frame = 2
Query:  131 MAKCIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIP-PASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVT----GSSSA---------VGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXI--------GDLLSIGNGDWVF-----------GRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPT-LRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNK 1528
            MA   +Q  + +V   K +    S    Y  +IK +   + W   +RY +F  LHE L   + S+ +   PPKK   N    FL +RR++LE YL  LL  F    P +L  F+D+N+Y+I  +  +LA+ F ++GD ++    ++  S L++Y+I++RL    P +L      DF HV++F  ++  + VT     +S A         +  SNI+ N+L  +++ F ++  L+ + ++ + +   E LK T++ + V ++        +         D+ S+     +            G   V  + W ++  LDL+ N L  +D S+    K+R + L+ N +  VQ+L              +L L+  S N I E       +GN+  L L+ N++ +   +  L SL+ L+L  N+IEE++E+  +A L  LE+L L GNP+     YR   L  F ER  EI LD    ++   ++L  ++  S +L++K
Sbjct:    1 MACYYRQHADTTVTVPKFSNESSSGGVTY-YDIKVRVGKVEWLVERRYRDFANLHEKLVG-EISISKKLLPPKKLVGNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSFNLNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLA----------ELPQLQLLSLSGNLIAECVDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLDNEPGNQ---QELDTALVLSALLQSK 485          
BLAST of PX domain-containing protein vs. Ensembl Fly
Match: CG11807 (gene:FBgn0033996 transcript:FBtr0310139)

HSP 1 Score: 151.369 bits (381), Expect = 2.671e-39
Identity = 138/500 (27.60%), Postives = 240/500 (48.00%), Query Frame = 2
Query:  131 MAKCIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIP-PASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVT----GSSSA---------VGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXI--------GDLLSIGNGDWVF-----------GRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPT-LRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNK 1528
            MA   +Q  + +V   K +    S    Y  +IK +   + W   +RY +F  LHE L   + S+ +   PPKK   N    FL +RR++LE YL  LL  F    P +L  F+D+N+Y+I  +  +LA+ F ++GD ++    ++  S L++Y+I++RL    P +L      DF HV++F  ++  + VT     +S A         +  SNI+ N+L  +++ F ++  L+ + ++ + +   E LK T++ + V ++        +         D+ S+     +            G   V  + W ++  LDL+ N L  +D S+    K+R + L+ N +  VQ+L              +L L+  S N I E       +GN+  L L+ N++ +   +  L SL+ L+L  N+IEE++E+  +A L  LE+L L GNP+     YR   L  F ER  EI LD    ++   ++L  ++  S +L++K
Sbjct:    1 MACYYRQHADTTVTVPKFSNESSSGGVTY-YDIKVRVGKVEWLVERRYRDFANLHEKLVG-EISISKKLLPPKKLVGNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSFNLNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLA----------ELPQLQLLSLSGNLIAECVDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLDNEPGNQ---QELDTALVLSALLQSK 485          
BLAST of PX domain-containing protein vs. Ensembl Fly
Match: CG5439 (gene:FBgn0032476 transcript:FBtr0080435)

HSP 1 Score: 71.633 bits (174), Expect = 9.918e-13
Identity = 35/94 (37.23%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  161 FSVLEAKLTRCWKS-DHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP 439
             ++   KL +  +S  H  YE+ I  +++   W+F +RYSEF +LH+SL K    +  + FPPKK F N+++ F+ +RRQ+L+ YL  L++  P
Sbjct:  406 ITIPHVKLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLP 499          
BLAST of PX domain-containing protein vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 50.0618 bits (118), Expect = 3.650e-6
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 2
Query:  974 KVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQN------------KLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCL 1351
            ++E L L  N ++ ++ +++  K +  ++L +N +  +++LD L +L VL++S N            KL  VY  SNRI +      L N+T L+L  N+L     +E L +L +L LG NKI +IE L++L  L+ L
Sbjct:   62 RIERLFLRWNLIKKIE-NLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEIL 198          
BLAST of PX domain-containing protein vs. Ensembl Zebrafish
Match: nisch (nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570])

HSP 1 Score: 221.09 bits (562), Expect = 5.938e-61
Identity = 145/440 (32.95%), Postives = 239/440 (54.32%), Query Frame = 2
Query:  203 DHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNC--------WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA 1495
            ++ +Y IE+K    D  WS   RYS+F +LHE L  ++  + +   PPKK     S   + KR++ELE YL  LL +FP   P  L NF+ ++ YEI+GI   LA + F NG+ ++  G  F    LQ+Y++ Q+L+   PT  + D   D  H+++F  R++ +K+ G  S VGTSNI    L  D+S F ++ ++E+++ +   +RG  +LK T+  + +  S  S+K + + +          +  + V T+C        W  +  LD+S N+++ +D S+ L  +V  + L++N L  V++L+ L NL  L+LS NKL ++           +  +LGNI  L+LS N+L +   +  LYSL+ L+L  NK+ +++E++ +  L CLE L L  NP+CI   YR   L  F +R +E+ LD     E E   ++ 
Sbjct:   25 NYTVYIIEVKVG--DHSWSVKHRYSDFHELHEKL-TVEKKIDKHLLPPKKIIGKNSKSLVEKRQKELEVYLQTLLSRFPATTPKVLSNFLLFHLYEINGIAAALAEELFHNGEQLLAAGEVFLLKPLQLYAVTQQLRLAKPTCANGDAKADLGHILDFTCRLKYLKIPGKKSTVGTSNIEEQSLLFDLSIFKALLQIEISDCDAGQIRGLPSLKPTLATLSIHLSAKSMKEILVPEASEFAQ----WEPEGVDTDCPVTAIIPTWKMLTTLDMSRNYIRCIDESVKLIPEVEFLDLSHNELSLVENLEHLYNLVHLDLSFNKLTVLE---------GVHTKLGNIKTLNLSENQLETLSGLSKLYSLVNLDLSSNKLTQLDEIKHIGLLPCLEKLNLANNPMCIIPDYRTKVLAQFCDRASEVCLDATITTEKELDTVEV 448          
BLAST of PX domain-containing protein vs. Ensembl Zebrafish
Match: nisch (nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570])

HSP 1 Score: 206.838 bits (525), Expect = 3.666e-56
Identity = 145/467 (31.05%), Postives = 239/467 (51.18%), Query Frame = 2
Query:  203 DHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKY---------------------------MRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNC--------WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA 1495
            ++ +Y IE+K    D  WS   RYS+F +LHE L  ++  + +   PPKK     S   + KR++ELE YL  LL +FP   P  L NF+ ++ YEI+GI   LA + F NG+ ++  G  F    LQ+Y++ Q+L+   PT  + D   D  H+++F  R++ +K+ G  S VGTSNI    L  D+S F ++ ++E+  + + +                           +RG  +LK T+  + +  S  S+K + + +       +     + V T+C        W  +  LD+S N+++ +D S+ L  +V  + L++N L  V++L+ L NL  L+LS NKL ++           +  +LGNI  L+LS N+L +   +  LYSL+ L+L  NK+ +++E++ +  L CLE L L  NP+CI   YR   L  F +R +E+ LD     E E   ++ 
Sbjct:   25 NYTVYIIEVKVG--DHSWSVKHRYSDFHELHEKL-TVEKKIDKHLLPPKKIIGKNSKSLVEKRQKELEVYLQTLLSRFPATTPKVLSNFLLFHLYEINGIAAALAEELFHNGEQLLAAGEVFLLKPLQLYAVTQQLRLAKPTCANGDAKADLGHILDFTCRLKYLKIPGKKSTVGTSNIEEQSLLFDLSIFKALLQIEVETLLMGFWVRLMISNCVSEVYLFIFQISDCDAGQIRGLPSLKPTLATLSIHLSAKSMKEILVPEASEFAQWE----PEGVDTDCPVTAIIPTWKMLTTLDMSRNYIRCIDESVKLIPEVEFLDLSHNELSLVENLEHLYNLVHLDLSFNKLTVLE---------GVHTKLGNIKTLNLSENQLETLSGLSKLYSLVNLDLSSNKLTQLDEIKHIGLLPCLEKLNLANNPMCIIPDYRTKVLAQFCDRASEVCLDATITTEKELDTVEV 475          
BLAST of PX domain-containing protein vs. Ensembl Zebrafish
Match: flii (FLII actin remodeling protein [Source:ZFIN;Acc:ZDB-GENE-071212-3])

HSP 1 Score: 57.3806 bits (137), Expect = 4.747e-8
Identity = 57/166 (34.34%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  947 DSVPTNCWLKVE---HLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQ--HLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLI---KLNLGGNKIEE----IEELESLATLQCLE-SLILLGNPICIKSGYRK 1405
            D++P   ++ +    +LDLS+N L  L P M     ++T+ LNNN L+  Q   L ++ +L+ L+L   +      + N +P  +L G L N+TD+DLS N+L   R+ E LYSL+   +LNL  N+I E    I++   L TL      L  L + IC  S  +K
Sbjct:  140 DNIPNQLFINLTDLLYLDLSDNNLDSLPPQMRRLVHLQTLILNNNPLMHAQLRQLPVMVSLQTLHLRNTQ-----RTQNNMPT-SLEG-LSNLTDVDLSCNDL--TRVPECLYSLVNLKRLNLSSNQISELSLCIDQWTKLETLNLSRNQLTSLPSAICKLSKLKK 296          
BLAST of PX domain-containing protein vs. Ensembl Zebrafish
Match: kif16ba (kinesin family member 16Ba [Source:ZFIN;Acc:ZDB-GENE-090313-233])

HSP 1 Score: 52.7582 bits (125), Expect = 1.178e-6
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  191 CWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYL 415
            C +     +E E+K    D  W+  +RYS F ++H+S+      L  + FPPKK F N   + + +RR +LE+YL
Sbjct: 1121 CGQGKDEHFEFEVKITVLDETWTVFRRYSRFREMHKSMKLKYPELAALDFPPKKIFGNRDERTIAERRNQLEQYL 1195          
BLAST of PX domain-containing protein vs. Ensembl Zebrafish
Match: kif16ba (kinesin family member 16Ba [Source:ZFIN;Acc:ZDB-GENE-090313-233])

HSP 1 Score: 50.447 bits (119), Expect = 7.110e-6
Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  191 CWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLN 418
            C +     +E E+K    D  W+  +RYS F ++H+S+      L  + FPPKK F N   + + +RR +LE+YL 
Sbjct:  829 CGQGKDEHFEFEVKITVLDETWTVFRRYSRFREMHKSMKLKYPELAALDFPPKKIFGNRDERTIAERRNQLEQYLR 904          
BLAST of PX domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000037169.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV465179.1:67:2160:-1 gene:ENSXETG00000015337.1 transcript:ENSXETT00000037169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 3.248e-8
Identity = 46/144 (31.94%), Postives = 78/144 (54.17%), Query Frame = 2
Query:  968 WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLG---LVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIK 1390
            W  +  LDLS+N +  +D S+ L  ++  +  ++N +  +++L  L NL  L+LS NKL     +YT            ++GNI  L L+ N L S R +  LYSL+ L+L  N+IE++  + +L T   + S++++   I IK
Sbjct:   56 WKVLTTLDLSHNRISCIDESVKLIPEIEFLDFSHNDISTIENLQHLYNLIHLDLSYNKLADLTGIYT------------KVGNIKTLSLAGNVLESLRGLNKLYSLVNLDLSQNRIEQVSAIYTL-TANKISSILMIFCVIVIK 186          
BLAST of PX domain-containing protein vs. Ensembl Xenopus
Match: SNX29 (sorting nexin 29 [Source:NCBI gene;Acc:100498265])

HSP 1 Score: 54.6842 bits (130), Expect = 2.389e-7
Identity = 31/105 (29.52%), Postives = 52/105 (49.52%), Query Frame = 2
Query:  146 QQDGEFSVLEAKLTRCW--------KSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKF 436
            Q   +F +    L   W        KS +A +  ++  + KD  W+  +RY+EF  LH  L      ++  +FPPKK+  N   KF+ +RR++L+ YL  ++ K 
Sbjct:  206 QSLSDFEISHRALINVWIPSVFLRGKSANAFHVYQVYIRIKDDEWNVYRRYTEFRSLHHKLQTKYPHIRTFHFPPKKAIGNKDAKFVEERRKQLQNYLRNVMNKI 310          
BLAST of PX domain-containing protein vs. Ensembl Xenopus
Match: SNX29 (sorting nexin 29 [Source:NCBI gene;Acc:100498265])

HSP 1 Score: 54.6842 bits (130), Expect = 4.216e-7
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  197 KSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKF 436
            KS +A +  ++  + KD  W+  +RY+EF  LH  L      ++  +FPPKK+  N   KF+ +RR++L+ YL  ++ K 
Sbjct:  658 KSANAFHVYQVYIRIKDDEWNVYRRYTEFRSLHHKLQTKYPHIRTFHFPPKKAIGNKDAKFVEERRKQLQNYLRNVMNKI 737          
BLAST of PX domain-containing protein vs. Ensembl Xenopus
Match: SNX29 (sorting nexin 29 [Source:NCBI gene;Acc:100498265])

HSP 1 Score: 54.6842 bits (130), Expect = 4.463e-7
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  197 KSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKF 436
            KS +A +  ++  + KD  W+  +RY+EF  LH  L      ++  +FPPKK+  N   KF+ +RR++L+ YL  ++ K 
Sbjct:  566 KSANAFHVYQVYIRIKDDEWNVYRRYTEFRSLHHKLQTKYPHIRTFHFPPKKAIGNKDAKFVEERRKQLQNYLRNVMNKI 645          
BLAST of PX domain-containing protein vs. Ensembl Xenopus
Match: SNX29 (sorting nexin 29 [Source:NCBI gene;Acc:100498265])

HSP 1 Score: 54.6842 bits (130), Expect = 4.471e-7
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  197 KSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKF 436
            KS +A +  ++  + KD  W+  +RY+EF  LH  L      ++  +FPPKK+  N   KF+ +RR++L+ YL  ++ K 
Sbjct:  601 KSANAFHVYQVYIRIKDDEWNVYRRYTEFRSLHHKLQTKYPHIRTFHFPPKKAIGNKDAKFVEERRKQLQNYLRNVMNKI 680          
BLAST of PX domain-containing protein vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 219.55 bits (558), Expect = 1.003e-63
Identity = 158/460 (34.35%), Postives = 245/460 (53.26%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDS---VPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRG---RLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID SL     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YE++G+T  LA + F+ G+ ++  G  F    LQ+Y+I ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  M V  S  S+K +   +          G    G      +PT  W  +  LDLS+N +  +D S+ L  K+  + L++N L  V +L  L NL  L+LS NKL             +L G   +LGN+  L+L+ N L S   +  LYSL+ ++L  N+IE+++E++S+ +L CLE L LL NP+ I   YR   L  FGER +EI LD  A  E E   ++   +I ++  +K+K  N
Sbjct:   31 YTVYVIQVTDGNHE--WTIKHRYSDFHDLHEKLVAERKIDKSL----LPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPT--WQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLS------------SLEGVHTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSN 470          
BLAST of PX domain-containing protein vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 213.001 bits (541), Expect = 1.031e-61
Identity = 148/427 (34.66%), Postives = 229/427 (53.63%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDS---VPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRG---RLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEI 1444
            + +Y I++     +  W+   RYS+F  LHE L    KID SL     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YE++G+T  LA + F+ G+ ++  G  F    LQ+Y+I ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  M V  S  S+K +   +          G    G      +PT  W  +  LDLS+N +  +D S+ L  K+  + L++N L  V +L  L NL  L+LS NKL             +L G   +LGN+  L+L+ N L S   +  LYSL+ ++L  N+IE+++E++S+ +L CLE L LL NP+ I   YR   L  FGER +E+
Sbjct:   31 YTVYVIQVTDGNHE--WTIKHRYSDFHDLHEKLVAERKIDKSL----LPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPT--WQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLS------------SLEGVHTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEV 437          
BLAST of PX domain-containing protein vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 219.55 bits (558), Expect = 1.925e-60
Identity = 158/460 (34.35%), Postives = 245/460 (53.26%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDS---VPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRG---RLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID SL     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YE++G+T  LA + F+ G+ ++  G  F    LQ+Y+I ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  M V  S  S+K +   +          G    G      +PT  W  +  LDLS+N +  +D S+ L  K+  + L++N L  V +L  L NL  L+LS NKL             +L G   +LGN+  L+L+ N L S   +  LYSL+ ++L  N+IE+++E++S+ +L CLE L LL NP+ I   YR   L  FGER +EI LD  A  E E   ++   +I ++  +K+K  N
Sbjct:   31 YTVYVIQVTDGNHE--WTIKHRYSDFHDLHEKLVAERKIDKSL----LPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPT--WQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLS------------SLEGVHTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSN 470          
BLAST of PX domain-containing protein vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 145.976 bits (367), Expect = 1.781e-38
Identity = 101/308 (32.79%), Postives = 161/308 (52.27%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIG----NGDWVFGRDS---VPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHL 1096
            + +Y I++     +  W+   RYS+F  LHE L    KID SL     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YE++G+T  LA + F+ G+ ++  G  F    LQ+Y+I ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  M V  S  S+K +   +          G    G      +PT  W  +  LDLS+N +  +D S+ L  K+  + L++N L  V +L
Sbjct:   31 YTVYVIQVTDGNHE--WTIKHRYSDFHDLHEKLVAERKIDKSL----LPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPT--WQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNL 330          
BLAST of PX domain-containing protein vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 100.138 bits (248), Expect = 2.521e-21
Identity = 74/200 (37.00%), Postives = 112/200 (56.00%), Query Frame = 2
Query:  953 VPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRG---RLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            +PT  W  +  LDLS+N +  +D S+ L  K+  + L++N L  V +L  L NL  L+LS NKL             +L G   +LGN+  L+L+ N L S   +  LYSL+ ++L  N+IE+++E++S+ +L CLE L LL NP+ I   YR   L  FGER +EI LD  A  E E   ++   +I ++  +K+K  N
Sbjct:   40 IPT--WQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLS------------SLEGVHTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSN 225          
BLAST of PX domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4G017|NISCH_RAT (Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 7.652e-61
Identity = 152/436 (34.86%), Postives = 234/436 (53.67%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRG---RLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEF 1480
            + +Y I++     +  W+   RYS+F  LHE L    KID +L     PPKK     S   + KR ++LE YL  LLK FP + P  L +F+ ++ YEI+G+T  LA + F+ G+ ++  G  F    LQ+Y+I ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++EM++ + K++RG    K T+  M V  S  S+K + + +          G  + G  +     W  +  LDLS+N +  +D S+ L  K+  + L++N ++ V +L  L NL  L+LS NKL             +L G   +LGN+  L+L+ N L     +  LYSL+ L+L  N+IE+++E++S+  L CLE + LL NP+ I   YR   L  FGER +EI LD  A  E E 
Sbjct:   31 YTVYVIQVTDGNHE--WTIKHRYSDFHDLHEKLVAERKIDKTL----LPPKKIIGKNSRSLVEKREKDLEVYLQTLLKTFPDVAPRVLAHFLHFHLYEINGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIREQLLPFDLSIFKSLHQVEMSHCDAKHVRGLVTSKPTLATMSVRFSAASMKEVLVPEASEFDEWEPEGTTLGGPVTAVIPTWQALTTLDLSHNSISEIDESVKLIPKIEYLDLSHNGVLVVDNLQHLYNLVHLDLSYNKLS------------SLEGVHTKLGNVKTLNLAGNFLERLSGLHKLYSLVNLDLRDNRIEQLDEVKSIGNLPCLEHVALLNNPLSIIPDYRTKVLSQFGERASEICLDDVATTEKEL 448          
BLAST of PX domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2I1|NISCH_HUMAN (Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3)

HSP 1 Score: 221.861 bits (564), Expect = 2.738e-60
Identity = 154/454 (33.92%), Postives = 243/454 (53.52%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID +L     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YEI+GIT  LA + F+ G+ ++  G  F    LQ+Y++ ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  + V  S  S+K + + +          G  + G  +     W  +  LDLS+N +  +D S+ L  K+  + L++N L+ V +L  L NL  L+LS NKL  +           L  +LGNI  L+L+ N L S   +  LYSL+ L+L  N+IE++EE+ S+ +L CLE + LL NP+ I   YR   L  FGER +E+ LD     E E   ++   +I ++  +K+K  N
Sbjct:   30 YTVYIIQVTDGSHE--WTVKHRYSDFHDLHEKLVAERKIDKNL----LPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLE---------GLHTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDYRTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSN 468          
BLAST of PX domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TM9|NISCH_MOUSE (Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 1.346e-59
Identity = 158/460 (34.35%), Postives = 245/460 (53.26%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSI----GNGDWVFGRDS---VPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRG---RLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQA--SISESIILKNKFQN 1537
            + +Y I++     +  W+   RYS+F  LHE L    KID SL     PPKK     S   + KR ++LE YL  LL  FP + P  L +F+ ++ YE++G+T  LA + F+ G+ ++  G  F    LQ+Y+I ++LQ   PT  S D   D  H+++F  R++ +KV+G+    GTSNI    L  D+S F S+ ++E+++ + K++RG    K T+  M V  S  S+K +   +          G    G      +PT  W  +  LDLS+N +  +D S+ L  K+  + L++N L  V +L  L NL  L+LS NKL             +L G   +LGN+  L+L+ N L S   +  LYSL+ ++L  N+IE+++E++S+ +L CLE L LL NP+ I   YR   L  FGER +EI LD  A  E E   ++   +I ++  +K+K  N
Sbjct:   31 YTVYVIQVTDGNHE--WTIKHRYSDFHDLHEKLVAERKIDKSL----LPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPT--WQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLS------------SLEGVHTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSN 470          
BLAST of PX domain-containing protein vs. UniProt/SwissProt
Match: sp|A2AL36|CNTRL_MOUSE (Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 5.923e-7
Identity = 40/115 (34.78%), Postives = 62/115 (53.91%), Query Frame = 2
Query: 1043 KVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNEL--CSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPI 1381
            K+  + L+ NL+V ++ +D L  LR LNLS NK+  +    N          + N+  L+L+ NE+        + L SL  LNL GNKI  ++++  L  LQ L SL+L+ NP+
Sbjct:  126 KLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKISKIEGLEN----------MCNLQKLNLAGNEIEHIPVWFAKKLKSLRVLNLKGNKISSLQDVSKLKPLQDLTSLVLIDNPV 230          
BLAST of PX domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9XHH2|DNAL1_CHLRE (Dynein light chain 1, axonemal OS=Chlamydomonas reinhardtii OX=3055 GN=LC1 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 2.228e-6
Identity = 38/125 (30.40%), Postives = 66/125 (52.80%), Query Frame = 2
Query: 1007 LQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPI 1381
            ++ +D +++  K  + + L+ N +  +  L  +ENLR+L+L +N   L+    N      L      + +L +SYN++ S   +E L +L  L +  NKI    E++ LA L  LE L+L GNP+
Sbjct:   37 IEKMDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRN---LIKKIEN------LDAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAALDKLEDLLLAGNPL 152          
BLAST of PX domain-containing protein vs. TrEMBL
Match: A0A158R6K9 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS424 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.748e-89
Identity = 197/468 (42.09%), Postives = 266/468 (56.84%), Query Frame = 2
Query:  161 FSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESL-CKIDDSLKQIY-FPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKL----------------------GLVYTSSN-------------RIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLD 1453
            +  L A + RC  SDH  Y+I++K   K   W  ++RY EF  L + L  K D S  Q+   P KK FNNLS  F+ +R  ELEEYLN LL  + +PP  L NFIDW +Y++HGITN LAR+  ++G+ ++  G  F  +V Q+ +INQR++S    NL N P  DF +V++F+ ++R +K+ GS   +  SNI +N L  DMS F S++ LE+ NV+L  MRGFE++K TV  + V  SL ++K L +GDL + G G+WV+G   V T  W +++  D SNNFL  LD ++ L   V  + L+NNLL ++  L  L  LRVL LS N+L                      GLV  SS              + P   LR RLG +  L LS N L SA LVEGL+SL  L+L  NKI+  EEL  L  L  L SL L GNPIC  + YR++ L + G RF  I LD
Sbjct:   26 YGCLSAAIQRCMLSDHVEYDIQLK-HPKGYTWCVTRRYREFRVLQKILQSKYDLSPNQVATLPGKKFFNNLSPAFVQQRSLELEEYLNRLLSYYTLPPPPLANFIDWEKYDVHGITNCLARQLAKDGEKVLSSGDVFVMNVYQVSAINQRMRSPVSENLFNRPDEDFGYVVKFISQIRRLKLFGSLEKIHKSNIAINALTFDMSPFRSLEYLELNNVDLASMRGFEHIKATVIQLVVHHSLKNLKNLMLGDLFAAGGGNWVYGEKPVSTLPWNQIKIADFSNNFLHLLDQTIALLPNVEILNLSNNLLTELAPLSSLSRLRVLYLSDNQLYIGEEANSCFTEVCEDEVDVPEGLVLASSAGTTDSGAERRRPLQTPLKPLRERLGEVQVLVLSKNGLRSAALVEGLFSLQHLDLSDNKIDSFEELVCLGELPHLNSLELTGNPICDNAYYRRNVLNVLGPRFPLIVLD 492          
BLAST of PX domain-containing protein vs. TrEMBL
Match: A0A068WND2 (Nischarin OS=Echinococcus granulosus OX=6210 GN=EgrG_000112400 PE=4 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.126e-88
Identity = 208/528 (39.39%), Postives = 286/528 (54.17%), Query Frame = 2
Query:  170 LEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESL-CKIDDSLKQIY-FPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKL----------------------GLVYTSSN-------------RIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNKFQNEICRNNANNEGDASILSTIFNNNNQANKQPAYPTD 1642
            L A + RC  SDH  Y+I++K   K   W  ++RY EF  L ++L  K + S  QI   P KK FNNLS  F+ +R  ELEEYLN LL  + +PP  L NFIDW +Y++HGITN LAR+  ++G  I+  G  F  +V Q+ +IN+R+ S    NL N    DF  V+EF+ R+R +K+ GS   +  S+I +N L  DMS F S++ LE+ NV+L  MRGFE++K TV  + V  SL ++K L +GDL + G G+WV+G + VPT  W +++  D SNNFL  LD ++ L   V  + L+NNLL ++  L  L  LRVL LS N+L                       LV  SS              + P   LR R+G I  L L+ N L SA LVEGL+SL  L+L  NKIE  EEL  L  L  L SL L GNPIC    YR++ L + G RF  I LD +     E+  ++       ++K    ++   +N    G   + ST   ++NQ + Q  Y  D
Sbjct:   29 LSAAIQRCMLSDHVEYDIQLK-HPKGHTWCVTRRYREFRILQKALQSKYNLSQDQIATLPGKKFFNNLSPAFVQQRSLELEEYLNRLLSYYTLPPPPLANFIDWERYDVHGITNCLARQLAKDGAKILSSGDVFIMNVYQVSAINKRMGSPVSKNLYNRADEDFGTVVEFISRIRRLKLFGSLDKIYKSSIAINTLIFDMSPFRSLEYLELNNVDLGCMRGFEHIKATVIQLVVHHSLKNLKNLMLGDLFAAGGGNWVYGENPVPTLPWDQIKIADFSNNFLHLLDQTIALLPNVEILDLSNNLLTELAPLSSLSRLRVLYLSDNQLYIGEETNPFPAEVCEDEVDILEALVLASSAGTIDSATERRRPLQTPLKPLRERVGEIQVLMLARNGLRSAALVEGLFSLQHLDLSDNKIESFEELVYLGELPHLNSLELSGNPICDDPYYRRNVLNVLGPRFPLIVLDGKRVTAKEYENVRL---HQALMKGGVVSQASPSNGLRSGAPPLSST--GSSNQISDQRDYIND 550          
BLAST of PX domain-containing protein vs. TrEMBL
Match: A0A0R3UET4 (PX domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5552 PE=4 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 5.778e-87
Identity = 188/500 (37.60%), Postives = 274/500 (54.80%), Query Frame = 2
Query:  131 MAKCIQQDGEFS---------------VLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCK---IDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKL-------------------------------------GLVYTSSNR----IPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLD 1453
            M  C+Q DG  +                L A + RC   DH  Y+I++ +  +   WS ++RY EF +L ++L     + DS + I  P K+ FNNLS+ F+ +R  ELE +LN LL  + +PP  L +FIDW +Y++HGITN LAR+  ++GD ++     F   V Q+++IN+R+ S    NL N P+ DF  V++FV RV+ +K+ GS   +  SNI +N L  DMS F  +  LE+ NV+L+ MRGFE++K TV  + V  SL ++K L +GDL ++G+GDWV G + +PT  W +++  + SNNFL  +D ++ L   V  + L+NNLL ++  L  L  LRVL LS N+L                                     G   +S+ R    +P   LR RLG +  L L+ N L SA +V+G+ SL  L+L GNKI+   EL  L  L  L SL L+GNPIC    YR++ L+L G RF+ I  D
Sbjct:    1 MVDCLQNDGIPADSVFNEDGTVKTGKGCLSAVIQRCLLGDHVEYDIKL-NHPRGHTWSVTRRYREFNELRKALHSNYALPDS-QSIRMPAKRLFNNLSLAFVHQRGLELEAFLNGLLTHYTLPPPPLADFIDWERYDVHGITNCLARQLAKDGDTVLDSNDVFVMHVYQLHAINKRMISPVSLNLFNRPNEDFGRVLDFVSRVKRLKLLGSLDKLHKSNIAINTLTFDMSPFRGLQFLELNNVDLRRMRGFEHIKATVTQLTVHHSLKNLKNLMLGDLFAVGDGDWVHGENPIPTLPWDQIKIANFSNNFLHLIDQTIALLPNVEILNLSNNLLTEIASLTSLPLLRVLYLSDNQLYIGEESNFVHNEGCELLPPDATDLPEGLALSKTSISAGTSESSTERWKRAVPLKPLRERLGEVQILVLANNGLRSASIVDGMCSLQHLDLSGNKIDSFAELTYLGNLPHLNSLELMGNPICDHPYYRRNVLDLLGPRFSLIVPD 498          
BLAST of PX domain-containing protein vs. TrEMBL
Match: A0A087VYU0 (Nischarin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000112400 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.999e-86
Identity = 198/478 (41.42%), Postives = 268/478 (56.07%), Query Frame = 2
Query:  170 LEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLK-QIY-FPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKL----------------------GLVYTSS---------NRIPEPT----LRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQ 1492
            L A + RC  SDH  Y+I++K   K   W  ++RY EF  L ++L    + L+ QI   P KK FNNLS  F+ +R  +LEEYLN LL  + +PP  L NFIDW +Y++HGITN LAR+  ++G  I+  G  F  +V Q+ +IN+R+ S    NL N    DF  V+EF+ R+R +K+ GS   +  S+I +N L  DMS F S++ LE+ NV+L  MRGFE++K TV  + V  SL ++K L +GDL + G G+WV+G + VPT  W +++  D SNNFL  LD ++ L   V  + L+NNLL ++  L  L  LRVL LS N+L                       LV  SS          R P  T    LR R+G I  L L+ N L SA LVEGL+SL  L+L  NKIE  EEL  L  L  L SL L GNPIC    YR++ L + G RF  I LD +     E+  ++
Sbjct:   29 LSAAIQRCMLSDHVEYDIQLK-HPKGHTWCVTRRYREFRILQKALQSKYNLLQDQIATLPGKKFFNNLSPAFVQQRSLQLEEYLNRLLSYYTLPPPPLANFIDWERYDVHGITNCLARQLAKDGAKILSSGDVFIMNVYQVSAINKRMGSPVSGNLYNRADEDFGTVVEFISRIRRLKLFGSLDKIYKSSIAINTLIFDMSPFRSLEYLELNNVDLGCMRGFEHIKATVIQLVVHHSLKNLKNLMLGDLFAAGGGNWVYGENPVPTLPWDQIKIADFSNNFLHLLDQTIALLPNVEILDLSNNLLTELAPLSSLSRLRVLYLSDNQLYIGEEINPSPAEVCEDEVDILEALVLASSAGTIDSATERRRPLQTLLKPLRERVGEIQVLMLARNGLRSAALVEGLFSLQHLDLSDNKIESFEELVYLGELPHLNSLELSGNPICDDPYYRRNVLNVLGPRFPLIVLDGKRVTAKEYENVR 505          
BLAST of PX domain-containing protein vs. TrEMBL
Match: A0A0X3Q0E2 (Nischarin OS=Schistocephalus solidus OX=70667 GN=NISCH PE=4 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 3.819e-84
Identity = 207/627 (33.01%), Postives = 306/627 (48.80%), Query Frame = 2
Query:  131 MAKCIQQDG---------------EFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKL------GL-VYTSSNRIPE----------------------------------------------PTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAA--DEIEFRQLQASISESIILKNKFQNEICRNNANNEGDASILSTIFNNNNQA----NKQPAYPTDGCTN----------CASRTLISSYFDKEDASPVNLEVSLESDVNEIIIF 1759
            M  C+Q D                +   L   + RC  S++A Y+IEI       CW  ++RY EF  L ++L    +  + +  P +K FNNLS  F+ +R ++LE +LN LL  + +PPA L  FIDW++Y+IHGITN LAR+  + G+ I+     +   V Q+ ++N+R+ S     L N+P+ DF HV++F+G V  +++ GS   +  SN+ +N L  DMS F  +  LE+ NV LK MRGFE +K T+  + V  SL +++ L +GDL + G GDWV+G   V T  W +++  D SNNFL  +D ++TL   V  + L+NNLL ++  L  L  LRVL +S N+L      GL + + +N +PE                                              P L  RLG I  L L+ N L SA LV G+ SL  L+L  NKI+   EL  L +L  L S+ L GNPIC    YR++TL+L G RF  I LD + A   EIE  +L  ++    +        +C      + +++   +    N+Q        P  P+  CT           C S T +    +KE    V    + +SD+ E  IF
Sbjct:    1 MVDCLQSDSRPVDSIFCEDGTVRRDAGCLTVNIPRCRLSNYAEYDIEI-CHPAGHCWCVTRRYREFRALRDALHSAYNLPEDVTLPSRKLFNNLSRAFVYQRSRDLEAFLNRLLAHYTLPPAPLAAFIDWDRYDIHGITNCLARQLSKGGETILSRNLLYSMQVYQLSAVNRRVISPVAPILFNNPNEDFGHVLDFLGNVEKLRLIGSIEKLHKSNVTINSLNFDMSPFKRLKYLELINVELKRMRGFECIKGTMTELIVHHSLKNLRNLMLGDLYAAGGGDWVYGETPVSTLPWNQIKMADFSNNFLHSIDQTITLLPMVEILNLSNNLLTELAPLTCLPYLRVLYVSGNQLYIGEEAGLDLPSPANGLPELQSGGDTTSLDAKASSEQPTVVLGTAASASTSGASELSSETRKTSPPPLHTRLGEIHVLALANNGLRSAILVAGINSLQHLDLSDNKIDSFAELVCLGSLPHLSSVDLSGNPICGNPYYRRNTLDLLGLRFTLIALDGQRATRQEIEIVELYRALKRGGVTLCSQLPAVCAPTTEVQKESTTNISTSGQNDQPVSIFQCNPEVPS--CTETAMAHGDPGPCDSLTDVDLRAEKESPGSVRQSENCKSDLLETDIF 624          
BLAST of PX domain-containing protein vs. Ensembl Cavefish
Match: nisch (nischarin [Source:NCBI gene;Acc:103045858])

HSP 1 Score: 214.927 bits (546), Expect = 5.679e-59
Identity = 148/459 (32.24%), Postives = 245/459 (53.38%), Query Frame = 2
Query:  203 DHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIP-PASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNC--------WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLD--LRAADEIEFRQLQASISESIILKNKFQN 1537
            ++ +Y IE+K  +    W    RYS+F  LHE L    KID  L     PPKK     S   + KR++ELE YL  LL +FP+  P  L  F+  + YEI+GI   LA   F  G+ ++  G  F    LQ+Y+I Q+L+   PT  + D   D  H+++F  R++ +K+ G+   VG+SNI  + L  D+S F S+ ++E+T+ +   ++G  +LK T+  + +  S  S+K + + +  S     W    + V  +C        W  +  LD+S N++  +D S+ L  +V  + L++N L  V++L  L NL  L+LS NKL ++           +  +LGNI  L+L+ N+L +   +  LYSL+ L+L  N++ +++E++ + TL CLE L L  NP+CI   YR   L  F +R +E+ LD  L    E++  ++  +I ++  +K++  N
Sbjct:   25 NYTVYVIEVKVGDHR--WIIKHRYSDFHDLHEKLTSEKKIDRHL----LPPKKIIGKNSKSLVEKRQKELEVYLQTLLSRFPVAAPKVLSVFLHLHLYEINGIAATLAEDLFHRGEQLLVAGEVFLLRPLQLYAITQQLKLAKPTCANGDAKADLGHILDFACRLKYLKIPGTKGVVGSSNIEEHHLPFDLSVFKSLLQIEITDCSSTQIKGLPSLKPTLATLSIHLSAASMKEILVPE--SAEFAQW--EPEGVAIDCPVTAIIPTWKMLTTLDMSRNYICSIDESVKLIPEVEFLDLSHNKLFLVENLQHLYNLIHLDLSYNKLTVLE---------GVHTKLGNIKTLNLAGNQLETLSGLSKLYSLVNLDLSSNRLAQLDEIKHIGTLPCLEKLFLTNNPMCIIPDYRTKVLAQFCDRASEVCLDGTLTTEKELDTVEVLKAIQKAKEVKDRMAN 464          
BLAST of PX domain-containing protein vs. Ensembl Cavefish
Match: kif16ba (kinesin family member 16Ba [Source:ZFIN;Acc:ZDB-GENE-090313-233])

HSP 1 Score: 54.299 bits (129), Expect = 3.395e-7
Identity = 32/92 (34.78%), Postives = 47/92 (51.09%), Query Frame = 2
Query:  140 CIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYL 415
            C++   + S+    L    K +H  YE E+K    D  W+  +RYS F ++H+SL      L  + FPPKK F N   + + +RR  LE YL
Sbjct: 1092 CLKDPVKISIPRYVLRGQGKDEH--YEFEVKITVLDETWTVFRRYSRFREMHKSLKMKYPELGALEFPPKKLFGNRDERMVAERRNHLELYL 1181          
BLAST of PX domain-containing protein vs. Ensembl Cavefish
Match: flii (FLII actin remodeling protein [Source:NCBI gene;Acc:103034676])

HSP 1 Score: 51.9878 bits (123), Expect = 1.965e-6
Identity = 51/144 (35.42%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  947 DSVPTNCWLKVE---HLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQ--HLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLI---KLNLGGNKIEE----IEELESLATL 1342
            D++P   ++ +    +LDLS+N L  L P M     ++T+ LNNN L+  Q   L  +  L+ L+L   +     T SN    PT    L N+ D+DLS N+L   R+ E LYSL    +LNL  N+I E    I++   L TL
Sbjct:  140 DNIPNQLFINLTDLLYLDLSDNKLDSLPPQMRRLVHLQTLILNNNPLMHAQLRQLPAMVALQTLHLRNTQ----RTQSNM---PTSLEGLTNLADVDLSCNDL--TRVPECLYSLASLKRLNLSSNQISELSLCIDQWTQLETL 274          
BLAST of PX domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 4.978e-8
Identity = 48/131 (36.64%), Postives = 70/131 (53.44%), Query Frame = 2
Query:  947 DSVPTNCWL---KVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQ--HLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLI---KLNLGGNKIEEI 1315
            +++PT  ++    V +LDLSNN L  L P M     ++T+ LNNN L+  Q   L  +  L  L++   +     T SN    PT    L ++ D+DLS+NEL  AR+ E LY+L    +LNL  N I E+
Sbjct:  140 ETIPTQLFINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLLHAQLRQLTAMTALETLHMRNTQ----RTLSNL---PTQLEALTHLADVDLSHNEL--ARVPECLYTLSALRRLNLSDNHITEL 261          
BLAST of PX domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002072.1 (pep scaffold:Pmarinus_7.0:GL481283:15294:22438:1 gene:ENSPMAG00000001882.1 transcript:ENSPMAT00000002072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.146e-6
Identity = 42/114 (36.84%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  983 HLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQ--HLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCS-ARLVEGLYSLIKLNLGGNKIEEI 1315
            +LDLSNN LQ L P M     ++T+ LNNN L   Q   L  L  L+ L+L   +      S N +P       L ++TD+DLS N++ S    +  L +L +LNL  N+I E+
Sbjct:  160 YLDLSNNRLQSLPPQMRRLVHLQTLILNNNPLQHAQLRQLPALTKLQTLHLRNTQ-----RSPNNMPASL--DALSHLTDVDLSCNDMPSIPECLYALSTLRRLNLSDNQISEM 266          
BLAST of PX domain-containing protein vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 50.0618 bits (118), Expect = 1.400e-6
Identity = 46/153 (30.07%), Postives = 78/153 (50.98%), Query Frame = 2
Query: 1025 SMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFR 1483
            S+    K+  + L+ N +V +++L  L  LRVLNL+ N++  V          +LRG L ++ +L+L  N + S + V+ L SL +L L  N I   + +  L     L  + L GNP+  ++ YR++ L   G+     +LD++   E E R
Sbjct:  113 SLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHV---------DSLRG-LHSLAELNLRRNNISSMKEVDCLPSLQRLFLSYNNIANFDGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLR---QLDMKRVTEEERR 252          
BLAST of PX domain-containing protein vs. Ensembl Sea Lamprey
Match: kif16bb (kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GENE-070424-241])

HSP 1 Score: 47.3654 bits (111), Expect = 9.866e-6
Identity = 28/88 (31.82%), Postives = 47/88 (53.41%), Query Frame = 2
Query:  197 KSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYL-NILLKKFPIPPASL 457
            K++H  ++ E+K       WS  +RYS F ++H+ +      + ++ FPPKK F N   + + +RR +LE YL N +     IP + L
Sbjct: 1199 KAEH--FQFEVKVTVLGETWSVFRRYSRFREMHKLMKARYPEVAELGFPPKKLFGNKDERVIDQRRAQLETYLRNFIAIMLRIPESPL 1284          
BLAST of PX domain-containing protein vs. Ensembl Nematostella
Match: EDO45359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ1])

HSP 1 Score: 183.341 bits (464), Expect = 9.437e-52
Identity = 134/419 (31.98%), Postives = 216/419 (51.55%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCK---IDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIP-PASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRG----FENLKETXXXXXXXXXXXXXXXXXIGDLLSIG--NGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGER 1432
            +A+Y +E+   E    W   KRY EF +LH+ L K   ID SL     PPKK F NL   ++  RR  LE YL+ LL+KF    P  L NF++  +Y++ G+T NLA++ F+ GD I+ +   + F+ LQ+Y I +RL    PT   ++   +  ++ +F+  + ++K+ G       S+ V    + D+S F S+  LE++ + ++ ++G       LK              +   +      IG  NG      +S   + W  +   D SNN    +D S++L   + ++ L++N + ++ HL+ L  L VL+LS NKL  + T+        L  +LGNI  L+L+ N+L     +E LYSL++L+L  N + E+  +  +  L CLE+L L GNP+  +S YR   L  FGER
Sbjct:   17 YAVYYVEVFITEYS--WLVRKRYREFRELHDKLVKEYHIDQSL----LPPKKYFGNLDPDYIETRRLLLEIYLHKLLEKFEDNLPDQLDNFLEGFKYDVCGVTYNLAKELFETGDKILLDKQPYTFTPLQLYCITKRLALPVPTCDVHNIHAEIGNLYDFIQNLSHLKIVGKGQQFHLSDNV--DFKYDLSLFKSLSNLEVSCIEMEAVQGLCQLLTQLKSLTVHQSAHLLKARIPHTTWNLFTPIGTTNGSSYLTPNS-NFHTWTDIRMADFSNNHFPYIDESVSLLPNIESLNLSHNCIEEINHLESLSELEVLDLSHNKLRAIPTN--------LNAKLGNIRKLNLANNQLSCVDGLEKLYSLVELDLRSNLLTEVSSVVLIGDLPCLENLHLEGNPLTKESSYRVRVLSGFGER 418          
BLAST of PX domain-containing protein vs. Ensembl Nematostella
Match: EDO27024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAE7])

HSP 1 Score: 111.309 bits (277), Expect = 2.641e-26
Identity = 108/426 (25.35%), Postives = 200/426 (46.95%), Query Frame = 2
Query:  206 HAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPAS--LGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPS-LDFVHVMEFVGRVRNVKVTGSSSAVGTS-NIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFG--------------RDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLL--VDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELF 1423
            HA+Y+I++ +K     WS  +RY EF +LH++L  +    K +  PPKK   NL +  L  RR+ LE YL  L+       +S  +  F+D + +++  +T  LA++     D I  E   F  +  Q+Y I ++LQ   P   + + S ++  ++  F+ ++ +++V G +     S + + N LE D+S F  +  L +    +K + G   L+  +K +    SL ++K L +  + +      V G              ++ V    W  + +L+LS+N +  +D S+ L   + ++ L+ N    +D+Q +D   +L  L+LS N +  V  +            L ++  L L++N L S   ++ L  LI+L +  N++  + E   L  +  L  L + GNP+  ++ YR      F
Sbjct:    1 HALYKIDVMTKSNH--WSVMRRYREFSELHKTLVNLYGIPKDM-LPPKKLTANLKLHHLESRREALEHYLQKLVNSSTYVSSSKEILAFLDVSSHDVMSVTQALAKEVSMVEDAIFVEKEHFSMTPTQLYCITKQLQLPEPIQATGETSAVELGNLYSFIYQLESLEVNGKAEKESKSFHELANHLEFDISLFKVLKSLVLNGCPVKLINGLSELQTHLKYLTAYHSLKTMKELLVDRVYTKRKAPRVQGSVAAWRTQMTARLTQNRVVVQPWTHLTNLNLSHNKIVVIDESLRLLPALESLDLSFNEFESLDLQEVDC-PSLTQLDLSHNSIQFVSATPR---------DLRHLKSLILNHNNLQSLSGLDCLVGLIELGIAENRVSTLTEFSKLTCMSQLRYLSVNGNPLTRETYYRVKIFHYF 413          
BLAST of PX domain-containing protein vs. Ensembl Nematostella
Match: EDO32737 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU94])

HSP 1 Score: 54.6842 bits (130), Expect = 4.780e-8
Identity = 25/72 (34.72%), Postives = 45/72 (62.50%), Query Frame = 2
Query:  212 IYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILL 427
            +Y++ I+ K+ +  W+  +RYS+F  LH+ LCK    +    FPPKK+  N   KF+ +RR+ L++Y+  ++
Sbjct:  213 LYQVYIRIKDDE--WNVYRRYSQFHDLHKKLCKKRSVVGSFKFPPKKTLGNKGTKFVEERRKHLQDYIRRIV 282          
BLAST of PX domain-containing protein vs. Ensembl Nematostella
Match: EDO37622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFD4])

HSP 1 Score: 50.8322 bits (120), Expect = 1.487e-6
Identity = 31/100 (31.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  206 HAIYEIEI--KSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLK-----KFPIPPASLGNFIDWNQY 484
            +A+Y I +   ++E    W+  +RYS+F  LH  L      L  +  P K++F N+   FL KRR  L+ Y+  LL      K+P     + NF++  +Y
Sbjct:  519 YAVYAISVFRATQEGTNSWTIYRRYSDFDDLHMHLKNKFGPLPNLLLPGKRTFRNMDKDFLEKRRAALDSYIQTLLSTDFLDKYPGMFEVVANFLEHGKY 618          
BLAST of PX domain-containing protein vs. Ensembl Nematostella
Match: EDO49856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV6])

HSP 1 Score: 48.1358 bits (113), Expect = 6.540e-6
Identity = 48/150 (32.00%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  977 VEHLDLSNNFL---QGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSAR-LVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTL 1414
            +EHL+LS N +    GLDP      ++  ++L  N L+    ++ LENLR L          Y ++N I +     RL ++T L L  N++ S     E + +L  LNL GN I   +E++ L  L  L +L+L+ NP+  +  YR   L
Sbjct:  143 LEHLNLSMNEIVEVSGLDPGK--LSRLAILELRGNKLMTTTGMN-LENLREL----------YLAANTIRKVEGLDRLEHLTKLHLRDNQIDSLEGFSENMKNLQYLNLRGNSISSNKEVQKLKCLPLLRALVLMENPVSDEDDYRIEVL 279          
BLAST of PX domain-containing protein vs. Ensembl Medaka
Match: nisch (nischarin [Source:NCBI gene;Acc:101164628])

HSP 1 Score: 213.386 bits (542), Expect = 1.604e-58
Identity = 140/434 (32.26%), Postives = 233/434 (53.69%), Query Frame = 2
Query:  203 DHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNC----WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEF 1480
            ++ +Y IE+   +    W+   RYS+F +LHE L    K+D  L     PPKK     S   + +R++ELE YL  LL++FP   P  L +F+ ++ YEI+GI   LA + F  G+ +++ G  F    LQ+YSI+Q+L+   PT  + D   D  H+++F  R+R +K++GS  ++GTSNI    L  D+S F S+ ++E+++ + + + G   L+ ++  M V  +   +  + + +       +      + P       W  +  +D+S+N +  +D S+ +  KV  + L+ N L  V++L  L NL  ++LS N L ++  +           RLGNI  L+L+ N+L     +  LYSL+ L+L  N++ ++EE+ +++ L CLE L L  NPICI   YR   L LFG+R  E+ LD +A  E E 
Sbjct:   25 NYTVYIIEMMVGQYR--WTVKHRYSDFHELHEKLTAEKKVDRGL----LPPKKILGKNSKSLVERRQKELELYLQALLQQFPEATPTPLASFLLFHLYEINGIATALAEELFHRGEQLLQAGQVFCLHPLQLYSISQQLRLAKPTCFNGDAKSDLGHILDFTCRLRYLKISGSRGSIGTSNIQETSLPFDLSVFKSLLQIEISDCSSQQIGGLPALRPSLVTMTVRRTTDFMTSILLPEASEFSQWEPEGLESACPVTAVIPVWRNLTTVDMSHNCISTIDSSVRVIPKVEFLDLSYNKLSSVENLQHLYNLVHVDLSFNNLRVLEAAHT---------RLGNIKTLNLAGNQLECLSGLSKLYSLVNLDLSHNQLAQLEEIRNISHLPCLEKLNLSSNPICIDPDYRTKVLALFGDRAAEVCLDCKATMEREL 443          
BLAST of PX domain-containing protein vs. Ensembl Medaka
Match: nisch (nischarin [Source:NCBI gene;Acc:101164628])

HSP 1 Score: 213.386 bits (542), Expect = 1.767e-58
Identity = 140/434 (32.26%), Postives = 233/434 (53.69%), Query Frame = 2
Query:  203 DHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLC---KIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNC----WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEF 1480
            ++ +Y IE+   +    W+   RYS+F +LHE L    K+D  L     PPKK     S   + +R++ELE YL  LL++FP   P  L +F+ ++ YEI+GI   LA + F  G+ +++ G  F    LQ+YSI+Q+L+   PT  + D   D  H+++F  R+R +K++GS  ++GTSNI    L  D+S F S+ ++E+++ + + + G   L+ ++  M V  +   +  + + +       +      + P       W  +  +D+S+N +  +D S+ +  KV  + L+ N L  V++L  L NL  ++LS N L ++  +           RLGNI  L+L+ N+L     +  LYSL+ L+L  N++ ++EE+ +++ L CLE L L  NPICI   YR   L LFG+R  E+ LD +A  E E 
Sbjct:   25 NYTVYIIEMMVGQYR--WTVKHRYSDFHELHEKLTAEKKVDRGL----LPPKKILGKNSKSLVERRQKELELYLQALLQQFPEATPTPLASFLLFHLYEINGIATALAEELFHRGEQLLQAGQVFCLHPLQLYSISQQLRLAKPTCFNGDAKSDLGHILDFTCRLRYLKISGSRGSIGTSNIQETSLPFDLSVFKSLLQIEISDCSSQQIGGLPALRPSLVTMTVRRTTDFMTSILLPEASEFSQWEPEGLESACPVTAVIPVWRNLTTVDMSHNCISTIDSSVRVIPKVEFLDLSYNKLSSVENLQHLYNLVHVDLSFNNLRVLEAAHT---------RLGNIKTLNLAGNQLECLSGLSKLYSLVNLDLSHNQLAQLEEIRNISHLPCLEKLNLSSNPICIDPDYRTKVLALFGDRAAEVCLDCKATMEREL 443          
BLAST of PX domain-containing protein vs. Ensembl Medaka
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:101164384])

HSP 1 Score: 56.9954 bits (136), Expect = 6.035e-8
Identity = 57/206 (27.67%), Postives = 97/206 (47.09%), Query Frame = 2
Query:  968 WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVD-VQHLDILENLRVLNLSQNKLGLVYTSSNRIPE--PTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNKFQNEICRNNANNEGDA 1576
            WL++  L+ S N +  LD S++L   ++++ L++N + +  + L  L  L  LNL  N L        R P   P+ R +L     L L  NEL +   VE L SL  L+L  N + E  +L  L+ L CL +L L GNP+  +  +R   +     R   +K+  +A+  +         + S+I+  +  N+   + A +  D+
Sbjct:  163 WLELHTLNFSYNAIACLDQSISLLNVLKSLDLSHNKIQECTEFLKPLSELEHLNLGYNCL-------QRAPTLGPSARSKL---LTLILRNNELETINGVEQLSSLQHLDLAYNLLLEHSQLAPLSLLHCLNTLNLQGNPLFFQKTHRLCAVRHLSPRAASLKVLPKASQLVHI-----PTAPSVIVLQEPSNQEASSGAGDLSDS 353          
BLAST of PX domain-containing protein vs. Ensembl Medaka
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:101164384])

HSP 1 Score: 56.6102 bits (135), Expect = 6.601e-8
Identity = 53/166 (31.93%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  968 WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVD-VQHLDILENLRVLNLSQNKLGLVYTSSNRIPE--PTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDL 1456
            WL++  L+ S N +  LD S++L   ++++ L++N + +  + L  L  L  LNL  N L        R P   P+ R +L     L L  NEL +   VE L SL  L+L  N + E  +L  L+ L CL +L L GNP+  +  +R   +     R   +KL L
Sbjct:  163 WLELHTLNFSYNAIACLDQSISLLNVLKSLDLSHNKIQECTEFLKPLSELEHLNLGYNCL-------QRAPTLGPSARSKL---LTLILRNNELETINGVEQLSSLQHLDLAYNLLLEHSQLAPLSLLHCLNTLNLQGNPLFFQKTHRLCAVRHLSPRAASLKLRL 318          
BLAST of PX domain-containing protein vs. Ensembl Medaka
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:101164384])

HSP 1 Score: 56.6102 bits (135), Expect = 7.623e-8
Identity = 53/166 (31.93%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  968 WLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVD-VQHLDILENLRVLNLSQNKLGLVYTSSNRIPE--PTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDL 1456
            WL++  L+ S N +  LD S++L   ++++ L++N + +  + L  L  L  LNL  N L        R P   P+ R +L     L L  NEL +   VE L SL  L+L  N + E  +L  L+ L CL +L L GNP+  +  +R   +     R   +KL L
Sbjct:  163 WLELHTLNFSYNAIACLDQSISLLNVLKSLDLSHNKIQECTEFLKPLSELEHLNLGYNCL-------QRAPTLGPSARSKL---LTLILRNNELETINGVEQLSSLQHLDLAYNLLLEHSQLAPLSLLHCLNTLNLQGNPLFFQKTHRLCAVRHLSPRAASLKLRL 318          
BLAST of PX domain-containing protein vs. Planmine SMEST
Match: SMESG000021527.1 (SMESG000021527.1)

HSP 1 Score: 1035.4 bits (2676), Expect = 0.000e+0
Identity = 536/543 (98.71%), Postives = 541/543 (99.63%), Query Frame = 2
Query:  131 MAKCIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNKFQNEICRNNANNEGDASILSTIFNNNNQANKQPAYPTDGCTNCASRTLISSYFDKEDASPVNLEVSLESDVNEIIIF 1759
            MAKCIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKE DICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETVKLMKVSSSLYSVKLL+IGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGL+YTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNKFQNEICRNNANNEG+ASILSTIFNNNNQ NKQPAYPT+GCTNCASRTL+SSYFDKEDASPVNLEVSLESDVNEIIIF
Sbjct:    1 MAKCIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKENDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETVKLMKVSSSLYSVKLLAIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLLYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQASISESIILKNKFQNEICRNNANNEGNASILSTIFNNNNQTNKQPAYPTEGCTNCASRTLLSSYFDKEDASPVNLEVSLESDVNEIIIF 543          
BLAST of PX domain-containing protein vs. Planmine SMEST
Match: SMESG000024931.1 (SMESG000024931.1)

HSP 1 Score: 201.445 bits (511), Expect = 1.282e-54
Identity = 139/434 (32.03%), Postives = 229/434 (52.76%), Query Frame = 2
Query:  215 YEIEIKSKEKDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVT-------GSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETXXXXXXXXXXXXXXXXXIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQ 1492
            YE+ ++    +I W   KRYSEFL+L++ L  +D + K +YFPPK+ F   S   L +R++ LE Y+N ++       P  L  F++  +YEIHGIT NLA+  F++G+ ++     FE S+L IYSINQR+ S +PTN+ N PS DF +V+E +   + +K+        GS S  GTSNI    L  D+S F+    LE+ +V +  ++G   +   V+ +K    L S++ +  GDL+   +          P   W+  +  D SNN +  +D S+   K+V  + L+ N + ++ +L  L  L  L+LS N L L    S          +LG++  L L  N+L    +++ ++SL  L++  N I E + L  L  L CLE+L +  NPIC    +     ++F ++ + IK++  + D++  +  Q
Sbjct:   29 YEVLVQFP-SNINWKLRKRYSEFLKLYDELASLDSNFK-VYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGAQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP---WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENIS-------FSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQ 450          
BLAST of PX domain-containing protein vs. Planmine SMEST
Match: SMESG000002561.1 (SMESG000002561.1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.096e-7
Identity = 53/201 (26.37%), Postives = 87/201 (43.28%), Query Frame = 2
Query:  899 IGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGER-FNEIKLDLRAADEIEFRQLQAS 1498
            +G L+ +  GD  F      +  W ++ HLD+  N L+ +D S++L  ++  + ++ N L  +  ++ +  L  LN S N +  +   +N   +  + G           YN L     +     L  LN   N I   + +  L  L  L++LIL GNPIC  S YR   L+       ++ +LD R     E   LQ S
Sbjct:  162 LGSLIELCGGDESF------SGSWSELLHLDVRYNRLKSIDNSVSLLSQLTVLDVSRNDLESISFVEKIPTLVCLNASYNFIKTLPKIANHCLKVLIIG-----------YNYLEGLANIVHFQLLSTLNASYNVISTYKYMSDLNELNFLKNLILRGNPICSSSNYRFELLKTVSSHVMSDFELDGRIISNKERTLLQKS 345          
BLAST of PX domain-containing protein vs. Planmine SMEST
Match: SMESG000002561.1 (SMESG000002561.1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.256e-7
Identity = 53/201 (26.37%), Postives = 87/201 (43.28%), Query Frame = 2
Query:  899 IGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGER-FNEIKLDLRAADEIEFRQLQAS 1498
            +G L+ +  GD  F      +  W ++ HLD+  N L+ +D S++L  ++  + ++ N L  +  ++ +  L  LN S N +  +   +N   +  + G           YN L     +     L  LN   N I   + +  L  L  L++LIL GNPIC  S YR   L+       ++ +LD R     E   LQ S
Sbjct:  143 LGSLIELCGGDESF------SGSWSELLHLDVRYNRLKSIDNSVSLLSQLTVLDVSRNDLESISFVEKIPTLVCLNASYNFIKTLPKIANHCLKVLIIG-----------YNYLEGLANIVHFQLLSTLNASYNVISTYKYMSDLNELNFLKNLILRGNPICSSSNYRFELLKTVSSHVMSDFELDGRIISNKERTLLQKS 326          
The following BLAST results are available for this feature:
BLAST of PX domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NISCH2.065e-6433.92nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
NISCH1.301e-6333.92nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
NISCH5.701e-6133.92nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
NISCH5.701e-6133.92nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
KIF16B1.525e-735.53kinesin family member 16B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F13E9.11.711e-4529.42pep chromosome:WBcel235:IV:10864331:10873632:1 gen... [more]
snx-137.439e-730.51Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
snx-137.439e-730.51Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
snx-139.007e-730.51Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
snx-139.007e-730.51Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9U2U6... [more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG118072.671e-3927.60gene:FBgn0033996 transcript:FBtr0087363[more]
CG118072.671e-3927.60gene:FBgn0033996 transcript:FBtr0310140[more]
CG118072.671e-3927.60gene:FBgn0033996 transcript:FBtr0310139[more]
CG54399.918e-1337.23gene:FBgn0032476 transcript:FBtr0080435[more]
sds223.650e-632.61gene:FBgn0028992 transcript:FBtr0083436[more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nisch5.938e-6132.95nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570][more]
nisch3.666e-5631.05nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570][more]
flii4.747e-834.34FLII actin remodeling protein [Source:ZFIN;Acc:ZDB... [more]
kif16ba1.178e-634.67kinesin family member 16Ba [Source:ZFIN;Acc:ZDB-GE... [more]
kif16ba7.110e-634.21kinesin family member 16Ba [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000037169.13.248e-831.94pep primary_assembly:Xenopus_tropicalis_v9.1:KV465... [more]
SNX292.389e-729.52sorting nexin 29 [Source:NCBI gene;Acc:100498265][more]
SNX294.216e-733.75sorting nexin 29 [Source:NCBI gene;Acc:100498265][more]
SNX294.463e-733.75sorting nexin 29 [Source:NCBI gene;Acc:100498265][more]
SNX294.471e-733.75sorting nexin 29 [Source:NCBI gene;Acc:100498265][more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nisch1.003e-6334.35nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch1.031e-6134.66nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch1.925e-6034.35nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch1.781e-3832.79nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch2.521e-2137.00nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
back to top
BLAST of PX domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4G017|NISCH_RAT7.652e-6134.86Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch P... [more]
sp|Q9Y2I1|NISCH_HUMAN2.738e-6033.92Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV... [more]
sp|Q80TM9|NISCH_MOUSE1.346e-5934.35Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 S... [more]
sp|A2AL36|CNTRL_MOUSE5.923e-734.78Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 ... [more]
sp|Q9XHH2|DNAL1_CHLRE2.228e-630.40Dynein light chain 1, axonemal OS=Chlamydomonas re... [more]
back to top
BLAST of PX domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158R6K91.748e-8942.09Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068WND21.126e-8839.39Nischarin OS=Echinococcus granulosus OX=6210 GN=Eg... [more]
A0A0R3UET45.778e-8737.60PX domain-containing protein OS=Mesocestoides cort... [more]
A0A087VYU01.999e-8641.42Nischarin OS=Echinococcus multilocularis OX=6211 G... [more]
A0A0X3Q0E23.819e-8433.01Nischarin OS=Schistocephalus solidus OX=70667 GN=N... [more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nisch5.679e-5932.24nischarin [Source:NCBI gene;Acc:103045858][more]
kif16ba3.395e-734.78kinesin family member 16Ba [Source:ZFIN;Acc:ZDB-GE... [more]
flii1.965e-635.42FLII actin remodeling protein [Source:NCBI gene;Ac... [more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008894.14.978e-836.64pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
ENSPMAT00000002072.11.146e-636.84pep scaffold:Pmarinus_7.0:GL481283:15294:22438:1 g... [more]
LRRC491.400e-630.07leucine rich repeat containing 49 [Source:HGNC Sym... [more]
kif16bb9.866e-631.82kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PX domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453599.437e-5231.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270242.641e-2625.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327374.780e-834.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376221.487e-631.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498566.540e-632.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PX domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nisch1.604e-5832.26nischarin [Source:NCBI gene;Acc:101164628][more]
nisch1.767e-5832.26nischarin [Source:NCBI gene;Acc:101164628][more]
stk11ip6.035e-827.67serine/threonine kinase 11 interacting protein [So... [more]
stk11ip6.601e-831.93serine/threonine kinase 11 interacting protein [So... [more]
stk11ip7.623e-831.93serine/threonine kinase 11 interacting protein [So... [more]
back to top
BLAST of PX domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000021527.10.000e+098.71SMESG000021527.1[more]
SMESG000024931.11.282e-5432.03SMESG000024931.1[more]
SMESG000002561.14.096e-726.37SMESG000002561.1[more]
SMESG000002561.14.256e-726.37SMESG000002561.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030056 ID=SMED30030056|Name=PX domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1839bp
AGAAATTAATTAATTTTTGAGAAATTAATTAATTTTAAAAATTTCTTTTT
GTATTTTTATTTATAAATATTATCATATTGAAATTTAACGTTATAATTTT
ATTAATTTCGATAATTTTTTTTAACACAACATGGCCAAATGTATTCAACA
AGATGGGGAATTTTCTGTTTTAGAAGCAAAATTAACGAGATGTTGGAAAA
GTGATCATGCAATATATGAAATTGAAATAAAATCTAAAGAAAAGGATATA
TGCTGGAGTTTTTCTAAAAGATACAGTGAATTTCTTCAACTACATGAAAG
CCTTTGTAAAATTGATGATTCTCTCAAGCAAATTTATTTCCCACCAAAAA
AGTCATTCAACAATTTGTCGATAAAATTTCTTTGCAAGCGCCGCCAAGAA
CTCGAAGAATATTTGAATATTCTACTGAAGAAATTCCCGATTCCTCCAGC
GTCGCTGGGAAATTTTATTGACTGGAATCAATACGAAATCCACGGAATCA
CAAATAATTTGGCAAGGAAATTTTTCCAAAACGGTGATCTGATCATTAAG
GAGGGCTTCCAATTCGAGTTCTCGGTCCTGCAGATCTACTCCATCAATCA
GAGGTTGCAATCGCAATCGCCGACGAATTTATCCAATGATCCGAGCTTGG
ACTTCGTGCACGTCATGGAATTTGTGGGGCGAGTTCGTAACGTCAAGGTG
ACCGGGTCCTCTTCTGCTGTCGGCACAAGCAATATTGTCATGAATAAATT
GGAACTGGACATGTCACGGTTCCATTCGGTTGACAAGCTAGAGATGACAA
ACGTGAACCTCAAGTACATGCGAGGATTTGAGAACCTTAAGGAAACTGTG
AAACTAATGAAGGTGAGTTCTTCTCTATACAGCGTTAAACTTCTCTCTAT
TGGGGATCTACTTTCAATCGGCAATGGGGATTGGGTCTTTGGACGGGACT
CGGTGCCCACTAATTGTTGGTTGAAAGTCGAACATTTGGACCTTTCAAAT
AATTTCCTACAGGGATTGGATCCCAGCATGACCCTGTTCAAAAAAGTGAG
AACAGTCAAGCTCAACAATAATCTGCTTGTCGATGTGCAGCATTTGGATA
TCCTGGAAAATTTGCGCGTGCTCAATCTCAGTCAGAATAAACTGGGCCTC
GTGTACACATCATCCAACAGAATCCCCGAACCGACATTGCGCGGTCGCCT
GGGTAACATAACGGATCTGGACTTGTCCTACAATGAACTGTGCAGTGCCC
GACTGGTGGAGGGTCTCTATTCACTGATAAAGCTGAATCTTGGCGGCAAC
AAGATCGAGGAGATCGAGGAGCTGGAGAGCCTGGCAACTTTGCAGTGCCT
TGAATCCCTGATTCTACTAGGGAACCCTATTTGCATTAAGTCCGGATACA
GAAAATCCACATTGGAGCTTTTTGGAGAGCGGTTCAACGAGATCAAACTT
GATTTGCGCGCGGCAGACGAAATAGAGTTCAGGCAGCTGCAAGCTTCAAT
TTCCGAGTCGATAATACTGAAAAATAAATTTCAAAACGAAATCTGTCGCA
ACAATGCAAATAACGAAGGGGATGCATCTATCCTATCGACCATATTCAAT
AACAATAACCAGGCAAACAAGCAGCCGGCATATCCAACGGACGGATGTAC
CAATTGCGCATCTCGTACTCTCATTTCTAGTTATTTCGACAAGGAAGACG
CTTCTCCTGTGAACCTCGAGGTGTCACTGGAATCGGATGTTAATGAAATT
ATAATATTTTGAGATTGATTAATTGATTGGCATCTACATATCCATTTTCT
CCTGATATTGATCTGCTATTATTTAAATTGATTTTCCAG
back to top

protein sequence of SMED30030056-orf-1

>SMED30030056-orf-1 ID=SMED30030056-orf-1|Name=SMED30030056-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=544bp
MAKCIQQDGEFSVLEAKLTRCWKSDHAIYEIEIKSKEKDICWSFSKRYSE
FLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLK
KFPIPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVL
QIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVTGSSSAVGTS
NIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETVKLMKVSSSLY
SVKLLSIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSM
TLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLVYTSSNRIPE
PTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELES
LATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEF
RQLQASISESIILKNKFQNEICRNNANNEGDASILSTIFNNNNQANKQPA
YPTDGCTNCASRTLISSYFDKEDASPVNLEVSLESDVNEIIIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR001683Phox
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00019LEURICHRPTcoord: 283..296
score: 49.72
coord: 325..338
score: 54.71
NoneNo IPR availablePANTHERPTHR15454:SF35NISCHARINcoord: 29..449
NoneNo IPR availablePANTHERPTHR15454NISCHARIN RELATEDcoord: 29..449
NoneNo IPR availableSUPERFAMILYSSF52075Outer arm dynein light chain 1coord: 280..427
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 9..116
e-value: 3.2E-6
score: 36.7
IPR001683Phox homologous domainPFAMPF00787PXcoord: 22..100
e-value: 5.5E-15
score: 55.3
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 7..139
score: 12.845
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 341..452
e-value: 4.4E-16
score: 60.6
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 188..340
e-value: 3.9E-9
score: 37.6
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 16..122
e-value: 1.1E-20
score: 75.4
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 18..101
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 327..348
score: 6.38
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 282..303
score: 6.672
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 305..326
score: 5.178
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 359..380
score: 6.002
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 381..402
score: 9.106