Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30030055
Length (bp)3538
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30030055) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30030055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30030055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30030055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30030055SMESG000033582.1 dd_Smed_v4_5930_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 238.81 bits (608), Expect = 3.958e-64
Identity = 204/719 (28.37%), Postives = 347/719 (48.26%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +DAD  + N+ V   +L+          ND F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NKAVTLSILN---------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDVDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 238.81 bits (608), Expect = 1.002e-63
Identity = 204/719 (28.37%), Postives = 347/719 (48.26%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +DAD  + N+ V   +L+          ND F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NKAVTLSILN---------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDVDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 238.424 bits (607), Expect = 1.237e-63
Identity = 204/719 (28.37%), Postives = 347/719 (48.26%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +DAD  + N+ V   +L+          ND F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NKAVTLSILN---------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDVDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 238.424 bits (607), Expect = 1.399e-63
Identity = 204/719 (28.37%), Postives = 347/719 (48.26%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +DAD  + N+ V   +L+          ND F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NKAVTLSILN---------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDVDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 231.106 bits (588), Expect = 4.354e-61
Identity = 203/701 (28.96%), Postives = 325/701 (46.36%), Query Frame = 3
Query:  471 GKLIVTGP-LDREKICS--PQTDQNLIQKCCESSCCMF---IGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            G++  TG  +DREK+C+  P+ +            C +   + I  P+   ++  IR  IED NDN P+FP + I I++ EN  I     LP A D D    G+ NY+LI  ++      ++    D    L+ + ++DRE    + + V   D G P ++ +  + + V D NDN P F+E+ I +S+ EN   G  + ++  TD+DIG N+++ ++  +  S   R  +LF +     L  ++  LD E     +  ++A D G   + + A V V VT++ND  P I   +   IV+P +  + L EN P +  I LI VTDKD+  +  + C   H +  F LR            +F  Q L+E     D E+T  Y I +  +D+     L QS  + +K+ D NDN P+F+ SF    I E +     + +T+  +   DAD G N++I Y     L       FS++     +   + +D EK  ++ F ++A D G P LT++  + +S+ D NDN P   +  Y F V E  P    +G I  +D D    N  V   +L          +ND F I++ TG I+  +  D EK +  +F V+  +              SSS  +T+ ++D+NDN P   +  S    +    L S  P  +    IA           +D D G+NAEV
Sbjct:   82 GEIFTTGARIDREKLCAGIPRDEH-----------CFYEVEVAIL-PDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIAR--RLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSI---DIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDH-EIPFRLR-----------PVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN--SPGIQLTK--VSAMDADSGPNAKINY----LLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD-NSAVTLSILD---------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS--------RSSSAKVTINVVDVNDNKPVFIVPPSNCSYEL--VLPSTNPGTVVFQVIA-----------VDNDTGMNAEV 711          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 179.104 bits (453), Expect = 5.839e-45
Identity = 177/726 (24.38%), Postives = 321/726 (44.21%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLV--LVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRV--TNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTD--KDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIF-SSSFHFGKIMETDLTDQDVHMTEG---VIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKP-IIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSE 2756
            I V ++DENDN P F    +K+ + E  ++G +  LP   D D P + +  + +I   +  + F++ +   + +L   LV   ++DRE    + LL+ A D GKP+K G L   +E+ D NDN P F  S  + SV  N   G  +  ++ TD+DIG NS++SY+I+  ++ +   F + Q   G+     S L     ++    ++A D G+P L S+A VT+ V  + L+  P +I++     +V+ NS  L   EN      +  + +    +D+KL  I      P+              ++  ++ L      DRET S + +         I  + +  ++ + I D+NDN P + SS  H             ++ T+G    +   D D+G N  I+Y +       D++  S++ E  +I     ID     + KF + A DGG PAL+   Q+   + D     P+     +   + E+ PIGT + ++VA+++      R + + +         Q Q++   ++  +G +  +   D EK +     V   N N            +S+  I++++ D+NDN P     E  +  + G     ++P ++++ SD+ S    E  Y                L E+ +FS++     +  +   L+ G F + V  +D     G + +E   NIH+  + ++K    P+   S+
Sbjct:  108 ILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRF-VILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQ--SGVITTTASLLPASTHDVI---VVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIW-----LVESNSAHLM--ENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQT------------DQAHVYLLLLCGILDRETASEHHLKFLLEKDGQI--IIEHPQL-LTIGDINDNAPQWHSSQIHIS-----------LNRTQGGSRTLTAKDPDLGQNGWIRYSV------LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKR-IRYSL---------QNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANS----------ETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGP--KPEEPLLVVSASDMDSGTFGEVSYHI--------------LSESSSFSINPVTGEVFAQK-PLARGRFHLVVSAKD----GGGQSSENSANIHI--TVIDKDTKTPQFSRSK 745          

HSP 2 Score: 107.842 bits (268), Expect = 3.286e-23
Identity = 147/651 (22.58%), Postives = 266/651 (40.86%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKS-CGSCFEVKN--EPKDNRLVL-------VFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVV 2534
            +  ++ D     P F ++  ++ + E+  IG  +V                 K++++ S CG+   ++   + +D  L +         +   D E    +   V+A +    + T  +SI L+  D+NDN P F  +   L+V E  +    +  +  +D D G   ++SY+I   +S     F +  +   +  Q         +  F   + AKD G     ++A + + V + + + P+   ++R S  +  + +  LP         I I      SK+            ++   +  N +I E      +   ++ D   T +  I  T       S  +   ++ + I+D NDNPP FSSS     I E    D  +H    V+Q +D D   N  ++Y +   ++S       ++    Q+     +DYE ++ +K  + A D G P  +++  + I V D NDN PE    +YT  VLE  P  T +G++VA D D+ + N  +++         R    ++ F I+   G + T+  +D E   HV   +        V     +   SS+ +  + ++D+NDN P   L  + IV  AGS LS+    I+                 +D D+GLN  V+
Sbjct:  526 VVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLV-----------------KVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS----FSINPVTGEVFAQKPLA-----RGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQ---FSR-SKYEIRTTEDILPG--------IAIGSVGAMSKVK---------YSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLP-----SGESNQTQVVIFIEDHNDNPPQFSSSLVEISIRE----DLKLHEPFYVVQASDKDKKKNGEVRYSI---ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLE-NGQIVY---------RITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISI--------VAEDKGVPPRSSTASARISVLDVNDNPPS-CLSITPIVVPAGSPLSTAIGTIVA----------------MDPDKGLNGSVL 1080          

HSP 3 Score: 93.9745 bits (232), Expect = 5.361e-19
Identity = 106/420 (25.24%), Postives = 182/420 (43.33%), Query Frame = 3
Query:  414 KDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVF--------YLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQ 1640
            K +IY  D+ ++       GK+ VT  LD +                  +  + I  T P+ + N  +V I  ED NDN P F  S ++I++ E++++     + +A D D    G   Y +IS    GS  E+          L   + +D E    + L V A D G P ++ ++++ + V D+NDN P FE+S  ++ V EN      + ++   D D   N Q+ Y I    +    YF + + K G ++  + ++D E  +  +  I+A+D+G P   STA+  + V ++ND PP  L       + P    + +P   P    I  I   D D  L   +L        +F        YLR   N +    +++    ++I  D+    + R ++ C     ISK +  ++IQ
Sbjct:  770 KYSIYSGDQDHNFSIDEDTGKIYVTRYLDAD---------------VHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHP-GSSIEIDQFTGQ----LSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI----TNGSEYFGIDE-KLG-NVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLS------ITP----IVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRL----SVIVSDQ---GVPRKSVVCHVPVRISKGSADIQIQ 1146          

HSP 4 Score: 68.1662 bits (165), Expect = 4.575e-11
Identity = 96/423 (22.70%), Postives = 174/423 (41.13%), Query Frame = 3
Query:  858 IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTIS-LSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPK-----DVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY--TFSVLEEQPIGTKIGQIVASDADT 2102
            +DRE +    L+++  D G  S+  S ++ + V D NDN+P  + ST S L + E+ R G  + R + +D DIG N + S+ + + +S +       +  D +  +L S   ++ K     R++  D G P L     + +   N   E    L + + + +       T+ E  P+ Q I         +KL   L  +++       D  +  ++E V          ++  +E DRE    Y + +  + S           + ++++++NDN P F  S       +     +++ +   V  V   D+   + ++Y L    +     +F+++     I    P+D+E   +    + A DG   +    T +TI VSD NDN P      Y  T S     P G    +I A D D 
Sbjct: 1687 LDREASQEHLLIIILTDGG--SRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVP--ETGDLVLRRLSSLQSWKIK----LRVV--DHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLS------TIDEGLPRGQFI---------AKLQPELAGLTYSIVEGNIDSAFSVDSEGV----------IRTNLELDREILERYSLKVIGTGSGQ----QIGTRVDVRVNNLNDNVPSFPMS-------KPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSP-GQPFAKIEAHDLDA 2059          

HSP 5 Score: 55.8398 bits (133), Expect = 2.657e-7
Identity = 86/410 (20.98%), Postives = 175/410 (42.68%), Query Frame = 3
Query:  435 DRKNSQPFSL-SHGKLIVTGPLDREKICSPQ-----TDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKT--GSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTI-SKLTQSVEI 1637
            D + S+ FS+   G+L V GP+DRE+  + +      ++ +  +  +  C                 V + DENDN P+F      +++ +++  G  I    A D D+   G  +Y+++S     +   +  +    +L      ++D   N+ + +LV A D G P++   G + + L++   + + P F      + V E+   G  +++I+ ++     N  + Y+++++  +         +K G  L L++ LD+E++ I    +   D        +A V +++     EP +        +   +S  L +P + P  +++  +   D+D  +  ++      K     R++  V I E   I  LQ  +   R   +I +IT+    S T  SK T  +EI
Sbjct: 2167 DPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKC----------------HVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDL-NIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLG-----IDVKTG-ELTLKTHLDWESEPIISMYLSVSDGNG----RSAVVPLKIVV---EPVDEF----APVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVV------KYSISDRQS-TVKIEEHTGIIRLQKPL-VSRRNLTIEQITVVAYSSPTKQSKTTVYLEI 2534          

HSP 6 Score: 53.9138 bits (128), Expect = 8.721e-7
Identity = 54/226 (23.89%), Postives = 91/226 (40.27%), Query Frame = 3
Query:  648 PIFPQSYIKIAVHENVEIGHTI--VLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQ----LQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP 1307
            P F Q   K  V E+ +IG  I  +  K E+   P Y    + +  D+      +V     +   +      +D E  S F+++ + ++    +    + I++EV+D NDN P F +  + L + E  + G       VTD D        + I          FKL   K    LQ    +   LD E ++ +E  I A+D G P  +     ++ + + ND  P
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESAAPKY----FVVFPDEQTSKFLKVDERSGEISTI----AHLDYEKRSKFDIVAVKVEESGET----IDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVI--LQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAP 231          

HSP 7 Score: 53.5286 bits (127), Expect = 1.068e-6
Identity = 59/242 (24.38%), Postives = 106/242 (43.80%), Query Frame = 3
Query: 1527 ELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD-QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNS-------EYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVL 2228
            E+  +   D E  S + I         + +  ++++I +++DD NDN P F+      ++++ ++++   +  +  +  VTD D     +   H    L    +  F + S       +   + N + +D E   +++  + A DGGKPA     + +I + DANDN P      YT SV     IG+ +  + A+DAD  + +R      +S D  K     N  F I + +G I T   L
Sbjct:   77 EISTIAHLDYEKRSKFDIVAV-----KVEESGETIDILVEVDDENDNAPSFAD-----QVVKLEISEFAQLGTSFALPTVTDGD---GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQ-LDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSR------ISYDIKKTSAPSNSNFAI-SQSGVITTTASL 297          

HSP 8 Score: 53.1434 bits (126), Expect = 1.586e-6
Identity = 119/556 (21.40%), Postives = 216/556 (38.85%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH-ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSL--SIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVR----VTNLNDEPP---EILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLT-QSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGM-NSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDAD 2099
            G + +T PLD E +     +  L  K  + S   F  +T          + + D NDN P F +   +  V       G      +A DLD  + G   Y L   +   S F V   P+   L +    K+       + + V A D G PS + S+  S+I+   +  D +P FE++     V EN + G +I  +   +S      +  Y I+D  +      K+F I     L +   +D E +   EF++   ++    +M++  V  +    V + ND  P    + +Y            L+L ++    Q I  I  +D+DS  +  +   +    D+  +    +   I+  +  + Q L EF   T   ++I +   D    ++     V++ +K+   + + P F    +   ++E    D  V      I+ ++  +GM N  + Y LK+           ++ +  ++  K  +D+E       +L   DG     +A   + I V   ++  P      YT  +    P G  +GQ+ A D D
Sbjct: 1982 GTIHLTAPLDFEVL----PEHTLTIKATDGSFDTFTNLT----------IFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSL--GQGSSSIFRVA--PESGALFM----KVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTD-KPGFEKAEFRFEVMENSKIGLQIGNLSGEES-----REFHYRIQDPEAS-----KIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNE----MMTSQKVQCKCHVIVLDENDNLPVFTSVAYY------------LSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQ-LDEFPNAT---WQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLE----DTSVGTVLQKIRASNR-LGMRNDGLLYSLKEHQGK-----LGIDVKTGELTLKTHLDWESEPIISMYLSVSDGN--GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDED 2470          

HSP 9 Score: 51.2174 bits (121), Expect = 5.808e-6
Identity = 125/556 (22.48%), Postives = 220/556 (39.57%), Query Frame = 3
Query:  609 YIRVNIEDENDN---EPIFPQSYIKIAVHENVEIGHTIVLPKAEDLD--TPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDV--NDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSR-IKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENN--TGFIKTRVVLDHEKDQ 2246
            Y+  N+E  N N   E   P  ++K      ++ G    LP+ + +    P      Y ++ + +  S F V     D+  V+    ++DRE    ++L V+    G+   T    + + V ++NDN P F  S     V EN R G  +  +   D D  A  +  + + D + Q   +F + Q     ++ L + LD+E        I A D       +   +T+ V+++ND  P        +   P       P      Q    I   D D++ +           +F +         E   +F     ++        Y +T+T +D N +   + SV + + I +    D P    + F F ++ME    +  + +  G +       G  SR   Y ++D      S+ FS++ ++ ++    PID E+    +F +   +    +     +  + V D NDN P   +  Y  S+ +    G KIGQI+ASD D+ +  R V + +LS          NDL I+  N  TG I+     D + D+
Sbjct: 1810 YVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEG----LPRGQFIAKLQPELAGLTYSIV-EGNIDSAFSV-----DSEGVIRTNLELDREILERYSLKVIGTGSGQQIGT---RVDVRVNNLNDNVPSFPMSK-PRRVPENLRVGSYVATVGAKDVDNLAPLRY-FLVSDSSGQTPTHFNIDQFTG--TIHLTAPLDFEVLPEHTLTIKATDGS---FDTFTNLTIFVSDINDNAP--------TFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAP-------ESGALF-----MKVLPPAGERYLVTVTATD-NGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRF-EVME----NSKIGLQIGNLS------GEESREFHYRIQDP---EASKIFSID-KFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGR-VSYRILS---------GNDLNIVTLNPDTGSIQLNEWNDAQLDE 2299          

HSP 10 Score: 50.8322 bits (120), Expect = 8.206e-6
Identity = 112/535 (20.93%), Postives = 214/535 (40.00%), Query Frame = 3
Query:  564 CCMFIGITSPNRKINYIRVNIE--DENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGID-NYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQ-AQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNI--IEKKKIFELQNLIEFDRET---TSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEI-GNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEML 2138
             C F    + +     +RV++E      ++P F   ++++ + E+   G  I    A   D  +  I   + L+ D      F +     D  L+      +       +NL+V A   G P  T  L + + V+D+ND+ P F  S  ++ +  + R G  + R+   D D   + ++ Y+++   S+ A+ +FK+ + K G    ++S+                  G P      T+T+R T+L D            +   +  ++ L  +     T    H  D+  K   IL        +  L+  E V++  I     FEL++     +     T   R TI     + +   T    +++ ++ V   PP  SS+      +E ++  +D        ++    +   SR ++         ++  FS+NS    I +  P+D E S++    ++  DGG  +   S  + ++V+D NDN+P++  +      + E   +G  + +  ASD D  Q N    FE+L
Sbjct: 1299 SCFFEKFNTTDGSAEEMRVDLEISRTKSDKPRFDTGHLRVNIREDTPTGSIITTVNATVSDDSASPISYRFPLLIDN-----FSIDQFTGDITLIDTLHWHV----TPTYNLIVEAFTSG-PGTT--LLVTVNVDDVNDHTP-FIVSQPTVLLPSSYRKGGMVHRVVAIDLD--KDPEIRYSLKYAGSEVAKEFFKIDE-KSGEIFVVESSSALSTS--------FGGAGLP-----ETLTIRATDLQD------------LTKFDEQKVLLKASNASRSTW---HFFDEQHKDVTILSTSPQGSQILQLKFQEGVDLQLIPSSPHFELKSSKIVQKSASVATGTQRFTIVAQKDDELDYST----LKIHVEPVFTEPPKISSTSCGVVTIEENVGIEDFK------RILATGMTEESRFRFQ-------GNAPKFSINSTTGSI-SVLPLDREASQEHLLIIILTDGG--SRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQ-NGKFSFELL 1768          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 176.022 bits (445), Expect = 4.332e-44
Identity = 167/605 (27.60%), Postives = 282/605 (46.61%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKD-GISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIE-----NNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIV 2402
            + +N+ D ND+ P    +   I + ENV IG  +    A D D+   GI  Y +   +     F +    +D+ L+   K  +DRET + ++L V A D G PS   S +I + ++DINDN P F++   ++++ E    G +I  +K  D+D   + +++Y IE+   +    F +  I D G  L +   L  ++  +    I A DQG   L     V V + ++N  P    ++N      P S+++  PE+ P    +I +   D D           + + V+ +  ++   I        + +  + DRE  + + + +T SD  +   L  S +I++ +DD+NDN P F+SS +   I E      D+ +    +QV+  DADIG N  + Y L ++ +S   Q F ++     ++    +D E+       + A D G P+L+A+++IT+++SD NDN P      Y   + E  P+G+ +G IVA DAD    N D+ F +      K       LF IE     N    I TR   D+E   +  F        E   +  +L   SS+V + + + D+NDN P  ALK+ +I+
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIID---EDSGLIKTTKL-LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREV---FSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGG--LQGRCVVNVFIDDVNSAP----YFND----HPFSVKI--PEHSPIGYPVITLKAEDHDRG--------DNARIVYSIDSSQFFRIDPSSGDISVSS--DLDREDRATFSVIVTASDHAS-PPLNTSTQIEVILDDINDNSPQFTSSSYAATISE------DIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD-NADISFRIFGGADAK-------LFDIEEDAEQNGVVRILTRAEFDYEAKANKFFF-------ELQASSGQL---SSTVPVRIHVSDVNDNKP--ALKDFVIL 1006          

HSP 2 Score: 150.214 bits (378), Expect = 3.682e-36
Identity = 171/702 (24.36%), Postives = 292/702 (41.60%), Query Frame = 3
Query:  441 KNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRK-INYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI-KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVT--DKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL-ALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            KN    +   G +    PLDRE +   + D     K             +P R+    + + + D NDN P+F      + + EN+ I   I   KA D D  + G  +Y + S    G    +     +    +  + +ID + NS    ++ A D  +P+ + ++ + + V DIND+ P    +   +++EEN   G E+ R+   D D G N  + Y++E            F I +D   ++    LD E    +  ++ A+D GTP L ++ T+ V + ++ND  P           D     +T+ E  P+   II +     D+D K++  + E    ++VF +     ++I ++  I  +    E  R+   + R+ I+ +D      L     + + IDDVN  P      F   KI E       V      ++  D D G N+RI Y +        SQ+F ++     I     +D E    F   + A D   P L  STQI + + D NDN P+  +  Y  ++ E+ P+GT   Q+ A DAD   +  + I +    + +     Q  LF ++  +G ++    LD E+   +   +  R+     GT       S++  IT+ + D+NDN+P    L   L + +         P+  T   I +           DADEG NA++
Sbjct:  315 KNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDK------------GTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG-LTIDYSTGE----VTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED--------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF---------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEAD--REVFSI-----LDIGDQGAILSVSG--ELKRQDHKV-RVEISATDQG---GLQGRCVVNVFIDDVNSAPYFNDHPFSV-KIPEHSPIGYPVI----TLKAEDHDRGDNARIVYSID------SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDAD---IGPNGIVDYFLNESSSSPSIQ--LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR----GTPS----LSAASEITLTLSDVNDNAPTFEQLSYDLYIAE-------NSPVGSTVGTIVAR----------DADEGDNADI 927          

HSP 3 Score: 121.709 bits (304), Expect = 1.944e-27
Identity = 149/595 (25.04%), Postives = 250/595 (42.02%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTK--IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEG--VIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVN--SEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            + V++ D  DN PIF +      + E+  IG T++   A DLD+   G   Y L            KN    N    V +T   +DRET S+  L V+A D+G P +  +  + + V D+NDN P F   + ++++ EN      I  +K TD D G N ++ Y++   +            +    + L+  +D +N  I    I AKD   P L ST  +T+ V ++ND  P ++   +          +TL EN    + +  ++  D+DS  + I+         + +  +E+  I E   + +   L+  DRETT+ Y + +T  D  T S L  S  I + + D+NDN P F    +   I E         M  G  +I +   D   + +I Y +++A    D + FS+    +   I +       +  + +  + A D G   L     + + + D N + P   +  ++  + E  PIG  +  + A D D     R V     S+D ++        F I+ ++G I     LD E     S +V          +       ++S  I V + DINDNSP+ 
Sbjct:  256 VVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNG-------KNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE----VTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK---------MITLEENVAIGEEVGRVYAIDEDSGPNGII--------KYSMEGSEDFIIDEDSGLIKTTKLL--DRETTARYSLKVTARDMGTPS-LNTSTTIAVVLKDINDNAPTFDKKEYNVTISE--------EMPRGSQIITLKAVDNDEDQKITYRIEEA----DREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV----YSIDSSQ-------FFRIDPSSGDISVSSDLDREDRATFSVIV--------TASDHASPPLNTSTQIEVILDDINDNSPQF 784          

HSP 4 Score: 117.857 bits (294), Expect = 3.122e-26
Identity = 106/421 (25.18%), Postives = 186/421 (44.18%), Query Frame = 3
Query:  858 IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD----SKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQ 2108
            +DRE      L V A +R  P+ + S ++++ V D+ DN P FE+ +    + E+   G  +  +   D D G N ++ Y++ +      +       K G+ +Q  + LD E  ++    +IA D+GTP   STA V + V ++ND  P         +   +S  +T+ EN      I  +  TD+D     K+   +   S    +     T  V + E+    + +N        T++ R     +       L+ +V + + + D+ND+ P   ++     + E     ++V    G +   D D G N  IKY ++       S+ F ++ +   IK  + +D E + ++   + A D G P+L  ST I + + D NDN P    K Y  ++ EE P G++I  + A D D DQ
Sbjct:  228 MDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNG---KNLLAINAKSGV-IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAP---------VFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRER---IDAKN-----SPITAVIR-----AKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEV----GRVYAIDEDSGPNGIIKYSME------GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ 612          

HSP 5 Score: 90.8929 bits (224), Expect = 5.270e-18
Identity = 71/261 (27.20%), Postives = 121/261 (46.36%), Query Frame = 3
Query: 1617 LTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLI 2399
            ++ S  + + + DV DN PIF    +FG+I E    D  +  T   +   D D G N  I+Y L +          ++N++   I+   P+D E     +  ++A D G P   ++  + I+V D NDN P   +  Y  ++LE   I   I  + A+D D    N  V + M S  G            I+ +TG +  R  +D  K+  ++ ++R ++     G +  L   SS+V +T+ +IDIND++P L   + +I
Sbjct:  250 ISASTTVVVHVLDVQDNSPIFEKDSYFGEIRE----DAPIGTTVLSVFARDLDSGENGEIEYSLGEG---NGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGT-NGKVHYSMASSSGIGG-------LTIDYSTGEVTLRERID-AKNSPITAVIRAKD-----GAQPAL---SSTVPLTINVIDINDHAPTLIAAQKMI 486          

HSP 6 Score: 60.077 bits (144), Expect = 1.393e-8
Identity = 49/212 (23.11%), Postives = 93/212 (43.87%), Query Frame = 3
Query: 1746 EGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLA 2381
            E +I    A    +  + Y +    +S     F++++   +I+  + +D E   +    + A +   P ++AST + + V D  DN P      Y   + E+ PIGT +  + A D D+ + N ++ + +   +G        +L  I   +G I+T   LD E       L+R+       GT  +     S+  + + ++D+NDN+P  A
Sbjct:  181 ETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGE-NGEIEYSLGEGNG-------KNLLAINAKSGVIQTAAPLDRETLS----LIRLDVIASDKGTPKR----ESTAMVEITVVDVNDNAPVFA 376          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 175.637 bits (444), Expect = 6.352e-44
Identity = 167/605 (27.60%), Postives = 282/605 (46.61%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKD-GISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIE-----NNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIV 2402
            + +N+ D ND+ P    +   I + ENV IG  +    A D D+   GI  Y +   +     F +    +D+ L+   K  +DRET + ++L V A D G PS   S +I + ++DINDN P F++   ++++ E    G +I  +K  D+D   + +++Y IE+   +    F +  I D G  L +   L  ++  +    I A DQG   L     V V + ++N  P    ++N      P S+++  PE+ P    +I +   D D           + + V+ +  ++   I        + +  + DRE  + + + +T SD  +   L  S +I++ +DD+NDN P F+SS +   I E      D+ +    +QV+  DADIG N  + Y L ++ +S   Q F ++     ++    +D E+       + A D G P+L+A+++IT+++SD NDN P      Y   + E  P+G+ +G IVA DAD    N D+ F +      K       LF IE     N    I TR   D+E   +  F        E   +  +L   SS+V + + + D+NDN P  ALK+ +I+
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIID---EDSGLIKTTKL-LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREV---FSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGG--LQGRCVVNVFIDDVNSAP----YFND----HPFSVKI--PEHSPIGYPVITLKAEDHDRG--------DNARIVYSIDSSQFFRIDPSSGDISVSS--DLDREDRATFSVIVTASDHAS-PPLNTSTQIEVILDDINDNSPQFTSSSYAATISE------DIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD-NADISFRIFGGADAK-------LFDIEEDAEQNGVVRILTRAEFDYEAKANKFFF-------ELQASSGQL---SSTVPVRIHVSDVNDNKP--ALKDFVIL 647          

HSP 2 Score: 148.288 bits (373), Expect = 1.566e-35
Identity = 159/644 (24.69%), Postives = 274/644 (42.55%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI-KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVT--DKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL-ALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            + + + D NDN P+F      + + EN+ I   I   KA D D  + G  +Y + S    G    +     +    +  + +ID + NS    ++ A D  +P+ + ++ + + V DIND+ P    +   +++EEN   G E+ R+   D D G N  + Y++E            F I +D   ++    LD E    +  ++ A+D GTP L ++ T+ V + ++ND  P           D     +T+ E  P+   II +     D+D K++  + E    ++VF +     ++I ++  I  +    E  R+   + R+ I+ +D      L     + + IDDVN  P      F   KI E       V      ++  D D G N+RI Y +        SQ+F ++     I     +D E    F   + A D   P L  STQI + + D NDN P+  +  Y  ++ E+ P+GT   Q+ A DAD   +  + I +    + +     Q  LF ++  +G ++    LD E+   +   +  R+     GT       S++  IT+ + D+NDN+P    L   L + +         P+  T   I +           DADEG NA++
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG-LTIDYSTGE----VTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED--------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF---------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEAD--REVFSI-----LDIGDQGAILSVSG--ELKRQDHKV-RVEISATDQG---GLQGRCVVNVFIDDVNSAPYFNDHPFSV-KIPEHSPIGYPVI----TLKAEDHDRGDNARIVYSID------SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDAD---IGPNGIVDYFLNESSSSPSIQ--LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR----GTPS----LSAASEITLTLSDVNDNAPTFEQLSYDLYIAE-------NSPVGSTVGTIVAR----------DADEGDNADI 568          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 119.013 bits (297), Expect = 1.563e-26
Identity = 164/692 (23.70%), Postives = 293/692 (42.34%), Query Frame = 3
Query:  627 EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFK--TKIDRETNSVFN--LLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPE-ILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD----SKLSDIL------CEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKY-HLKDALNSTDSQ-YFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGK-----PALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQI--VASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVV--LDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKE-NPNFSLDMGHNLICLKNLHLSPGY 2621
            E EN + P+F      + V E+  IG  +   +A D DT   G   Y +I D + GS  EV    + +  + V    +K+ +E   V +  L V AID G P K+   ++ L ++D+N++ P F+E +  L + EN + G++I ++   D D G N ++ +++ +  +Q +        K GI ++L  +LD E++++  F IIA D+G P  +S   +T+ V ++ND PP+ ++ ++R  I          PE+ P    +  +   D+D    SKL  +L        + H     ++   E                   D   T  + ++I  +D      L+ S  + +++ D+  N      +  F  + +     ++  +   VI +   + G   ++K  +L+  +   D   +FS++ +   ++    +D E    +   + A D        P       + I + D ND+RP      Y  SV E  P    I ++    +D   +     ++F++        R      F I+  +G+I T  +  LD EK       V + +     G + +L    S+V + V ++D NDNSP           QA    S +       S  A  LC  F    +DADEG NA +   + E +  FS+D   N+I  + +H    Y
Sbjct:  599 ESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRY-VIHDIA-GSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGN--NQEKSSVISIDAKTGI-VKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARI----------PEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPE----------------YPLDYHKTPFFNLSIEVADHGD-PILSTSCHLHVELVDIAHN----HLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKI-------ERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICD-----GGEPQL---CSNVIVIVNVLDENDNSPTFT--------QAIHHYSVR-------SKFAGKLCRIFA---VDADEGENARLTYNITEGDARFSIDNNGNIIASEAIHGDESY 1220          

HSP 2 Score: 93.2041 bits (230), Expect = 1.117e-18
Identity = 174/796 (21.86%), Postives = 309/796 (38.82%), Query Frame = 3
Query:  366 DVGHLLLTSSLISQAEKDNIYFTDRKNSQ------PFSL--SHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFI-IENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP 2726
            DVG+++     + + E D I FT    S+      PFS+  S GK+IV   LDRE+       +N  +    +     +        I  + V+I D NDN P F   Y +  + E+  +G ++ +  A D D    G   + L+ +      F++     +N   L   +++DRE    + L+  A D G  +     +I+  V D+ND+ P FE+   ++ +     S   I    + D D+  N+   + I     +      +F I     L L+     ENK  ++ ++ A D       ++  V + + +  D        N+  I+  NS + T+        +++  +VT K S     +  V+    +  ++E++ ++       +E    +EF R         +T  D++ + K      I + I+++NDN P          I E   T +D       I   DAD      IK+ + D         F ++     +   +P+D E    F   +VA DG          I ++V D NDN P      Y+  V+E + IG ++    AS  D    N  + + +   D T         F+ +   TG +     LD E    +   V  +++         +    +   + + ++D NDN+PK   KE  + +   +  S +K + +   D+ S       Y      E      V+    N N     G  LI     +     + + VI +D  GG    R+E L+ IH++    + P
Sbjct: 2622 DVGNVIGRVQQM-ETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRER-------KNQWKMTIRADAAGGV------HAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEEN---PYFDL----NENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIV--VSDVNDSPPQFEKEEFNIDLHLPSTS--PILHFSIKDDDLSPNNVSQFFIPKGNEEG-----VFWIDSNNDLLLKRPEIVENKMQYQLKVTAFDG---VFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLG---ESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQID-------YEKNQQLEFHR---------LTIQDNSEVCKEL----ITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADF---DEIKFRMVDDFGG----LFQIDDINGVVTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ---NETIEYYLKPSDVTS--------FVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSG--------VPPLETEAQVEISVMDENDNAPKFE-KEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSN-----GDVLISQSIDYEKIKKYNLKVIAKD--GGRPPLRSEALLEIHVEDENDHAP 3324          

HSP 3 Score: 85.1149 bits (209), Expect = 2.969e-16
Identity = 166/744 (22.31%), Postives = 294/744 (39.52%), Query Frame = 3
Query:  327 VTENIPYPSSS--LIDVGHLLLTSSLISQAEKDNIYFTDRKNSQPFSL--SHGKLIVTGPLDREKICSPQTDQNLIQKCCE---SSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTP-SYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTK----IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFK-----LFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEIL--FYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDS-NTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQY-FSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPII---ITTSDIASNLCSEF 2486
            V E + Y +S+     +G  LLT    +  E D I ++    S+   +    G + +TG LD EK  + + D  L+        SS   FI             V IED ND  P F +S +   + ++   G  I +  A D+DT  S   ++ KL+     G        P    L L    +    ++ +T  V N   +++  G  +    L + +         P FE+S    +  EN       K   +T +  G    + +++   TS      K         K G  + +   L+Y     ++  ++ +D       S  T+T+ V ++ND+PP  +  FY+            ++ E+  +  T++++  TD D   +     +   +  F+        I   KK+         + +      +TI  +DS N     T +VE+ +  + V    P FS+S +   +ME    D DV    G +Q  + +I     I++ +      +DS   FSV     +I  K  +D E+  Q+K  + A   G   + A T +T+ + D NDN P     +  F++ E+  +GT +    A D D     R + F ++          +N  F +  N+G++     LD EK  H   + R  +             +++ +  T+ + D+ND+ P+   KE   ++     L S  PI+   I   D++ N  S+F
Sbjct: 2185 VFEKLKYTASTPESTSIGQRLLTIKATTSDENDTIEYS-LSGSKDIEIHPETGDVTITGQLDYEK--TQKYDLKLVATSSGKQVSSEAEFI-------------VLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLN---VSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVN---KSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTG-RIHVSRVLNYHRDKRYQIPLVVEDATGRRAFS--TLTLSVIDINDKPPFFVLPFYS-----------TSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHPRQGTITVAKKL---------EHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESV--KVPRFSNSHYLFSVME----DADVGNVIGRVQQMETEI---DEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGR-IRFSLV---------EENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGG----------FNTDLPFTIVVSDVNDSPPQFE-KEEFNIDLH---LPSTSPILHFSIKDDDLSPNNVSQF 2848          

HSP 4 Score: 82.4185 bits (202), Expect = 2.153e-15
Identity = 146/629 (23.21%), Postives = 244/629 (38.79%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKP-SKTGSLSI---------------ILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQ-STLDYENKNIF--EFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYL----RETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSN-----TISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDA-----LNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRP--EIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNR--DVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSS-----VAITVKIIDINDNSP 2372
            + + I D ND+ P+F   +++       + G  +V   A D D    G   YK  S+       E+     +  LV     ++ ++ NS +   V AID G P S+  +L++               I+  E  N + P F      + V E+   G  + +++  D D G N  + Y I D    +     + +    I++    S L  E   +   + ++ A D GTP   S  T+ +R+ ++N+  P+          D  S  L + EN    + I  +   D D          ++ K  F L     ++  ++I  K  I +L  L   DRE   ++   I  SD       +++ LT SVE      DVNDNPP         +I E    D         +   D DIG NS++K+ L        ++      F    EY       P+DY K+  F   +   D G P L+ S  + + + D   N    E  +     SV E   IGT++  I A +   +Q  +  ++ + ++  DG          F I+   G ++T  +LD E        V  R++        K D Y        + + ++I+D ND+ P
Sbjct:  478 VSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELP----LEINANTGEITLV-----EVPKKGNS-WPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQF---------DEVSYYLRISENEKPGKDIFKVTANDFDGG--------NNGKIKFSLGNNQEKSSVISIDAKTGIVKL--LKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVE------DVNDNPPKCVVQHSRARIPE----DLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEY-------PLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPH-------FSIDQK-GTVRTTHLLDRETKSAYWITVEARDS--------KTDLYKDPRRRDVLHVFIRILDRNDHRP 1044          

HSP 5 Score: 78.9518 bits (193), Expect = 2.243e-14
Identity = 79/356 (22.19%), Postives = 149/356 (41.85%), Query Frame = 3
Query: 1482 RETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFI---IENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP-------KLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGL 2519
            +E   V I  K     +  ++ + R+    Y+I +   D+      +    + + + D+ND PP F   F+   I E+      V M    +  TD D   N  I+Y L   L+ ++SQ+FSV+     I   + ++++        + A D   P   A+T + ++++  +   P   N  Y FSV+E+  +G  IG++   + + D++   ++       G++    ++D F+   +E +TG I  +  LD E+       +R           D      +   +TV I D+NDN+P       +  + E   V  + +  S+       +  I  +L  E PY  L+ + G 
Sbjct: 2445 KEAWPVAIDRKTGRIHVSRVLNYHRDKR--YQIPLVVEDATGRRAFST---LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMM----VSATDDD--ENDTIEYSL---LDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIV------PGSE----ESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRA----------DAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGW 2766          

HSP 6 Score: 70.8626 bits (172), Expect = 6.407e-12
Identity = 114/495 (23.03%), Postives = 198/495 (40.00%), Query Frame = 3
Query:  648 PIFPQSYIKIAVHENVEIGHTIVLPKA--EDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFE-FRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSI-YRITITCSDSNTISKLTQSV-EIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDV---HMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTA--STQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADT 2102
            P F  S+ +  V E V +G  I   KA  E L T       + L S        +++ EP    ++++    +D E       +V  + +       + S+   + D NDN P+F   T    V+E+      +  +   D D G N  ++Y+I   +   +  FK+   K G  ++L   LD E +++    RI A D     L    ++ +R +N   E PE   ++R         Q TL ++      +++++                H   V Y  E  N    E   +  L   +      T + +R ++ C+     ++  Q + ++  KI   N + PIF    + G I E   T   V    +   V+   D D G N  + Y +   L+  D Q FSV+     I+ +   D+EK K++ F++ A D G+P   +   + I ++V D ND  P   +     S++     G  +G   A D D+
Sbjct: 1361 PKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPL---VFNLFSVDDVAMEDKIRVEPSSGNVIVM--EPLDYEAARRIRAVV-QVQQANMKSFATFSV--NINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSI--VSGNEESLFKI-DAKSG-EVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSN---EAPETAKFDR------KVYQTTLYDSTRPGTPVLVLNAL--------------HHGTVSYKLEP-NCTFFE---VHTLSGAVHLATWLTKLKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRM---LSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDS 1813          

HSP 7 Score: 62.3882 bits (150), Expect = 2.782e-9
Identity = 135/654 (20.64%), Postives = 269/654 (41.13%), Query Frame = 3
Query:  366 DVGHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIR--VNIEDENDNEPIFPQS-YIKIAVHENVEIGHTIVLPKAE-DLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENV--NIIEKKKIFELQNLIEFD----RETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLK-----DALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDG-GKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNT 2279
            D+G ++L   +I   E D +  +     + F +  GK+++   L       P  ++  ++         F  I   N  ++ +   V I   +   P+F Q+ Y  +   E+ +    +V   A+  L + S G+  Y+++  KS  S   +  E + N L      K+  ETN  F +    + R K      + II++   I  + P FE+   + S  E+   G+ +  IK T SD   N  + Y++        +  ++      +++  Q  LDYE    ++ +++A   G   + S A   V + ++NDE PE +  +  + +  ++I           Q I ++  TD D+  ++ L E S  K ++ + + +    NI        L   +E D     +T  +  +++T       +KL     +++        PP F  S +    +E  + ++   +T  V        G    +++ L      ++  S ++   +++ +  +I     ++Y + K+++  LV  D  G+ A +    +T+SV D ND  P     FY+ S+ E    G  +  + A+D D +    D I E   LDG+     ++  F +    G I     L+H+    +S  ++  ++
Sbjct: 1997 DIGTVVLEPKVIDNDEGDVVTISSENMPEYFKIVGGKVVLGKKL-------PSIEEEDLE-------FNFKLIAKDNGSVHRVEEPVKIRVVDKARPVFSQNVYTAVISKESTKKSTVLVKVMAKSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLNNL------KMLAETNYTFEVEAREVTRPKMIAKAQVEIIVK-SGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSD--ENDTIEYSL-----SGSKDIEIHPETGDVTITGQ--LDYEKTQKYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAIT---------GQFITIMSATDMDT--TNSLDEESQ-KLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLV----VEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAV-------KGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFST---LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDEN----DTI-EYSLLDGS-----ESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDS 2583          

HSP 8 Score: 61.6178 bits (148), Expect = 4.730e-9
Identity = 100/449 (22.27%), Postives = 174/449 (38.75%), Query Frame = 3
Query:  858 IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRP--HFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGT-----PYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDIL------CEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHF--------GKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALT-ASTQITISVSDAN-------DNRPEIGNKF--YTFSVLEEQPIGTKIGQIVASDADTDQL 2111
            +D      FNL +   D G P  + S  + +E+ DI  N     F++     SV EN   G E+  I +   + G   ++     +Y       +  F I    +++    LD E K+ +   + A+D  T     P       V +R+ + ND  P         +        ++ EN P +  I+ +  TD D   +D         E   P+  F +  T                +   DRE  S + + ++  D     +L  +V + + + D NDN P F+ + H         GK+                I   DAD G N+R+ Y++ +         FS+++    I   E I  ++S  +   + A D G P    A+T++ ++ + A        ++ PEI  K   Y   + +   +G  +G++ ASDAD D+L
Sbjct:  890 LDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEV--IMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRP---------VAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGY--------ITTSGIRRLDREKQSEHELWVSICDGGE-PQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFAGKLCR--------------IFAVDADEGENARLTYNITEG-----DARFSIDNN-GNIIASEAIHGDES--YALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDEL 1296          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 115.546 bits (288), Expect = 1.536e-25
Identity = 176/672 (26.19%), Postives = 280/672 (41.67%), Query Frame = 3
Query:  618 VNIEDENDNEPIF-PQSYIKIAVHENVE-------IGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIV-DPN-SIQL------------------------TLPENG-----PKHQTIILIHVTDKDSKLSDILCE-VSHPKDV----FYLRETENVNIIEKKKIFELQNLIEFDRETTSI-YRITITCSDSNTISKLTQSVEIQMKIDDVN--------------DNPPIFSSSFHFGKIMETD----LTDQDVH---MTEG-----VIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSC 2420
            +++ DEND  P F     + + V E ++       IG +I    AEDLD    G+  Y ++S  +  S F V +   D    ++    +DRE +S+  LL+ A D G PS + +  I++ V DINDN P FE S+  + + EN + G +I RI  TD D  A  Q S    D  +   R      +  G  + +   ++ E    F F +   D       S   V + V + ND  P I   N    V DP  S+++                         L ENG        QT + + VT  D        E + HP        ++ + + V++ E  +    Q L  F     SI Y I   CSD   + K T  ++ +  +D                 DN P+ + +    KI++ +      DQ ++   +TE      +  V   DI  +SR+ Y +       D+ +  + +E  QI++   +D E   ++   + A+D GKP    +T + ++V D +DN P     F+   V E+  IG  + Q+ ASDAD    +R   FE   LDG      +   F ++ NTG +     LD EK Q  S+ ++V+ T       D      +S+ + VK  D+NDN+P     E L + +  S 
Sbjct: 1636 IHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSI----AEDLDEGQNGLVTYSILSGNT--SLFAVNSTTGD----ILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFR----INVATGW-ITVAGKVNREENEEFRFFVKVTDGEKS---SKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDE----QELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIARDIDRSSRVFYEIVGG----DANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIFHV-EVPEDVRIGEPVIQLSASDADEHSNHR---FE---LDGGG----EGIPFRVDENTGMVFVNDSLDFEKKQ--SYRIKVKLT-------DGAWLIETSLFVNVK--DVNDNAPIFEKPEYLFISEENSA 2259          

HSP 2 Score: 102.064 bits (253), Expect = 2.063e-21
Identity = 115/398 (28.89%), Postives = 180/398 (45.23%), Query Frame = 3
Query:  369 VGHLLLTSSLISQAEKDNIYFTDRKNSQ-PFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYG-IDNYKLISDKSC---GSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP--EILFYNRGS---IVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL---SDILCEVSHPKDVFYLRETENVNIIEKKKI 1523
            +GHL        +AE    Y   R NS+  F     +L V+ PLDRE                E++  M I ITSP   I +I +++ D NDN PIFP    ++ + E   IG  + +  A D D    G I  Y+L+   +     S F +     D  L L    K+DRET  ++++ + AID+G P  + S  + + + DINDN P+F     SL++  NG    ++  +  TD D   NS ++Y I      ++    +F I D   L  Q+  +   +   EF + A+D G P L +T  + V +   N+  P   I FY       IV P  +      NG   +T+ ++ +TD D  L   S I  E  + + +F L   +++NI+  K +
Sbjct:   46 IGHL--------EAEIGYTYRLSRGNSKIKFDEQTLELSVSSPLDRE---------------SENAIDMLI-ITSPPSII-HILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQ--SDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF--GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSE----MFSISDENILVTQNNTECLQR--CEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQPEDV------NG---KTLAILSITDSDGPLGANSTIWIENGNEQSIFSLISRQSINILTVKHV 399          

HSP 3 Score: 80.1073 bits (196), Expect = 1.016e-14
Identity = 76/277 (27.44%), Postives = 122/277 (44.04%), Query Frame = 3
Query: 1548 FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
             D E    YR  IT   S +        ++ + + D ND  P F +       +  +L      +  G     D D G N  + Y    ++ S ++  F+VNS    I +  P+D E+S   +  + A D G P+L+A+++I I V D NDN PE     Y   + E   IG+KI +I+A+D D D    ++ + + S D           F I   TG+I     ++ E+++   F V+V +     G K      SS V + + + D NDN P +
Sbjct: 1613 LDFENIKTYRFNITAGKSTS--------QVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTY----SILSGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDA---ELQYSLESNDEITIP------FRINVATGWITVAGKVNREENEEFRFFVKVTD-----GEK------SSKVIVEIHVEDFNDNHPMI 1857          

HSP 4 Score: 58.9214 bits (141), Expect = 3.227e-8
Identity = 42/156 (26.92%), Postives = 75/156 (48.08%), Query Frame = 3
Query: 1749 GVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKT 2216
            G IQ  D D G++  + Y +    +  D   F ++S    +++ +  D EK + + F   A D G P+ T +   TI + D NDN P+ G+++YT ++  +      I Q  A+D D D  N+ + + +L+          +D F ++  TG + T
Sbjct:  651 GRIQARDEDSGLSGVVSYKILTKSDDYDG-IFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAIVQ--ANDNDVDVKNQKLQYHLLNY---------HDFFQLDKETGKVTT 794          

HSP 5 Score: 57.7658 bits (138), Expect = 7.246e-8
Identity = 67/236 (28.39%), Postives = 105/236 (44.49%), Query Frame = 3
Query: 1419 KDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRI-KYHLKDALNSTD--SQYFSVNSE---YPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQ 2108
            +D+KL+ I+  +       Y     N  I   ++  EL      DRE+ +   + I  S  + I        I + + DVNDN PIF       +I ET      V ++      TD D G N  I KY L D+L + D  S +  V S+   + ++  K  +D E    +   L A+D G P L++S  + I + D NDN P  G +  T +     P  TK+  + A+D D+++
Sbjct:   38 EDAKLNTIIGHLEAEIGYTYRLSRGNSKIKFDEQTLELSVSSPLDRESENAIDMLIITSPPSII-------HILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGA----TDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGK--LDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTLN-WNGLP-NTKLFSLNATDLDSNE 258          

HSP 6 Score: 51.6026 bits (122), Expect = 5.058e-6
Identity = 68/299 (22.74%), Postives = 128/299 (42.81%), Query Frame = 3
Query: 1884 PIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPE-IGNKFYTFSVLEEQPIGTK---IGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVS-VIGQDRNG--------GNGSRRAECLINIHLKSSTVNKPINNPK 2741
            P+D+E  K ++F + A   GK    +++Q+ I V+D ND  P  I        VLEE    +    IG  +A D D  Q N  V + +LS + +        LF + + TG I + + LD E+      L+  ++          +   S++  I + + DINDN+P+  L    I     S + S+   I+ T                  D+  +AE+  +L+ N   ++           ++++ G+ TV+  + ++ N          +G + ++ ++ IH++    N P+ N +
Sbjct: 1612 PLDFENIKTYRFNITA---GK----STSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQ-NGLVTYSILSGNTS--------LFAVNSTTGDILSLIPLDREESSLHELLIEAKDAG--------IPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILAT------------------DKDKDAELQYSLESNDEITIPF--------RINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMINDR 1860          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 209.149 bits (531), Expect = 3.515e-54
Identity = 182/642 (28.35%), Postives = 308/642 (47.98%), Query Frame = 3
Query:  573 FIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENV--EIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTK--IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSK--LSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP-------KLALKESLIVEQAGSCLSSQKPIIITTSD 2459
             + I    R I  + V ++DENDN P FPQ+ + I   EN   E+  T+ LP A DLD   Y    Y ++S     +     +  +D  L L  +    +DRET   ++LL+ A+D G P   G +++ + ++D+NDN+P F +S    +V EN   G  + ++  +D+D   N  + Y I    S  ++ F++   + G ++ +   LD+E K + E  ++AKD G   L +TA V++RVT++ND  P I   N   + D  S +++  E+    + +  I V D DSK   +++   ++     F L   +N        I+ +   +  DRE  S Y +++  +D  T   L  S  I ++I DVNDNPP F    +   +ME  + D    + +  +   D D G+NS + Y L +    T +Q+F ++ +   I  +  ID E     +  +VA DGG P L+++  + +++ D NDN P     FY  SV E +P+G  I ++ ASD D   +N  V + +   +G K        F + + +G I     LD E+          R++ E+          S++  I +++ D+NDN P       K++L+ES    +A S  SS   + +  +D
Sbjct:  148 LVAIPLSGRNIRVL-VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL-LP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRI-DPRTG-AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI---NVIFLSDDASPKIS--ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDN-------SIYLVIVHLPLDREIVSNYTLSVVATDKGT-PPLHASKSIFLRITDVNDNPPEFEQDLYHANVME--VADPGTSVLQ--VLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTI--GEGFKHLTE----FEVRSASGEICIAGELDFER----------RSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES---PKASSQASSTPIVAVVATD 746          

HSP 2 Score: 172.555 bits (436), Expect = 7.497e-43
Identity = 158/656 (24.09%), Postives = 288/656 (43.90%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDY----------TSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGV-IQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDV--IFEMLSLDGTKRRQRQNDL---FIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            + + +ED NDN P F  S ++I+V E+ E+G  +    A D D+ S G   Y L+ +   G  F +  + +   L+L     +D E++    L+V A D G PS + +L+I+++V+D+NDN P FE+   S++V E+     +I ++  +D D G N++++Y I D           +S   ++F +F     I   L++ LD E ++ ++  ++A D GTP   +   V VRV + ND  P+            +  +  + EN  +   + ++  +D D         +     + Y     N +        E+      DRE   +Y + +   D  T  + +  V +++ + DVNDN P  +      +     + ++    TE V ++  D D G N+ I Y +    +S     FS++     I+ +  +D+E+   ++  + A DGG P       + + V D NDNRP   +    F V E+  +G  +G I   +   D +   V   FE L +  T     ++ +   F I+ ++G +    +LD E        +R  +T      +      SS++ + +++ D+NDN+P+                  Q PI +  S+          +T  DAD G N ++
Sbjct:  917 VNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG-LFAI--DARSGHLIL--SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWI--YLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF---------QKSKYEFRIEENLRRGSVVGVVTASDLD---------LGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADP----QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQ------SSAITVKIEVADVNDNAPEWP----------------QDPIDLQVSEATPVGTIIHNFTATDADTGTNGDL 1520          

HSP 3 Score: 149.443 bits (376), Expect = 1.032e-35
Identity = 161/688 (23.40%), Postives = 298/688 (43.31%), Query Frame = 3
Query:  477 LIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLI-SDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQT------IILIHVTDKD-SKLSDILCEV--SHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDA 2507
            +IV  PLDRE          ++     S      G T P      I + I D NDN P F Q      V E  + G +++   A D D        Y L  + ++    F++  +P+    ++  ++ ID ET  V  L V+A D G P  + + ++++ + D+NDN P F++S  ++SV EN   GR I ++  +D D G N+ ++Y I     +  ++   F+++     + +   LD+E ++ +EF ++A D+G   L +TA + +++T++ND  P  +FY       P   +++L E+ PK  +      I+ +  TD D      +   +   +   +F +  +     + +  +  ++        T  ++ + I+ +D   +     +V + + I D    PPIF  +  +   ++ D+    V    G +     D+   S ++Y +    +     YFS+ +    I+  +P+D+E   Q    + A   G+P +   TQ+ I V D NDN PE        SV E   +G  +    A D D+    + V + ++   G         LF I+  +G +     LD+E  Q  + +V          T   +   S+++ I V + D+NDN P     E  +       +++Q  I +  SD+ +   +   Y  +DA
Sbjct:  456 VIVHLPLDRE----------IVSNYTLSVVATDKG-TPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQI--DPQTG--LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI----GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRP--VFY-------PREYKVSLRES-PKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVR--------TQPMHMLNISATDGGNLRSNADAV-VFLSIIDAMQRPPIFEKA-RYNYYVKEDIPRGTV---VGSVIAASGDVAHRSPVRYSI---YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQ-VTYSLVKESG-------KGLFAIDARSGHLILSQHLDYESSQRHTLIV--------TATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQI-IQVNASDLDTGNNARITYRIVDA 1078          

HSP 4 Score: 145.591 bits (366), Expect = 1.418e-34
Identity = 153/589 (25.98%), Postives = 259/589 (43.97%), Query Frame = 3
Query:  396 LISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKL---ISDKSCGSCFEVKNEPKDNRLVLVFKTK-IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPH----FEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSY-NIEDYTSQAQRYFKLFQIKDGISLQL-QSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI---LFY-NRGSIVDPNSIQLTLPENGPKHQTIILIHVTDK--DSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLE-----EQPIGTKIGQIVASDAD 2099
            L S  E+D + + D             L ++G LDRE         +L+ +  +       G T P R    + + I+D NDN+PIF QS     V EN  +G +++   A D D    G+  Y +    SDK     F +     D R   ++  K +D ET  +  L+V+A D G+     +  + + V D+NDN+P     F     S  + E+ + G  + RI V D D    S+  Y N+    +    +F L    + I L +    LD E  + +   ++A D+GTP L ++ ++ +R+T++ND PPE    L++ N   + DP +  L            +L H  D+  +S L+  L E       ++  + +   I  +  I         D ET  + ++T+   D   +  L+ +  + + I DVNDN PIF  SF+   + E +   + +      +  +D D G+N+ + Y + +         F V S   +I     +D+E+   ++F ++A D G   L+ +  I + ++D NDNRP    + Y  S+ E      Q   T I  +VA+D D
Sbjct:  224 LSSHRERDGVLYLD-------------LQISGFLDRETTPG----YSLLIEALD-------GGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKE--QMFRI-----DPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD----SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQ-----------VLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI---------DCETEPVPQLTVVARDGG-VPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILK----VSASDPDCGVNAMVNYTIGEGFKHLTE--FEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPD 748          

HSP 5 Score: 144.05 bits (362), Expect = 3.856e-34
Identity = 187/743 (25.17%), Postives = 304/743 (40.92%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLI--------SDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGK---PSKTGSLSIILEVEDINDNRPHF------EESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI--KDGISLQLQS----TLDYENKNIFEFRIIAKDQGTPY-LMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILI-----HVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSV----------------------EIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKP-ALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            G L+V   LDRE     Q++  L  +  +++        +P      +++ + D NDN P +PQ  I + V E   +G  I    A D DT + G   Y+LI        S +   S F + +        L  +  +D E    + L+V A+D+          S+++ L + D ND+ PHF         T SL + +  R G  +  I   D D G N Q++Y I     + +     F+I  + GI   ++S    T D E    F   I AKD G P    S+  + + V   ++ PP  L             + T+ EN P    ++ +     H  +  +   +I   V++  D+F++       II  +         +FDRE+ + Y + +   D+N  S L+ S                        I + + DVNDN P F     +G  +  +     +H     +  +D D G N+ + Y +           FS++S   ++  + P+D E+  ++   + A D G+P +      ITI V D NDN P      YT SV E+ P+GT + QI A DAD   +N  +++ +         Q Q   F I+  +G I T   LD E     +F+V   +   Y       +  S++V + + ++DINDN P        I E+       Q P +I        + +      LDAD G NAE+V +L
Sbjct: 1433 GNLVVARLLDREV----QSEFRLEIRALDTTAS-----NNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG----ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-----FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFL---------QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN--DLFHVDWQRG--IITTRG--------QFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH----TVVASDLDEGPNADLIYSIT---GGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLG-VNARLVYSL-----ANETQWQ---FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRY-------EVRSATVPVQINVLDINDNRP--------IFERYPYI--GQVPALIQPGQTLLKVQA------LDADLGANAEIVYSL 2096          

HSP 6 Score: 122.865 bits (307), Expect = 1.114e-27
Identity = 144/528 (27.27%), Postives = 231/528 (43.75%), Query Frame = 3
Query:  849 KTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKR--IKVTDSDIGANSQMSYNIEDYTSQAQRYFKL--FQIKDGI---SLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEV-----SHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPP----IFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKY-HLKDALNSTDSQYFSV---NSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            K K+DRET + ++L+ +      P    ++ +++ V+D NDN P F ++++ +   EN  + RE+KR  +   D D+   +   YNI   +      F+L   + +DG+    LQ+   LD E    +   I A D GTP L    TV + + ++ND  P         I + +    T+PEN     +++ ++ +D D+  + ++        S  + +F +        I K            D ET  ++ + +   D      L  +  + +++ DVNDN P    IF S     KI E+    + V      I V D D    S+ +Y ++   LN  D  +      NS Y  I +  P+D E    +   +VA D G P L AS  I + ++D NDN PE     Y  +V+E    GT + Q++A D D + LN  + +   SL  T     Q   F I+  TG I TR  +D E +      V  R+     G    L   SS+  + V I D+NDN P
Sbjct:  135 KVKLDRETRASYSLVAI------PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPEN--TPREVKRTLLPARDLDLEPYNTQRYNI--VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP---------IFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKA----------LDFETKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFV----ARISVHDPD----SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHL-PLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALTY---SLAETPETHAQ--WFQIDPQTGLITTRSHIDCETEPVPQLTVVARD-----GGVPPL---SSTATVLVTIHDVNDNEP 609          

HSP 7 Score: 115.161 bits (287), Expect = 3.054e-25
Identity = 166/730 (22.74%), Postives = 290/730 (39.73%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTI--VLPKAEDLDTPSYGID--------NYKL--ISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPS--KTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDY-------TSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQG---TPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNS-----IQLTLPENGPKHQTIILIHVTDKDSKLSDILC-EVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADI--GMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQ-----------------------ITISVSDANDNRPEI-GNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLD-GTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL--KENPNFSLDMGHNLIC 2591
            G   P   +  +RV + D NDN P F  S +   V E+  +GH +  + P     D     ++         Y L  ++     + F++     +    LV    +DRE  S F L + A+D    +  ++ ++++ +EV D+NDN P + +  I L V E    G  I     TD+D G N  + Y +  Y         QA   F++  +   +S  LQ+ LD+E    +   + A DQ    T  L ++ TV +R+ + ND  P          V PNS       L + +     + +  I   D+DS  +  L  E++        R      IIE  K   L    E D E    + + I   D         S+ + + +   ++NPP F  + +   I+E      +V     V+QVT   +    N+ + Y +   +    +  F V+ +   I  +   D E    +   +   D  + +  +S+                        I I+V D NDN PE      Y  SV E    G  I  +VASD D +  N D+I+ +   + G K        F I++++G +  R +   +++QH  + ++++ ++     + +         IT+ + D NDN+P+  L +          +    P+  +   I++          +DAD G+NA +V +L  +    F++D    LI 
Sbjct: 1340 GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN----LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALS--LQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPH--------FVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVK--SLPPATE-DVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILE------NVPSGSFVLQVTAKSLHGAENANLSYEIPAGVA---NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLD-EGPNADLIYSITGGNLGNK--------FSIDSSSGELSARPL---DREQHSRYTLQIQASD-----RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYT------GSVQEDAPLGTSVVQISA----------VDADLGVNARLVYSLANETQWQFAIDGQSGLIT 2009          

HSP 8 Score: 108.227 bits (269), Expect = 3.323e-23
Identity = 158/672 (23.51%), Postives = 265/672 (39.43%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSC---FEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGS-----------------------LSIILEVEDINDNRPHFEE-STISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQST-LDYENKNIFEFRIIAKDQGTP-YLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLR-ETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRP--EIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQL---------NRDVIFEMLSLDGTKRRQRQN----DLFIIENNTGFIKTRVVL--------------DHEKDQHV----SFLVRVRNTNE----YVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE 2390
            G   P +    + + ++  ++N P F Q+  +  + ENV  G  ++   A+ L    +G +N  L  +   G     F V  +    R ++  + + DRE+ + + L V   D  + S   S                        +I + V D+NDN P F   S   LSV EN   G  I  +  +D D G N+ + Y+I             F I D  S +L +  LD E  + +  +I A D+G P        +T+ V + ND  P   L    GS+           E+ P   +++ I   D D  ++  L        V+ L  ET+    I+ +    +  + + DRE  + Y   +  +D       + +V +Q+ + D+NDN PIF    + G++       Q +      +Q  DAD+G N+ I Y L +A NS  S  F +N     +   + +  E  K     +VA D G P  ++   I + + +A    P     N+ Y   + E  P GT++ Q+VA  +D  +          N D I  + SL G  R  + +    D F   + +   + R +               +  + Q      SF +     NE     V       F +S   + +++ D NDNSPK + K+
Sbjct: 1694 GQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSL----HGAENANLSYEIPAGVANDLFHVDWQ----RGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSI-----TGGNLGNKFSI-DSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSV----------QEDAPLGTSVVQISAVDADLGVNARL--------VYSLANETQWQFAIDGQSGL-ITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLK----VQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQ 2326          

HSP 9 Score: 104.76 bits (260), Expect = 4.596e-22
Identity = 131/513 (25.54%), Postives = 216/513 (42.11%), Query Frame = 3
Query:  795 SCFEVKN-EPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS--LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI-------EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSS---FHFG------KIMETDLTDQDVHMTEGVIQVTDADI-GMNSRIKYHLKDALNSTDSQYFSVNSEYPQIK-NKEPIDYEKSKQFKFF--LVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQL-----NRDVIFEMLS-----LDGTKRRQRQNDLFIIENNTGFIKTRVVLDH 2234
            S F + N +P + R+VLV +T                     P       +++E+ED NDN P F +     +V E    G  + ++   DSD G+N+++ Y+I D       +   F I+   S  ++    LD E ++I++ +IIA D+G P +  TAT+ V++ ++ND  P            PN++ +T+ E       I  I   D D          ++P   + L     V+ IE   IF L             D E    Y + +  SD+   ++   +V    +++D NDN P+F +     +F       +I E+   D D+      +  TDAD  G NS++ Y ++ A      + FSV+     +  N   +    S    +F  ++A D GKPAL +ST + +  +D    R +     Y   + E  P+G+ + Q+   DA    L     N +  FE+L      L     R+R NDL+         K R+VL H
Sbjct: 2276 SSFALTNSQPNEIRVVLVARTA------------------DAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVD-----GNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF---------PPNNL-VTVSEATELGAVITSISANDVD----------TYPALTYRLGAESTVD-IENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTV----RVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLL----TVNATDADSEGNNSKVIYIIEPA-----QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-GQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRER-NDLY---------KLRLVLSH 2720          

HSP 10 Score: 91.2781 bits (225), Expect = 5.917e-18
Identity = 105/352 (29.83%), Postives = 170/352 (48.30%), Query Frame = 3
Query:  324 TVTENIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKN--SQPFSLSHGKLIVT--GPLDREKICS---PQTDQNLIQKCCESSCCM-------FIGITSPNRKINY--IRVNIEDENDNEPIF-PQSYIKIAVHENVEIG--HTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKP-SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQST--LDYENKNIFEFRIIAKDQGTPYLMSTATVTVR--VTNLNDEPP 1307
            T+ EN+P  S S +    L +T+  +  AE  N+ +       +  F +   + I+T  G  DRE   S   P   ++  ++   SS  +        IG TS  +  +   I + + D NDN P F P S   ++V EN E G  HT+V   A DLD      D    I+  + G+ F + +   +     +    +DRE +S + L + A DRG+P S+ G  +I + VED NDN P F+ S  + SV+E+   G  + +I   D+D+G N+++ Y++ + T   Q  F +    DG S  + +   LD E +  + F ++A D G  Y + +ATV V+  V ++ND  P
Sbjct: 1727 TILENVP--SGSFV----LQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV---ASDLDE-GPNADLIYSITGGNLGNKFSIDSSSGE-----LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANET---QWQFAI----DGQSGLITTVGKLDRELQASYNFMVLATDGGR-YEVRSATVPVQINVLDINDNRP 2055          

HSP 11 Score: 89.7373 bits (221), Expect = 1.522e-17
Identity = 150/640 (23.44%), Postives = 261/640 (40.78%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCG----SCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHF---------------EESTISLSVEENGRSGREIKRIKVTDSDI-GANSQMSYNIEDYTSQAQRYFKLFQIKDGISL---QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSN-----TISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD-QDVHMTEGVIQVTDADI--GMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEK-SKQFKFFLVAVDGGKPALTASTQ-ITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADT---DQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCL 2423
            IRV I D NDN+P FP + + + V E  E+G  I    A D+DT  Y    Y+L ++ +      S F +          LV K ++D E    + L V+A D    ++T    + + V D NDN P F                E + SLSV+       ++  +  TD+D  G NS++ Y IE     AQ  F +      +S+   +LQ  +   +   +  RIIAKD G P L S+  + V+  +      + L          N  +  + E  P    ++ +     D  L+ I              E     +++ K I  ++ L   DRE   +Y++ +  S  +     +    +  + + + I D NDN PIF  S  +    E ++++   +  +   +Q  DAD     NS + Y   D  +  D   F+++     +     +DY+  +K ++  + A D        S Q   + + D NDN P+     Y   + E +P+G+ + +  ASD D     QLN        S+      +    +F +++ +G + +  V D+E+ Q     +   +    +G K       +SVA+ V+I   ++ +P+   +    V  A   L
Sbjct: 2414 IRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGK----LVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVD------FDLLTVNATDADSEGNNSKVIYIIE----PAQEGFSVHPSNGVVSVNMSRLQPAV--SSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFL---------QNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGN-----------EESAFELLQSKAIVLVKPL---DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKY----EAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLN-------YSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD----MGGK------KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVAL 2984          

HSP 12 Score: 78.1814 bits (191), Expect = 4.520e-14
Identity = 142/613 (23.16%), Postives = 251/613 (40.95%), Query Frame = 3
Query:  618 VNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKI--DRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI-KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQT------IILIHVTDKDSKL--SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETD-LTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKP------ALTASTQITISVSDANDNRPEIGNKF-YTFSVLEEQPIGTKIGQIVASDADTDQL-NRDVIFEMLSLDGTKRRQRQND--LFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE 2390
            + +EDENDN P F Q      V E    G  +    A D D  S     Y ++ D +  + F +  EP  + +V   +T I  DRE   ++ L ++A D G P  TG+ +I +++ D+NDN+P F  + + ++V E    G  I  I   D D      ++Y +   ++       +F + +    L L+  LDYE +  +E  +IA D       +   +TVRV + ND  P  L         P +    LP      ++      ++ ++ TD DS+   S ++  +   ++ F +  +  V  +   +   LQ  +     ++  Y + I   D+     L  S  ++++ +D       F  + +  +I E   L    + + +  +  + A I  N    + L   L S              I   +P+D E++  +K  LV      P        ++   + I++ DANDN P       Y   + E  P+   I Q+ A DAD +   N +V++++ S          ND  +F I+  TG +     LD++     S+ + +R  + +           S     +++ D NDN PK  L E
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIV-DGNHDNAFVI--EPAFSGIV---RTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQ------PPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSR---LQPAV----SSSGDYFVRIIAKDAGK-PALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFEL---LQSK------------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITS---------GNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRP-----LCSLQPFRLELHDENDNEPKFPLTE 2866          

HSP 13 Score: 75.0998 bits (183), Expect = 4.791e-13
Identity = 115/474 (24.26%), Postives = 194/474 (40.93%), Query Frame = 3
Query: 1350 SIQLTLPENGPKHQTIILIHVTDKD-----SKLSDILCEVSHPKDVFYL---RETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYT----FSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLA--LKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN-----FSLDMGHNLICLKNLHL---SPGYFTVSVIGQDRNGGNGSRRAECLINIH 2699
            S+ +  PEN P+     L+   D D     ++  +I+    +  D F L   RE + V         +LQ     DRETT  Y + I   D  T   L   + + + I DVNDN PIF+ S +F  + E      +  +   V+QV  +D D   N  ++Y + +   S   Q F ++     I   + +D+E  +  +  +VA D G+  L  +  ++I V+D NDN+P I   F +      + E    G  + +I   D D+     +V   +   DG         L   +N+   +   + LD E   + +  V        V T        +S +I ++I D+NDN P+    L  + ++E A               D  +++     +   D DEGLN+ +  +L E P      F +D    LI  ++ H+   +     ++V+ +D      S  A  L+ IH
Sbjct:  178 SMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVS--GNVNDAFRLSSHRERDGV------LYLDLQISGFLDRETTPGYSLLIEALDGGT-PPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPE------NATVGTSVLQVYASDTDADENGLVEYAI-NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDG------HFALTTRDNSIYLVIVHLPLDREIVSNYTLSV--------VATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVA---------------DPGTSVLQVLAH---DRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRS-HIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIH 602          

HSP 14 Score: 70.4774 bits (171), Expect = 1.112e-11
Identity = 114/539 (21.15%), Postives = 227/539 (42.12%), Query Frame = 3
Query:  597 RKINYIRVNIEDENDNEPIF----PQSYIKI-----AVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISD-KSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLV--LAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRII-AKDQGTPYLMSTAT-----VTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL---SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDS-QYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD-GGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQ---PIGTKIGQIVASDADTDQLNRDVIFEM 2135
            R +  +RVN  DENDN P+F    P +Y  I      + E++ +   ++   A D D+     +N K+I   +     F V      N +V V  +++    +S  +  V  +A D GKP+   S  + ++  D    R  F ++     + E    G  + ++            +  ++       +  F+L Q K   ++ L   LD E  ++++ R++ +   G P + S  +     V + + + ND  P    ++R +       +  + E  P   +I  +   D D +    S+++ +++   D         ++++    +  + N +++D    S Y + I   DS+    L      ++++ D NDN P F  + +   + E +     V         +D D G   ++ Y +  A +   S + F V+SE   + +    DYE+ +++   L+A D GGK    AS  + + +   ++  P+   + Y F VL      P G  +GQ+ A+D+D+    R V++++
Sbjct: 2515 RTVLTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEG---NNSKVIYIIEPAQEGFSVH---PSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL--------GQDALDQSLAIIAGNEESAFELLQSK---AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP---IFDRSA-----KYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMF----TIDLV--TGVLFVNNRLDYDSGAKS-YELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRA----HASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGK---KASVAVRVEIESRDEFTPQFTERTYRF-VLPAAVALPQGYVVGQVTATDSDSGPDGR-VVYQL 3010          

HSP 15 Score: 68.1662 bits (165), Expect = 6.100e-11
Identity = 67/248 (27.02%), Postives = 107/248 (43.15%), Query Frame = 3
Query:  462 LSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKL---ISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEEST--ISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLD 1190
            L  G L V   LD +   S      LI + C+S          P   +   R+ + DENDNEP FP +     + EN  +G ++    A DLD   +G  NY +    SD+S    F V +E        VF    D E    +++ +LA D G   K  S+++ +E+E  ++  P F E T    L        G  + ++  TDSD G + ++ Y +    S    +FK+ +    + ++ +  LD
Sbjct: 2807 LVTGVLFVNNRLDYD---SGAKSYELIIRACDSHH------QRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVF----DYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL----SAPHSHFKVNRSSGAVLIKRKLKLD 3035          

HSP 16 Score: 61.2326 bits (147), Expect = 7.756e-9
Identity = 67/261 (25.67%), Postives = 115/261 (44.06%), Query Frame = 3
Query: 1821 NSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENN-TGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFP-YTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLK 2597
            NST SQ    +S +  + N +P       + +  LVA     P L +  ++ I + D NDN P+   K +  +V E    GT + Q+ A D+D     R        +DG       ++ F+IE   +G ++T +VLD E        +R     + + T + +   + +  I V+I+D+NDN P       + V +A     ++   +IT+  I++N    +P  T+      L AE  V ++    F+LD     + LK
Sbjct: 2265 NSTRSQRALTSSSF-ALTNSQP------NEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNAR---LRYHIVDGN-----HDNAFVIEPAFSGIVRTNIVLDRE--------IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEA-----TELGAVITS--ISANDVDTYPALTYR-----LGAESTVDIENMSIFALDRYSGKLVLK 2490          

HSP 17 Score: 53.5286 bits (127), Expect = 1.605e-6
Identity = 76/312 (24.36%), Postives = 134/312 (42.95%), Query Frame = 3
Query:  618 VNIEDENDNEPIFPQSY-IKIAVHENVEIGHTIVLPKAEDLD---TPSYGIDNYKLISDKSCGS---CFEVKNEPKDNRLVLVFKTKIDRETNS-VFNLLVLAIDRGKPSKTGSLSII-LEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQS-TLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRG-SIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKK 1517
            + I D NDN PIF +S   +  + E   + ++I   +A D D   TP     N +++ D + G+    F +         VL    ++D ++ +  + L++ A D        SL    LE+ D NDN P F  +     + EN   G  + R   +D D G   Q++Y+I    S  +  +K+F++     L   +   DYE +  ++  ++A D G       A+V VRV   + +     F  R    V P ++ L      P+   +  +  TD DS     ++ ++S P   F +  +    +I++K
Sbjct: 2740 ITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTP-----NSEVVYDITSGNDEHMFTIDLVTG----VLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSD-ESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG----KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVAL------PQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRK 3031          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 209.149 bits (531), Expect = 3.515e-54
Identity = 182/642 (28.35%), Postives = 308/642 (47.98%), Query Frame = 3
Query:  573 FIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENV--EIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTK--IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSK--LSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP-------KLALKESLIVEQAGSCLSSQKPIIITTSD 2459
             + I    R I  + V ++DENDN P FPQ+ + I   EN   E+  T+ LP A DLD   Y    Y ++S     +     +  +D  L L  +    +DRET   ++LL+ A+D G P   G +++ + ++D+NDN+P F +S    +V EN   G  + ++  +D+D   N  + Y I    S  ++ F++   + G ++ +   LD+E K + E  ++AKD G   L +TA V++RVT++ND  P I   N   + D  S +++  E+    + +  I V D DSK   +++   ++     F L   +N        I+ +   +  DRE  S Y +++  +D  T   L  S  I ++I DVNDNPP F    +   +ME  + D    + +  +   D D G+NS + Y L +    T +Q+F ++ +   I  +  ID E     +  +VA DGG P L+++  + +++ D NDN P     FY  SV E +P+G  I ++ ASD D   +N  V + +   +G K        F + + +G I     LD E+          R++ E+          S++  I +++ D+NDN P       K++L+ES    +A S  SS   + +  +D
Sbjct:  148 LVAIPLSGRNIRVL-VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL-LP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRI-DPRTG-AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI---NVIFLSDDASPKIS--ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDN-------SIYLVIVHLPLDREIVSNYTLSVVATDKGT-PPLHASKSIFLRITDVNDNPPEFEQDLYHANVME--VADPGTSVLQ--VLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTI--GEGFKHLTE----FEVRSASGEICIAGELDFER----------RSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES---PKASSQASSTPIVAVVATD 746          

HSP 2 Score: 172.555 bits (436), Expect = 7.497e-43
Identity = 158/656 (24.09%), Postives = 288/656 (43.90%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDY----------TSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGV-IQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDV--IFEMLSLDGTKRRQRQNDL---FIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            + + +ED NDN P F  S ++I+V E+ E+G  +    A D D+ S G   Y L+ +   G  F +  + +   L+L     +D E++    L+V A D G PS + +L+I+++V+D+NDN P FE+   S++V E+     +I ++  +D D G N++++Y I D           +S   ++F +F     I   L++ LD E ++ ++  ++A D GTP   +   V VRV + ND  P+            +  +  + EN  +   + ++  +D D         +     + Y     N +        E+      DRE   +Y + +   D  T  + +  V +++ + DVNDN P  +      +     + ++    TE V ++  D D G N+ I Y +    +S     FS++     I+ +  +D+E+   ++  + A DGG P       + + V D NDNRP   +    F V E+  +G  +G I   +   D +   V   FE L +  T     ++ +   F I+ ++G +    +LD E        +R  +T      +      SS++ + +++ D+NDN+P+                  Q PI +  S+          +T  DAD G N ++
Sbjct:  917 VNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG-LFAI--DARSGHLIL--SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWI--YLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF---------QKSKYEFRIEENLRRGSVVGVVTASDLD---------LGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADP----QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQ------SSAITVKIEVADVNDNAPEWP----------------QDPIDLQVSEATPVGTIIHNFTATDADTGTNGDL 1520          

HSP 3 Score: 149.443 bits (376), Expect = 1.032e-35
Identity = 161/688 (23.40%), Postives = 298/688 (43.31%), Query Frame = 3
Query:  477 LIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLI-SDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQT------IILIHVTDKD-SKLSDILCEV--SHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDA 2507
            +IV  PLDRE          ++     S      G T P      I + I D NDN P F Q      V E  + G +++   A D D        Y L  + ++    F++  +P+    ++  ++ ID ET  V  L V+A D G P  + + ++++ + D+NDN P F++S  ++SV EN   GR I ++  +D D G N+ ++Y I     +  ++   F+++     + +   LD+E ++ +EF ++A D+G   L +TA + +++T++ND  P  +FY       P   +++L E+ PK  +      I+ +  TD D      +   +   +   +F +  +     + +  +  ++        T  ++ + I+ +D   +     +V + + I D    PPIF  +  +   ++ D+    V    G +     D+   S ++Y +    +     YFS+ +    I+  +P+D+E   Q    + A   G+P +   TQ+ I V D NDN PE        SV E   +G  +    A D D+    + V + ++   G         LF I+  +G +     LD+E  Q  + +V          T   +   S+++ I V + D+NDN P     E  +       +++Q  I +  SD+ +   +   Y  +DA
Sbjct:  456 VIVHLPLDRE----------IVSNYTLSVVATDKG-TPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQI--DPQTG--LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI----GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRP--VFY-------PREYKVSLRES-PKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVR--------TQPMHMLNISATDGGNLRSNADAV-VFLSIIDAMQRPPIFEKA-RYNYYVKEDIPRGTV---VGSVIAASGDVAHRSPVRYSI---YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQ-VTYSLVKESG-------KGLFAIDARSGHLILSQHLDYESSQRHTLIV--------TATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQI-IQVNASDLDTGNNARITYRIVDA 1078          

HSP 4 Score: 145.591 bits (366), Expect = 1.418e-34
Identity = 153/589 (25.98%), Postives = 259/589 (43.97%), Query Frame = 3
Query:  396 LISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKL---ISDKSCGSCFEVKNEPKDNRLVLVFKTK-IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPH----FEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSY-NIEDYTSQAQRYFKLFQIKDGISLQL-QSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI---LFY-NRGSIVDPNSIQLTLPENGPKHQTIILIHVTDK--DSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLE-----EQPIGTKIGQIVASDAD 2099
            L S  E+D + + D             L ++G LDRE         +L+ +  +       G T P R    + + I+D NDN+PIF QS     V EN  +G +++   A D D    G+  Y +    SDK     F +     D R   ++  K +D ET  +  L+V+A D G+     +  + + V D+NDN+P     F     S  + E+ + G  + RI V D D    S+  Y N+    +    +F L    + I L +    LD E  + +   ++A D+GTP L ++ ++ +R+T++ND PPE    L++ N   + DP +  L            +L H  D+  +S L+  L E       ++  + +   I  +  I         D ET  + ++T+   D   +  L+ +  + + I DVNDN PIF  SF+   + E +   + +      +  +D D G+N+ + Y + +         F V S   +I     +D+E+   ++F ++A D G   L+ +  I + ++D NDNRP    + Y  S+ E      Q   T I  +VA+D D
Sbjct:  224 LSSHRERDGVLYLD-------------LQISGFLDRETTPG----YSLLIEALD-------GGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKE--QMFRI-----DPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD----SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQ-----------VLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI---------DCETEPVPQLTVVARDGG-VPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILK----VSASDPDCGVNAMVNYTIGEGFKHLTE--FEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPD 748          

HSP 5 Score: 144.05 bits (362), Expect = 3.856e-34
Identity = 187/743 (25.17%), Postives = 304/743 (40.92%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLI--------SDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGK---PSKTGSLSIILEVEDINDNRPHF------EESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI--KDGISLQLQS----TLDYENKNIFEFRIIAKDQGTPY-LMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILI-----HVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSV----------------------EIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKP-ALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            G L+V   LDRE     Q++  L  +  +++        +P      +++ + D NDN P +PQ  I + V E   +G  I    A D DT + G   Y+LI        S +   S F + +        L  +  +D E    + L+V A+D+          S+++ L + D ND+ PHF         T SL + +  R G  +  I   D D G N Q++Y I     + +     F+I  + GI   ++S    T D E    F   I AKD G P    S+  + + V   ++ PP  L             + T+ EN P    ++ +     H  +  +   +I   V++  D+F++       II  +         +FDRE+ + Y + +   D+N  S L+ S                        I + + DVNDN P F     +G  +  +     +H     +  +D D G N+ + Y +           FS++S   ++  + P+D E+  ++   + A D G+P +      ITI V D NDN P      YT SV E+ P+GT + QI A DAD   +N  +++ +         Q Q   F I+  +G I T   LD E     +F+V   +   Y       +  S++V + + ++DINDN P        I E+       Q P +I        + +      LDAD G NAE+V +L
Sbjct: 1433 GNLVVARLLDREV----QSEFRLEIRALDTTAS-----NNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG----ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-----FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFL---------QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN--DLFHVDWQRG--IITTRG--------QFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH----TVVASDLDEGPNADLIYSIT---GGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLG-VNARLVYSL-----ANETQWQ---FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRY-------EVRSATVPVQINVLDINDNRP--------IFERYPYI--GQVPALIQPGQTLLKVQA------LDADLGANAEIVYSL 2096          

HSP 6 Score: 122.865 bits (307), Expect = 1.114e-27
Identity = 144/528 (27.27%), Postives = 231/528 (43.75%), Query Frame = 3
Query:  849 KTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKR--IKVTDSDIGANSQMSYNIEDYTSQAQRYFKL--FQIKDGI---SLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEV-----SHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPP----IFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKY-HLKDALNSTDSQYFSV---NSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            K K+DRET + ++L+ +      P    ++ +++ V+D NDN P F ++++ +   EN  + RE+KR  +   D D+   +   YNI   +      F+L   + +DG+    LQ+   LD E    +   I A D GTP L    TV + + ++ND  P         I + +    T+PEN     +++ ++ +D D+  + ++        S  + +F +        I K            D ET  ++ + +   D      L  +  + +++ DVNDN P    IF S     KI E+    + V      I V D D    S+ +Y ++   LN  D  +      NS Y  I +  P+D E    +   +VA D G P L AS  I + ++D NDN PE     Y  +V+E    GT + Q++A D D + LN  + +   SL  T     Q   F I+  TG I TR  +D E +      V  R+     G    L   SS+  + V I D+NDN P
Sbjct:  135 KVKLDRETRASYSLVAI------PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPEN--TPREVKRTLLPARDLDLEPYNTQRYNI--VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP---------IFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKA----------LDFETKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFV----ARISVHDPD----SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHL-PLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALTY---SLAETPETHAQ--WFQIDPQTGLITTRSHIDCETEPVPQLTVVARD-----GGVPPL---SSTATVLVTIHDVNDNEP 609          

HSP 7 Score: 115.161 bits (287), Expect = 3.054e-25
Identity = 166/730 (22.74%), Postives = 290/730 (39.73%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTI--VLPKAEDLDTPSYGID--------NYKL--ISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPS--KTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDY-------TSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQG---TPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNS-----IQLTLPENGPKHQTIILIHVTDKDSKLSDILC-EVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADI--GMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQ-----------------------ITISVSDANDNRPEI-GNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLD-GTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL--KENPNFSLDMGHNLIC 2591
            G   P   +  +RV + D NDN P F  S +   V E+  +GH +  + P     D     ++         Y L  ++     + F++     +    LV    +DRE  S F L + A+D    +  ++ ++++ +EV D+NDN P + +  I L V E    G  I     TD+D G N  + Y +  Y         QA   F++  +   +S  LQ+ LD+E    +   + A DQ    T  L ++ TV +R+ + ND  P          V PNS       L + +     + +  I   D+DS  +  L  E++        R      IIE  K   L    E D E    + + I   D         S+ + + +   ++NPP F  + +   I+E      +V     V+QVT   +    N+ + Y +   +    +  F V+ +   I  +   D E    +   +   D  + +  +S+                        I I+V D NDN PE      Y  SV E    G  I  +VASD D +  N D+I+ +   + G K        F I++++G +  R +   +++QH  + ++++ ++     + +         IT+ + D NDN+P+  L +          +    P+  +   I++          +DAD G+NA +V +L  +    F++D    LI 
Sbjct: 1340 GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN----LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALS--LQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPH--------FVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVK--SLPPATE-DVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILE------NVPSGSFVLQVTAKSLHGAENANLSYEIPAGVA---NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLD-EGPNADLIYSITGGNLGNK--------FSIDSSSGELSARPL---DREQHSRYTLQIQASD-----RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYT------GSVQEDAPLGTSVVQISA----------VDADLGVNARLVYSLANETQWQFAIDGQSGLIT 2009          

HSP 8 Score: 108.227 bits (269), Expect = 3.323e-23
Identity = 158/672 (23.51%), Postives = 265/672 (39.43%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSC---FEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGS-----------------------LSIILEVEDINDNRPHFEE-STISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQST-LDYENKNIFEFRIIAKDQGTP-YLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLR-ETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRP--EIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQL---------NRDVIFEMLSLDGTKRRQRQN----DLFIIENNTGFIKTRVVL--------------DHEKDQHV----SFLVRVRNTNE----YVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE 2390
            G   P +    + + ++  ++N P F Q+  +  + ENV  G  ++   A+ L    +G +N  L  +   G     F V  +    R ++  + + DRE+ + + L V   D  + S   S                        +I + V D+NDN P F   S   LSV EN   G  I  +  +D D G N+ + Y+I             F I D  S +L +  LD E  + +  +I A D+G P        +T+ V + ND  P   L    GS+           E+ P   +++ I   D D  ++  L        V+ L  ET+    I+ +    +  + + DRE  + Y   +  +D       + +V +Q+ + D+NDN PIF    + G++       Q +      +Q  DAD+G N+ I Y L +A NS  S  F +N     +   + +  E  K     +VA D G P  ++   I + + +A    P     N+ Y   + E  P GT++ Q+VA  +D  +          N D I  + SL G  R  + +    D F   + +   + R +               +  + Q      SF +     NE     V       F +S   + +++ D NDNSPK + K+
Sbjct: 1694 GQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSL----HGAENANLSYEIPAGVANDLFHVDWQ----RGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSI-----TGGNLGNKFSI-DSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSV----------QEDAPLGTSVVQISAVDADLGVNARL--------VYSLANETQWQFAIDGQSGL-ITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLK----VQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQ 2326          

HSP 9 Score: 104.76 bits (260), Expect = 4.596e-22
Identity = 131/513 (25.54%), Postives = 216/513 (42.11%), Query Frame = 3
Query:  795 SCFEVKN-EPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS--LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI-------EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSS---FHFG------KIMETDLTDQDVHMTEGVIQVTDADI-GMNSRIKYHLKDALNSTDSQYFSVNSEYPQIK-NKEPIDYEKSKQFKFF--LVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQL-----NRDVIFEMLS-----LDGTKRRQRQNDLFIIENNTGFIKTRVVLDH 2234
            S F + N +P + R+VLV +T                     P       +++E+ED NDN P F +     +V E    G  + ++   DSD G+N+++ Y+I D       +   F I+   S  ++    LD E ++I++ +IIA D+G P +  TAT+ V++ ++ND  P            PN++ +T+ E       I  I   D D          ++P   + L     V+ IE   IF L             D E    Y + +  SD+   ++   +V    +++D NDN P+F +     +F       +I E+   D D+      +  TDAD  G NS++ Y ++ A      + FSV+     +  N   +    S    +F  ++A D GKPAL +ST + +  +D    R +     Y   + E  P+G+ + Q+   DA    L     N +  FE+L      L     R+R NDL+         K R+VL H
Sbjct: 2276 SSFALTNSQPNEIRVVLVARTA------------------DAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVD-----GNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF---------PPNNL-VTVSEATELGAVITSISANDVD----------TYPALTYRLGAESTVD-IENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTV----RVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLL----TVNATDADSEGNNSKVIYIIEPA-----QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-GQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRER-NDLY---------KLRLVLSH 2720          

HSP 10 Score: 91.2781 bits (225), Expect = 5.917e-18
Identity = 105/352 (29.83%), Postives = 170/352 (48.30%), Query Frame = 3
Query:  324 TVTENIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKN--SQPFSLSHGKLIVT--GPLDREKICS---PQTDQNLIQKCCESSCCM-------FIGITSPNRKINY--IRVNIEDENDNEPIF-PQSYIKIAVHENVEIG--HTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKP-SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQST--LDYENKNIFEFRIIAKDQGTPYLMSTATVTVR--VTNLNDEPP 1307
            T+ EN+P  S S +    L +T+  +  AE  N+ +       +  F +   + I+T  G  DRE   S   P   ++  ++   SS  +        IG TS  +  +   I + + D NDN P F P S   ++V EN E G  HT+V   A DLD      D    I+  + G+ F + +   +     +    +DRE +S + L + A DRG+P S+ G  +I + VED NDN P F+ S  + SV+E+   G  + +I   D+D+G N+++ Y++ + T   Q  F +    DG S  + +   LD E +  + F ++A D G  Y + +ATV V+  V ++ND  P
Sbjct: 1727 TILENVP--SGSFV----LQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV---ASDLDE-GPNADLIYSITGGNLGNKFSIDSSSGE-----LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANET---QWQFAI----DGQSGLITTVGKLDRELQASYNFMVLATDGGR-YEVRSATVPVQINVLDINDNRP 2055          

HSP 11 Score: 89.7373 bits (221), Expect = 1.522e-17
Identity = 150/640 (23.44%), Postives = 261/640 (40.78%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCG----SCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHF---------------EESTISLSVEENGRSGREIKRIKVTDSDI-GANSQMSYNIEDYTSQAQRYFKLFQIKDGISL---QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSN-----TISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD-QDVHMTEGVIQVTDADI--GMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEK-SKQFKFFLVAVDGGKPALTASTQ-ITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADT---DQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCL 2423
            IRV I D NDN+P FP + + + V E  E+G  I    A D+DT  Y    Y+L ++ +      S F +          LV K ++D E    + L V+A D    ++T    + + V D NDN P F                E + SLSV+       ++  +  TD+D  G NS++ Y IE     AQ  F +      +S+   +LQ  +   +   +  RIIAKD G P L S+  + V+  +      + L          N  +  + E  P    ++ +     D  L+ I              E     +++ K I  ++ L   DRE   +Y++ +  S  +     +    +  + + + I D NDN PIF  S  +    E ++++   +  +   +Q  DAD     NS + Y   D  +  D   F+++     +     +DY+  +K ++  + A D        S Q   + + D NDN P+     Y   + E +P+G+ + +  ASD D     QLN        S+      +    +F +++ +G + +  V D+E+ Q     +   +    +G K       +SVA+ V+I   ++ +P+   +    V  A   L
Sbjct: 2414 IRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGK----LVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVD------FDLLTVNATDADSEGNNSKVIYIIE----PAQEGFSVHPSNGVVSVNMSRLQPAV--SSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFL---------QNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGN-----------EESAFELLQSKAIVLVKPL---DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKY----EAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLN-------YSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD----MGGK------KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVAL 2984          

HSP 12 Score: 78.1814 bits (191), Expect = 4.520e-14
Identity = 142/613 (23.16%), Postives = 251/613 (40.95%), Query Frame = 3
Query:  618 VNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKI--DRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI-KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQT------IILIHVTDKDSKL--SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETD-LTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKP------ALTASTQITISVSDANDNRPEIGNKF-YTFSVLEEQPIGTKIGQIVASDADTDQL-NRDVIFEMLSLDGTKRRQRQND--LFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE 2390
            + +EDENDN P F Q      V E    G  +    A D D  S     Y ++ D +  + F +  EP  + +V   +T I  DRE   ++ L ++A D G P  TG+ +I +++ D+NDN+P F  + + ++V E    G  I  I   D D      ++Y +   ++       +F + +    L L+  LDYE +  +E  +IA D       +   +TVRV + ND  P  L         P +    LP      ++      ++ ++ TD DS+   S ++  +   ++ F +  +  V  +   +   LQ  +     ++  Y + I   D+     L  S  ++++ +D       F  + +  +I E   L    + + +  +  + A I  N    + L   L S              I   +P+D E++  +K  LV      P        ++   + I++ DANDN P       Y   + E  P+   I Q+ A DAD +   N +V++++ S          ND  +F I+  TG +     LD++     S+ + +R  + +           S     +++ D NDN PK  L E
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIV-DGNHDNAFVI--EPAFSGIV---RTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQ------PPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSR---LQPAV----SSSGDYFVRIIAKDAGK-PALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFEL---LQSK------------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITS---------GNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRP-----LCSLQPFRLELHDENDNEPKFPLTE 2866          

HSP 13 Score: 75.0998 bits (183), Expect = 4.791e-13
Identity = 115/474 (24.26%), Postives = 194/474 (40.93%), Query Frame = 3
Query: 1350 SIQLTLPENGPKHQTIILIHVTDKD-----SKLSDILCEVSHPKDVFYL---RETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYT----FSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLA--LKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN-----FSLDMGHNLICLKNLHL---SPGYFTVSVIGQDRNGGNGSRRAECLINIH 2699
            S+ +  PEN P+     L+   D D     ++  +I+    +  D F L   RE + V         +LQ     DRETT  Y + I   D  T   L   + + + I DVNDN PIF+ S +F  + E      +  +   V+QV  +D D   N  ++Y + +   S   Q F ++     I   + +D+E  +  +  +VA D G+  L  +  ++I V+D NDN+P I   F +      + E    G  + +I   D D+     +V   +   DG         L   +N+   +   + LD E   + +  V        V T        +S +I ++I D+NDN P+    L  + ++E A               D  +++     +   D DEGLN+ +  +L E P      F +D    LI  ++ H+   +     ++V+ +D      S  A  L+ IH
Sbjct:  178 SMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVS--GNVNDAFRLSSHRERDGV------LYLDLQISGFLDRETTPGYSLLIEALDGGT-PPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPE------NATVGTSVLQVYASDTDADENGLVEYAI-NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDG------HFALTTRDNSIYLVIVHLPLDREIVSNYTLSV--------VATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVA---------------DPGTSVLQVLAH---DRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRS-HIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIH 602          

HSP 14 Score: 70.4774 bits (171), Expect = 1.112e-11
Identity = 114/539 (21.15%), Postives = 227/539 (42.12%), Query Frame = 3
Query:  597 RKINYIRVNIEDENDNEPIF----PQSYIKI-----AVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISD-KSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLV--LAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRII-AKDQGTPYLMSTAT-----VTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL---SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDS-QYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD-GGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQ---PIGTKIGQIVASDADTDQLNRDVIFEM 2135
            R +  +RVN  DENDN P+F    P +Y  I      + E++ +   ++   A D D+     +N K+I   +     F V      N +V V  +++    +S  +  V  +A D GKP+   S  + ++  D    R  F ++     + E    G  + ++            +  ++       +  F+L Q K   ++ L   LD E  ++++ R++ +   G P + S  +     V + + + ND  P    ++R +       +  + E  P   +I  +   D D +    S+++ +++   D         ++++    +  + N +++D    S Y + I   DS+    L      ++++ D NDN P F  + +   + E +     V         +D D G   ++ Y +  A +   S + F V+SE   + +    DYE+ +++   L+A D GGK    AS  + + +   ++  P+   + Y F VL      P G  +GQ+ A+D+D+    R V++++
Sbjct: 2515 RTVLTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEG---NNSKVIYIIEPAQEGFSVH---PSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL--------GQDALDQSLAIIAGNEESAFELLQSK---AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP---IFDRSA-----KYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMF----TIDLV--TGVLFVNNRLDYDSGAKS-YELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRA----HASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGK---KASVAVRVEIESRDEFTPQFTERTYRF-VLPAAVALPQGYVVGQVTATDSDSGPDGR-VVYQL 3010          

HSP 15 Score: 68.1662 bits (165), Expect = 6.100e-11
Identity = 67/248 (27.02%), Postives = 107/248 (43.15%), Query Frame = 3
Query:  462 LSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKL---ISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEEST--ISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLD 1190
            L  G L V   LD +   S      LI + C+S          P   +   R+ + DENDNEP FP +     + EN  +G ++    A DLD   +G  NY +    SD+S    F V +E        VF    D E    +++ +LA D G   K  S+++ +E+E  ++  P F E T    L        G  + ++  TDSD G + ++ Y +    S    +FK+ +    + ++ +  LD
Sbjct: 2807 LVTGVLFVNNRLDYD---SGAKSYELIIRACDSHH------QRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVF----DYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL----SAPHSHFKVNRSSGAVLIKRKLKLD 3035          

HSP 16 Score: 61.2326 bits (147), Expect = 7.756e-9
Identity = 67/261 (25.67%), Postives = 115/261 (44.06%), Query Frame = 3
Query: 1821 NSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENN-TGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFP-YTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLK 2597
            NST SQ    +S +  + N +P       + +  LVA     P L +  ++ I + D NDN P+   K +  +V E    GT + Q+ A D+D     R        +DG       ++ F+IE   +G ++T +VLD E        +R     + + T + +   + +  I V+I+D+NDN P       + V +A     ++   +IT+  I++N    +P  T+      L AE  V ++    F+LD     + LK
Sbjct: 2265 NSTRSQRALTSSSF-ALTNSQP------NEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNAR---LRYHIVDGN-----HDNAFVIEPAFSGIVRTNIVLDRE--------IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEA-----TELGAVITS--ISANDVDTYPALTYR-----LGAESTVDIENMSIFALDRYSGKLVLK 2490          

HSP 17 Score: 53.5286 bits (127), Expect = 1.605e-6
Identity = 76/312 (24.36%), Postives = 134/312 (42.95%), Query Frame = 3
Query:  618 VNIEDENDNEPIFPQSY-IKIAVHENVEIGHTIVLPKAEDLD---TPSYGIDNYKLISDKSCGS---CFEVKNEPKDNRLVLVFKTKIDRETNS-VFNLLVLAIDRGKPSKTGSLSII-LEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQS-TLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRG-SIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKK 1517
            + I D NDN PIF +S   +  + E   + ++I   +A D D   TP     N +++ D + G+    F +         VL    ++D ++ +  + L++ A D        SL    LE+ D NDN P F  +     + EN   G  + R   +D D G   Q++Y+I    S  +  +K+F++     L   +   DYE +  ++  ++A D G       A+V VRV   + +     F  R    V P ++ L      P+   +  +  TD DS     ++ ++S P   F +  +    +I++K
Sbjct: 2740 ITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTP-----NSEVVYDITSGNDEHMFTIDLVTG----VLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSD-ESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG----KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVAL------PQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRK 3031          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 189.504 bits (480), Expect = 5.067e-48
Identity = 175/648 (27.01%), Postives = 298/648 (45.99%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIG---HTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKD----ALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL-KESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            ++V + D+NDN P F +    + V E+   G   +T+   +A D D  +     Y +I   +  S F + +   D  LV      +D E+   + L++ A D G PS++ +  +++ V D NDN P F  S    SV EN   G  I R++  DSD GAN++++Y+I    S+    F L        +Q    LD E +  F F+++AKD G P   ++++V + V ++ND  P           +P   +  + E+ P    +  +  TD D   S +  E++        R    +     + +  +   +++ +E    + +T+  +DS   S    +  + + I D N+  PIF ++ +   + E    D  V  T  V+  TD+D+G+N++I Y L +     L S D   FS+N +   I    P+D E +  +   + A DGG P+L+ +T + I V+D NDN P   +  Y  S+LE+  +GT + Q+ ASD D   LN  + + +LS      R  ++  F+I+  +G I+T   LD E        V V +       K      SS+V + +++ D+ND+ P  A  K +L V +         P+     +I ++          D DEG+NA V
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT-QSQFSIDSMSGDVSLV----KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---------NPKYYEANVGEDQPPGTPVTTVTATDPDED-SRLHYEITTGN----TRGRFAITSQNGRGLITIAQSLDYKQEKR--FLLTVAATDSGGRSD---TATVHINITDANNFAPIFENAPYSASVFE----DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKY-LLS-----DRDIEDGSFVIDPTSGTIRTNKGLDRES-------VAVFHLTAIAVDKGSPPL-SSTVEVQIRLEDVNDSPPTFASDKITLYVPE-------NSPVGSVVGEIHAH----------DPDEGVNAVV 1148          

HSP 2 Score: 180.644 bits (457), Expect = 2.263e-45
Identity = 166/620 (26.77%), Postives = 278/620 (44.84%), Query Frame = 3
Query:  588 SPNRK-INYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPS-----YGI----DNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNL-------IEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVV----LDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            SP+R     + VN+ D NDN P F  S  + +V ENV +G+ I+  +A D D  +     Y I    DN+ L  D   G    +K               +DRE    F   V+A D G P K+ S S+++ V+D+NDN P F       +V E+   G  +  +  TD D   +S++ Y I    ++  R+    Q   G+ + +  +LDY+ +  F   + A D G      TATV + +T+ N+  P         I +      ++ E+ P   T++++  TD D  ++           + Y    E++N +     F +             DRETTS Y +T+T  D    S L+ + ++++ + DVNDN P F S  +   I+E      D  +   VIQV  +D D+G+N RIKY L D     +   F ++     I+  + +D E    F    +AVD G P L+++ ++ I + D ND+ P   +   T  V E  P+G+ +G+I A D D + +N  V + ++  D        ++ F +    G  + +++    LD+E  +   F + VR  +  +          +   I + + D+NDN+P L
Sbjct:  666 SPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK--------------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRG-RFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP---------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN---------AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS-LSDTTDVEIGVTDVNDNAPAFKSPLYQASILE------DALVGTSVIQVAASDPDVGLNGRIKYLLSD--RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGD-------DSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPL---------RNDAHIEILVTDVNDNAPVL 1220          

HSP 3 Score: 170.244 bits (430), Expect = 4.385e-42
Identity = 176/662 (26.59%), Postives = 284/662 (42.90%), Query Frame = 3
Query:  591 PNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTP-----SYGI----DNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPS---KTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGRE---IKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQ--IKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEM--LSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP--KLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDAD 2510
            P      ++VN+ D ND+ P F     + ++ E   +G T++  +A D D        YGI    D   L  D+     F + +       V+  ++ +DRET+  ++LLV A D        +T + S+ ++V D NDN P F E T ++ V E+   G E   +  I+ TD+D G N+ + Y I    +Q+Q  F +  +   +S  L   LDYE+   +   I A+D G+P   +T  + V V + ND  P   FY        +  Q ++ EN P    II +   D D    ++I   +S   D F L        +        Q +   DRE    +   +   D     K + S  + + + DVNDN P F+  ++   + E    DQ        +  TD D   +SR+ Y +           F++ S+  +  I   + +DY++ K+F   + A D G  + TA+  I I  +DAN+  P   N  Y+ SV E+ P+GT +  + A+D+D   +N  + + +   S++G        D F I   TG I T   LD E        V  ++     G    L   S +  + + + D+NDN+P  K  L ++ I+E A   L     I +  SD    L     Y   D D
Sbjct:  443 PRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEM-PIFRIDSRSG----VISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ--FSIDSMSGDVS--LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR--FYT-------SQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWV--------QTIKPLDREEQGRFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPAFNPKYYEANVGE----DQPPGTPVTTVTATDPD--EDSRLHYEIT---TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI--TDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG-VNAQITYSLNEESINGLG----SPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKD-----GGNPSL---SDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 159.844 bits (403), Expect = 5.995e-39
Identity = 170/663 (25.64%), Postives = 294/663 (44.34%), Query Frame = 3
Query:  615 RVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDL-DTPSYGIDNYKLIS--DKSCGSCFEVKNEPKDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQA----QRYFKLFQI--KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPY---LMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPEN---GPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQA--GSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKE 2549
            RV  E  N + P F Q+    +V E    G  +   +A D  D+P      Y ++S  D    S F+V     D+R  V+     +DRE   V    V+A D   P ++G+ ++ + V D ND+ P FE      S+ E    G  +  ++ TD DIG N+++ Y IE  T  A     +   +F+I  + G+ +  +S+LD E  + +   + A D  +       +TA+V V+V + ND  P+  F  R       +  + +PE+   G +  T+  I  TD D   +  +      +       T++   I+     ++  +   D E+   YR+ I   D  + S+ + + ++ + + D NDN P F +S    +  E+ L +  V      +Q  D+D G N+ I Y + +     D+   +V+     ++  +P+D E+  +F F +VA DGG P  +AS+ + I+V D NDN P    K+Y  +V E+QP GT +  + A+D D D          L  + T    R       +N  G I     LD+++++   FL+ V  T+   G +      S +  + + I D N+ +P        I E A   + +    P+  T   +++           D+D G+NA++  +L E
Sbjct:  347 RVRRELRNQS-PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVV----YSMVSLLDSRSQSLFKV-----DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV-ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSER-------TYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAI------RYAIIGGNTQSQFSIDSMS-GDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAPRFYTS----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--------SRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKR--FLLTVAATDS--GGR------SDTATVHINITDANNFAP--------IFENAPYSASVFEDAPVGTTVLVVSAT----------DSDVGVNAQITYSLNE 938          

HSP 5 Score: 144.436 bits (363), Expect = 2.826e-34
Identity = 136/522 (26.05%), Postives = 239/522 (45.79%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGI-SLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSV----NSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDAD-TDQLNRDVI 2126
            G   P    + + + ++D NDN+P F   Y +  V E+   G  +    A D D  S    +Y++ +  + G  F + ++  + R ++     +D +    F L V A D G  S T ++ I   + D N+  P FE +  S SV E+   G  +  +  TDSD+G N+Q++Y++ + +         F I     ++   + LD E  + +   + AKD G P L  T  V + VT++ND  P        +   P   Q ++ E+     ++I +  +D D  L+  +      K +   R+ E+ + +       ++     DRE+ +++ +T    D  +   L+ +VE+Q++++DVND+PP F+S     KI      +  V    G I   D D G+N+ + Y +   +   DS  FS+     SE  Q+     +DYE ++  K F + V    P L     I I V+D NDN P + +    F+   +     +IG+I A DAD +D+L+  ++
Sbjct:  769 GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR--LHYEITTGNTRGR-FAITSQ--NGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHI--NITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAP--------AFKSP-LYQASILEDALVGTSVIQVAASDPDVGLNGRI------KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTFASD----KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI---IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTR--KRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRIL 1258          

HSP 6 Score: 85.5001 bits (210), Expect = 2.800e-16
Identity = 92/350 (26.29%), Postives = 150/350 (42.86%), Query Frame = 3
Query:  327 VTENIPYPSSSLID--VGHLLLTSSLISQAEKDNIYFTDRKNSQ---------PFSLS--HGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVL-----VFKT--KIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQL--QSTLDYEN-KNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP 1307
            + EN PY +S   D  VG  +L  S        N   T   N +         PFS++   G ++   PLDRE      T   L+    +      +  T+       + + + D NDN P F     + ++ E+  +G +++   A D D    G   Y L+SD+            +D   V+       +T   +DRE+ +VF+L  +A+D+G P  + ++ + + +ED+ND+ P F    I+L V EN   G  +  I   D D G N+ + Y+I          F L         QL   + LDYE+ +  FE  + A    +P L + A + + VT++ND  P
Sbjct:  896 IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRET-----TSGYLLTVTAKDGGNPSLSDTTD------VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDI----------EDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 7 Score: 54.6842 bits (130), Expect = 7.654e-7
Identity = 52/200 (26.00%), Postives = 84/200 (42.00%), Query Frame = 3
Query: 2007 PEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHE-KDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE-SLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKN 2600
            P      Y  SVLEEQP G  +  + A D +    +  V++ M+SL  +    R   LF +++ TG + T   LD E  D H     RV      V T D     S +  + V ++D ND+SP    ++    + +  +  S+   +  T  DI  N   E+    +    GL  +     +E P F +D    +I  ++
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPE----DSPVVYSMVSLLDS----RSQSLFKVDSRTGVVTTSASLDRELMDVH---YFRV------VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQD-----QEMPIFRIDSRSGVISTRS 534          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 189.119 bits (479), Expect = 5.846e-48
Identity = 175/648 (27.01%), Postives = 298/648 (45.99%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIG---HTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKD----ALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL-KESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            ++V + D+NDN P F +    + V E+   G   +T+   +A D D  +     Y +I   +  S F + +   D  LV      +D E+   + L++ A D G PS++ +  +++ V D NDN P F  S    SV EN   G  I R++  DSD GAN++++Y+I    S+    F L        +Q    LD E +  F F+++AKD G P   ++++V + V ++ND  P           +P   +  + E+ P    +  +  TD D   S +  E++        R    +     + +  +   +++ +E    + +T+  +DS   S    +  + + I D N+  PIF ++ +   + E    D  V  T  V+  TD+D+G+N++I Y L +     L S D   FS+N +   I    P+D E +  +   + A DGG P+L+ +T + I V+D NDN P   +  Y  S+LE+  +GT + Q+ ASD D   LN  + + +LS      R  ++  F+I+  +G I+T   LD E        V V +       K      SS+V + +++ D+ND+ P  A  K +L V +         P+     +I ++          D DEG+NA V
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT-QSQFSIDSMSGDVSLV----KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---------NPKYYEANVGEDQPPGTPVTTVTATDPDED-SRLHYEITTGN----TRGRFAITSQNGRGLITIAQSLDYKQEKR--FLLTVAATDSGGRSD---TATVHINITDANNFAPIFENAPYSASVFE----DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKY-LLS-----DRDIEDGSFVIDPTSGTIRTNKGLDRES-------VAVFHLTAIAVDKGSPPL-SSTVEVQIRLEDVNDSPPTFASDKITLYVPE-------NSPVGSVVGEIHAH----------DPDEGVNAVV 1148          

HSP 2 Score: 180.644 bits (457), Expect = 2.480e-45
Identity = 166/620 (26.77%), Postives = 278/620 (44.84%), Query Frame = 3
Query:  588 SPNRK-INYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPS-----YGI----DNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNL-------IEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVV----LDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            SP+R     + VN+ D NDN P F  S  + +V ENV +G+ I+  +A D D  +     Y I    DN+ L  D   G    +K               +DRE    F   V+A D G P K+ S S+++ V+D+NDN P F       +V E+   G  +  +  TD D   +S++ Y I    ++  R+    Q   G+ + +  +LDY+ +  F   + A D G      TATV + +T+ N+  P         I +      ++ E+ P   T++++  TD D  ++           + Y    E++N +     F +             DRETTS Y +T+T  D    S L+ + ++++ + DVNDN P F S  +   I+E      D  +   VIQV  +D D+G+N RIKY L D     +   F ++     I+  + +D E    F    +AVD G P L+++ ++ I + D ND+ P   +   T  V E  P+G+ +G+I A D D + +N  V + ++  D        ++ F +    G  + +++    LD+E  +   F + VR  +  +          +   I + + D+NDN+P L
Sbjct:  666 SPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK--------------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRG-RFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP---------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN---------AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS-LSDTTDVEIGVTDVNDNAPAFKSPLYQASILE------DALVGTSVIQVAASDPDVGLNGRIKYLLSD--RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGD-------DSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPL---------RNDAHIEILVTDVNDNAPVL 1220          

HSP 3 Score: 169.859 bits (429), Expect = 4.846e-42
Identity = 176/662 (26.59%), Postives = 284/662 (42.90%), Query Frame = 3
Query:  591 PNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTP-----SYGI----DNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPS---KTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGRE---IKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQ--IKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEM--LSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP--KLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDAD 2510
            P      ++VN+ D ND+ P F     + ++ E   +G T++  +A D D        YGI    D   L  D+     F + +       V+  ++ +DRET+  ++LLV A D        +T + S+ ++V D NDN P F E T ++ V E+   G E   +  I+ TD+D G N+ + Y I    +Q+Q  F +  +   +S  L   LDYE+   +   I A+D G+P   +T  + V V + ND  P   FY        +  Q ++ EN P    II +   D D    ++I   +S   D F L        +        Q +   DRE    +   +   D     K + S  + + + DVNDN P F+  ++   + E    DQ        +  TD D   +SR+ Y +           F++ S+  +  I   + +DY++ K+F   + A D G  + TA+  I I  +DAN+  P   N  Y+ SV E+ P+GT +  + A+D+D   +N  + + +   S++G        D F I   TG I T   LD E        V  ++     G    L   S +  + + + D+NDN+P  K  L ++ I+E A   L     I +  SD    L     Y   D D
Sbjct:  443 PRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEM-PIFRIDSRSG----VISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ--FSIDSMSGDVS--LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR--FYT-------SQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWV--------QTIKPLDREEQGRFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPAFNPKYYEANVGE----DQPPGTPVTTVTATDPD--EDSRLHYEIT---TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI--TDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG-VNAQITYSLNEESINGLG----SPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKD-----GGNPSL---SDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 159.844 bits (403), Expect = 6.796e-39
Identity = 170/663 (25.64%), Postives = 294/663 (44.34%), Query Frame = 3
Query:  615 RVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDL-DTPSYGIDNYKLIS--DKSCGSCFEVKNEPKDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQA----QRYFKLFQI--KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPY---LMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPEN---GPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQA--GSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKE 2549
            RV  E  N + P F Q+    +V E    G  +   +A D  D+P      Y ++S  D    S F+V     D+R  V+     +DRE   V    V+A D   P ++G+ ++ + V D ND+ P FE      S+ E    G  +  ++ TD DIG N+++ Y IE  T  A     +   +F+I  + G+ +  +S+LD E  + +   + A D  +       +TA+V V+V + ND  P+  F  R       +  + +PE+   G +  T+  I  TD D   +  +      +       T++   I+     ++  +   D E+   YR+ I   D  + S+ + + ++ + + D NDN P F +S    +  E+ L +  V      +Q  D+D G N+ I Y + +     D+   +V+     ++  +P+D E+  +F F +VA DGG P  +AS+ + I+V D NDN P    K+Y  +V E+QP GT +  + A+D D D          L  + T    R       +N  G I     LD+++++   FL+ V  T+   G +      S +  + + I D N+ +P        I E A   + +    P+  T   +++           D+D G+NA++  +L E
Sbjct:  347 RVRRELRNQS-PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVV----YSMVSLLDSRSQSLFKV-----DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV-ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSER-------TYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAI------RYAIIGGNTQSQFSIDSMS-GDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAPRFYTS----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--------SRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKR--FLLTVAATDS--GGR------SDTATVHINITDANNFAP--------IFENAPYSASVFEDAPVGTTVLVVSAT----------DSDVGVNAQITYSLNE 938          

HSP 5 Score: 144.436 bits (363), Expect = 2.821e-34
Identity = 136/522 (26.05%), Postives = 239/522 (45.79%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGI-SLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSV----NSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDAD-TDQLNRDVI 2126
            G   P    + + + ++D NDN+P F   Y +  V E+   G  +    A D D  S    +Y++ +  + G  F + ++  + R ++     +D +    F L V A D G  S T ++ I   + D N+  P FE +  S SV E+   G  +  +  TDSD+G N+Q++Y++ + +         F I     ++   + LD E  + +   + AKD G P L  T  V + VT++ND  P        +   P   Q ++ E+     ++I +  +D D  L+  +      K +   R+ E+ + +       ++     DRE+ +++ +T    D  +   L+ +VE+Q++++DVND+PP F+S     KI      +  V    G I   D D G+N+ + Y +   +   DS  FS+     SE  Q+     +DYE ++  K F + V    P L     I I V+D NDN P + +    F+   +     +IG+I A DAD +D+L+  ++
Sbjct:  769 GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR--LHYEITTGNTRGR-FAITSQ--NGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHI--NITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAP--------AFKSP-LYQASILEDALVGTSVIQVAASDPDVGLNGRI------KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTFASD----KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI---IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTR--KRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRIL 1258          

HSP 6 Score: 85.5001 bits (210), Expect = 3.256e-16
Identity = 92/350 (26.29%), Postives = 150/350 (42.86%), Query Frame = 3
Query:  327 VTENIPYPSSSLID--VGHLLLTSSLISQAEKDNIYFTDRKNSQ---------PFSLS--HGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVL-----VFKT--KIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQL--QSTLDYEN-KNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP 1307
            + EN PY +S   D  VG  +L  S        N   T   N +         PFS++   G ++   PLDRE      T   L+    +      +  T+       + + + D NDN P F     + ++ E+  +G +++   A D D    G   Y L+SD+            +D   V+       +T   +DRE+ +VF+L  +A+D+G P  + ++ + + +ED+ND+ P F    I+L V EN   G  +  I   D D G N+ + Y+I          F L         QL   + LDYE+ +  FE  + A    +P L + A + + VT++ND  P
Sbjct:  896 IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRET-----TSGYLLTVTAKDGGNPSLSDTTD------VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDI----------EDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 7 Score: 54.299 bits (129), Expect = 8.393e-7
Identity = 52/200 (26.00%), Postives = 84/200 (42.00%), Query Frame = 3
Query: 2007 PEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHE-KDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE-SLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKN 2600
            P      Y  SVLEEQP G  +  + A D +    +  V++ M+SL  +    R   LF +++ TG + T   LD E  D H     RV      V T D     S +  + V ++D ND+SP    ++    + +  +  S+   +  T  DI  N   E+    +    GL  +     +E P F +D    +I  ++
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPE----DSPVVYSMVSLLDS----RSQSLFKVDSRTGVVTTSASLDRELMDVH---YFRV------VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQD-----QEMPIFRIDSRSGVISTRS 534          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 189.119 bits (479), Expect = 5.846e-48
Identity = 175/648 (27.01%), Postives = 298/648 (45.99%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIG---HTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKD----ALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL-KESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            ++V + D+NDN P F +    + V E+   G   +T+   +A D D  +     Y +I   +  S F + +   D  LV      +D E+   + L++ A D G PS++ +  +++ V D NDN P F  S    SV EN   G  I R++  DSD GAN++++Y+I    S+    F L        +Q    LD E +  F F+++AKD G P   ++++V + V ++ND  P           +P   +  + E+ P    +  +  TD D   S +  E++        R    +     + +  +   +++ +E    + +T+  +DS   S    +  + + I D N+  PIF ++ +   + E    D  V  T  V+  TD+D+G+N++I Y L +     L S D   FS+N +   I    P+D E +  +   + A DGG P+L+ +T + I V+D NDN P   +  Y  S+LE+  +GT + Q+ ASD D   LN  + + +LS      R  ++  F+I+  +G I+T   LD E        V V +       K      SS+V + +++ D+ND+ P  A  K +L V +         P+     +I ++          D DEG+NA V
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT-QSQFSIDSMSGDVSLV----KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---------NPKYYEANVGEDQPPGTPVTTVTATDPDED-SRLHYEITTGN----TRGRFAITSQNGRGLITIAQSLDYKQEKR--FLLTVAATDSGGRSD---TATVHINITDANNFAPIFENAPYSASVFE----DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKY-LLS-----DRDIEDGSFVIDPTSGTIRTNKGLDRES-------VAVFHLTAIAVDKGSPPL-SSTVEVQIRLEDVNDSPPTFASDKITLYVPE-------NSPVGSVVGEIHAH----------DPDEGVNAVV 1148          

HSP 2 Score: 180.644 bits (457), Expect = 2.480e-45
Identity = 166/620 (26.77%), Postives = 278/620 (44.84%), Query Frame = 3
Query:  588 SPNRK-INYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPS-----YGI----DNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNL-------IEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVV----LDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            SP+R     + VN+ D NDN P F  S  + +V ENV +G+ I+  +A D D  +     Y I    DN+ L  D   G    +K               +DRE    F   V+A D G P K+ S S+++ V+D+NDN P F       +V E+   G  +  +  TD D   +S++ Y I    ++  R+    Q   G+ + +  +LDY+ +  F   + A D G      TATV + +T+ N+  P         I +      ++ E+ P   T++++  TD D  ++           + Y    E++N +     F +             DRETTS Y +T+T  D    S L+ + ++++ + DVNDN P F S  +   I+E      D  +   VIQV  +D D+G+N RIKY L D     +   F ++     I+  + +D E    F    +AVD G P L+++ ++ I + D ND+ P   +   T  V E  P+G+ +G+I A D D + +N  V + ++  D        ++ F +    G  + +++    LD+E  +   F + VR  +  +          +   I + + D+NDN+P L
Sbjct:  666 SPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK--------------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRG-RFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP---------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN---------AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS-LSDTTDVEIGVTDVNDNAPAFKSPLYQASILE------DALVGTSVIQVAASDPDVGLNGRIKYLLSD--RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGD-------DSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPL---------RNDAHIEILVTDVNDNAPVL 1220          

HSP 3 Score: 169.859 bits (429), Expect = 4.846e-42
Identity = 176/662 (26.59%), Postives = 284/662 (42.90%), Query Frame = 3
Query:  591 PNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTP-----SYGI----DNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPS---KTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGRE---IKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQ--IKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEM--LSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP--KLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDAD 2510
            P      ++VN+ D ND+ P F     + ++ E   +G T++  +A D D        YGI    D   L  D+     F + +       V+  ++ +DRET+  ++LLV A D        +T + S+ ++V D NDN P F E T ++ V E+   G E   +  I+ TD+D G N+ + Y I    +Q+Q  F +  +   +S  L   LDYE+   +   I A+D G+P   +T  + V V + ND  P   FY        +  Q ++ EN P    II +   D D    ++I   +S   D F L        +        Q +   DRE    +   +   D     K + S  + + + DVNDN P F+  ++   + E    DQ        +  TD D   +SR+ Y +           F++ S+  +  I   + +DY++ K+F   + A D G  + TA+  I I  +DAN+  P   N  Y+ SV E+ P+GT +  + A+D+D   +N  + + +   S++G        D F I   TG I T   LD E        V  ++     G    L   S +  + + + D+NDN+P  K  L ++ I+E A   L     I +  SD    L     Y   D D
Sbjct:  443 PRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEM-PIFRIDSRSG----VISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ--FSIDSMSGDVS--LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR--FYT-------SQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWV--------QTIKPLDREEQGRFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPAFNPKYYEANVGE----DQPPGTPVTTVTATDPD--EDSRLHYEIT---TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI--TDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG-VNAQITYSLNEESINGLG----SPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKD-----GGNPSL---SDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 159.844 bits (403), Expect = 6.796e-39
Identity = 170/663 (25.64%), Postives = 294/663 (44.34%), Query Frame = 3
Query:  615 RVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDL-DTPSYGIDNYKLIS--DKSCGSCFEVKNEPKDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQA----QRYFKLFQI--KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPY---LMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPEN---GPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQA--GSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKE 2549
            RV  E  N + P F Q+    +V E    G  +   +A D  D+P      Y ++S  D    S F+V     D+R  V+     +DRE   V    V+A D   P ++G+ ++ + V D ND+ P FE      S+ E    G  +  ++ TD DIG N+++ Y IE  T  A     +   +F+I  + G+ +  +S+LD E  + +   + A D  +       +TA+V V+V + ND  P+  F  R       +  + +PE+   G +  T+  I  TD D   +  +      +       T++   I+     ++  +   D E+   YR+ I   D  + S+ + + ++ + + D NDN P F +S    +  E+ L +  V      +Q  D+D G N+ I Y + +     D+   +V+     ++  +P+D E+  +F F +VA DGG P  +AS+ + I+V D NDN P    K+Y  +V E+QP GT +  + A+D D D          L  + T    R       +N  G I     LD+++++   FL+ V  T+   G +      S +  + + I D N+ +P        I E A   + +    P+  T   +++           D+D G+NA++  +L E
Sbjct:  347 RVRRELRNQS-PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVV----YSMVSLLDSRSQSLFKV-----DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV-ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSER-------TYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAI------RYAIIGGNTQSQFSIDSMS-GDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAPRFYTS----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--------SRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKR--FLLTVAATDS--GGR------SDTATVHINITDANNFAP--------IFENAPYSASVFEDAPVGTTVLVVSAT----------DSDVGVNAQITYSLNE 938          

HSP 5 Score: 144.436 bits (363), Expect = 2.821e-34
Identity = 136/522 (26.05%), Postives = 239/522 (45.79%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGI-SLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSV----NSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDAD-TDQLNRDVI 2126
            G   P    + + + ++D NDN+P F   Y +  V E+   G  +    A D D  S    +Y++ +  + G  F + ++  + R ++     +D +    F L V A D G  S T ++ I   + D N+  P FE +  S SV E+   G  +  +  TDSD+G N+Q++Y++ + +         F I     ++   + LD E  + +   + AKD G P L  T  V + VT++ND  P        +   P   Q ++ E+     ++I +  +D D  L+  +      K +   R+ E+ + +       ++     DRE+ +++ +T    D  +   L+ +VE+Q++++DVND+PP F+S     KI      +  V    G I   D D G+N+ + Y +   +   DS  FS+     SE  Q+     +DYE ++  K F + V    P L     I I V+D NDN P + +    F+   +     +IG+I A DAD +D+L+  ++
Sbjct:  769 GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR--LHYEITTGNTRGR-FAITSQ--NGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHI--NITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAP--------AFKSP-LYQASILEDALVGTSVIQVAASDPDVGLNGRI------KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTFASD----KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI---IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTR--KRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRIL 1258          

HSP 6 Score: 85.5001 bits (210), Expect = 3.256e-16
Identity = 92/350 (26.29%), Postives = 150/350 (42.86%), Query Frame = 3
Query:  327 VTENIPYPSSSLID--VGHLLLTSSLISQAEKDNIYFTDRKNSQ---------PFSLS--HGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVL-----VFKT--KIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQL--QSTLDYEN-KNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP 1307
            + EN PY +S   D  VG  +L  S        N   T   N +         PFS++   G ++   PLDRE      T   L+    +      +  T+       + + + D NDN P F     + ++ E+  +G +++   A D D    G   Y L+SD+            +D   V+       +T   +DRE+ +VF+L  +A+D+G P  + ++ + + +ED+ND+ P F    I+L V EN   G  +  I   D D G N+ + Y+I          F L         QL   + LDYE+ +  FE  + A    +P L + A + + VT++ND  P
Sbjct:  896 IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRET-----TSGYLLTVTAKDGGNPSLSDTTD------VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDI----------EDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 7 Score: 54.299 bits (129), Expect = 8.393e-7
Identity = 52/200 (26.00%), Postives = 84/200 (42.00%), Query Frame = 3
Query: 2007 PEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHE-KDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE-SLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKN 2600
            P      Y  SVLEEQP G  +  + A D +    +  V++ M+SL  +    R   LF +++ TG + T   LD E  D H     RV      V T D     S +  + V ++D ND+SP    ++    + +  +  S+   +  T  DI  N   E+    +    GL  +     +E P F +D    +I  ++
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPE----DSPVVYSMVSLLDS----RSQSLFKVDSRTGVVTTSASLDRELMDVH---YFRV------VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQD-----QEMPIFRIDSRSGVISTRS 534          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 243.432 bits (620), Expect = 5.890e-66
Identity = 202/693 (29.15%), Postives = 332/693 (47.91%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGIT-SPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            +DREK+C   + +       +S C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT    +  Y+L++ +S      V+    +    L+ +  +DRE    + + V   D G P K+ +  + + V D+NDNRP F+ES I + + EN   G  + +++ TD+D+GAN+++ Y      S A R         G+ + +Q  LD E   I +  ++A D  +    + AT+T+ VT++ND  P I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       +ME +L D    M    I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G  AL +   + +++ D NDN P+  +  + F V E  P  + +G I  +DAD  + N  V   +L+          N+ FI++ ++G IK+ V  D E+    +F VR  +              SS+  +T+ +ID+NDN+P        IV    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+
Sbjct:   92 IDREKLCPGPSFE-------DSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGL-ITVQRPLDREETAIHKLTVLASDGSSS--PARATITINVTDVNDNAPNIDLRY----IISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD----MFLTTISATDEDSGRNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILN---------DNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPP--------CSSAAKVTINVIDVNDNTP--------IVIYPPSNTSFK---LVPLSAIPGSVVAEV--FAVDGDTGMNAELKYTI 716          

HSP 2 Score: 98.5969 bits (244), Expect = 2.816e-20
Identity = 107/421 (25.42%), Postives = 180/421 (42.76%), Query Frame = 3
Query: 1353 IQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY------TFSVLEEQPIGTKIGQIVASDADTDQ-------LNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTF--LDADEGLNAEVVVTLKENPNF 2561
            I +++PEN   +    +   TD D+  + +     H  ++   +    ++I+E  +  +   LI     DRE    Y + +   D     K + ++ +Q+ + DVNDN P+F  S     I E    +  V  +   +Q TDAD+G N+ IKY     ++    + F++N+    I  + P+D E++   K  ++A DG      A+  ITI+V+D NDN P I  ++       T  + E+ PI TKI  I  SD DTD        + +DV F + +               + +N   ++T  +LD+E  +   F +        V +       + +  + V++ D NDN P        I  Q           +I  + + +NL   F  T    D D G NAE+V  L  N +F
Sbjct:  146 INISIPENTLINSRFAIPSATDPDTGPNSV-----HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAI-LQVTVTDVNDNRPVFKESQIEVHIPE----NSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKA---------------VYDNQYLLETSALLDYEGTKEYIFKI--------VASDSGKPSLNQTALVRVRLEDENDNPP--------IFTQP----------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF 513          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 243.817 bits (621), Expect = 6.606e-66
Identity = 202/693 (29.15%), Postives = 332/693 (47.91%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGIT-SPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            +DREK+C   + +       +S C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT    +  Y+L++ +S      V+    +    L+ +  +DRE    + + V   D G P K+ +  + + V D+NDNRP F+ES I + + EN   G  + +++ TD+D+GAN+++ Y      S A R         G+ + +Q  LD E   I +  ++A D  +    + AT+T+ VT++ND  P I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       +ME +L D    M    I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G  AL +   + +++ D NDN P+  +  + F V E  P  + +G I  +DAD  + N  V   +L+          N+ FI++ ++G IK+ V  D E+    +F VR  +              SS+  +T+ +ID+NDN+P        IV    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+
Sbjct:   92 IDREKLCPGPSFE-------DSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGL-ITVQRPLDREETAIHKLTVLASDGSSS--PARATITINVTDVNDNAPNIDLRY----IISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD----MFLTTISATDEDSGRNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILN---------DNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPP--------CSSAAKVTINVIDVNDNTP--------IVIYPPSNTSFK---LVPLSAIPGSVVAEV--FAVDGDTGMNAELKYTI 716          

HSP 2 Score: 98.9821 bits (245), Expect = 2.061e-20
Identity = 107/421 (25.42%), Postives = 180/421 (42.76%), Query Frame = 3
Query: 1353 IQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY------TFSVLEEQPIGTKIGQIVASDADTDQ-------LNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTF--LDADEGLNAEVVVTLKENPNF 2561
            I +++PEN   +    +   TD D+  + +     H  ++   +    ++I+E  +  +   LI     DRE    Y + +   D     K + ++ +Q+ + DVNDN P+F  S     I E    +  V  +   +Q TDAD+G N+ IKY     ++    + F++N+    I  + P+D E++   K  ++A DG      A+  ITI+V+D NDN P I  ++       T  + E+ PI TKI  I  SD DTD        + +DV F + +               + +N   ++T  +LD+E  +   F +        V +       + +  + V++ D NDN P        I  Q           +I  + + +NL   F  T    D D G NAE+V  L  N +F
Sbjct:  146 INISIPENTLINSRFAIPSATDPDTGPNSV-----HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAI-LQVTVTDVNDNRPVFKESQIEVHIPE----NSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKA---------------VYDNQYLLETSALLDYEGTKEYIFKI--------VASDSGKPSLNQTALVRVRLEDENDNPP--------IFTQP----------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF 513          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 243.817 bits (621), Expect = 6.606e-66
Identity = 202/693 (29.15%), Postives = 332/693 (47.91%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGIT-SPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            +DREK+C   + +       +S C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT    +  Y+L++ +S      V+    +    L+ +  +DRE    + + V   D G P K+ +  + + V D+NDNRP F+ES I + + EN   G  + +++ TD+D+GAN+++ Y      S A R         G+ + +Q  LD E   I +  ++A D  +    + AT+T+ VT++ND  P I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       +ME +L D    M    I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G  AL +   + +++ D NDN P+  +  + F V E  P  + +G I  +DAD  + N  V   +L+          N+ FI++ ++G IK+ V  D E+    +F VR  +              SS+  +T+ +ID+NDN+P        IV    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+
Sbjct:   92 IDREKLCPGPSFE-------DSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGL-ITVQRPLDREETAIHKLTVLASDGSSS--PARATITINVTDVNDNAPNIDLRY----IISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD----MFLTTISATDEDSGRNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILN---------DNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPP--------CSSAAKVTINVIDVNDNTP--------IVIYPPSNTSFK---LVPLSAIPGSVVAEV--FAVDGDTGMNAELKYTI 716          

HSP 2 Score: 98.9821 bits (245), Expect = 2.061e-20
Identity = 107/421 (25.42%), Postives = 180/421 (42.76%), Query Frame = 3
Query: 1353 IQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY------TFSVLEEQPIGTKIGQIVASDADTDQ-------LNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTF--LDADEGLNAEVVVTLKENPNF 2561
            I +++PEN   +    +   TD D+  + +     H  ++   +    ++I+E  +  +   LI     DRE    Y + +   D     K + ++ +Q+ + DVNDN P+F  S     I E    +  V  +   +Q TDAD+G N+ IKY     ++    + F++N+    I  + P+D E++   K  ++A DG      A+  ITI+V+D NDN P I  ++       T  + E+ PI TKI  I  SD DTD        + +DV F + +               + +N   ++T  +LD+E  +   F +        V +       + +  + V++ D NDN P        I  Q           +I  + + +NL   F  T    D D G NAE+V  L  N +F
Sbjct:  146 INISIPENTLINSRFAIPSATDPDTGPNSV-----HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAI-LQVTVTDVNDNRPVFKESQIEVHIPE----NSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKA---------------VYDNQYLLETSALLDYEGTKEYIFKI--------VASDSGKPSLNQTALVRVRLEDENDNPP--------IFTQP----------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF 513          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 243.817 bits (621), Expect = 9.001e-66
Identity = 202/693 (29.15%), Postives = 332/693 (47.91%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGIT-SPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            +DREK+C   + +       +S C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT    +  Y+L++ +S      V+    +    L+ +  +DRE    + + V   D G P K+ +  + + V D+NDNRP F+ES I + + EN   G  + +++ TD+D+GAN+++ Y      S A R         G+ + +Q  LD E   I +  ++A D  +    + AT+T+ VT++ND  P I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       +ME +L D    M    I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G  AL +   + +++ D NDN P+  +  + F V E  P  + +G I  +DAD  + N  V   +L+          N+ FI++ ++G IK+ V  D E+    +F VR  +              SS+  +T+ +ID+NDN+P        IV    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+
Sbjct:   92 IDREKLCPGPSFE-------DSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGL-ITVQRPLDREETAIHKLTVLASDGSSS--PARATITINVTDVNDNAPNIDLRY----IISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD----MFLTTISATDEDSGRNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILN---------DNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPP--------CSSAAKVTINVIDVNDNTP--------IVIYPPSNTSFK---LVPLSAIPGSVVAEV--FAVDGDTGMNAELKYTI 716          

HSP 2 Score: 98.9821 bits (245), Expect = 2.023e-20
Identity = 107/421 (25.42%), Postives = 180/421 (42.76%), Query Frame = 3
Query: 1353 IQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY------TFSVLEEQPIGTKIGQIVASDADTDQ-------LNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTF--LDADEGLNAEVVVTLKENPNF 2561
            I +++PEN   +    +   TD D+  + +     H  ++   +    ++I+E  +  +   LI     DRE    Y + +   D     K + ++ +Q+ + DVNDN P+F  S     I E    +  V  +   +Q TDAD+G N+ IKY     ++    + F++N+    I  + P+D E++   K  ++A DG      A+  ITI+V+D NDN P I  ++       T  + E+ PI TKI  I  SD DTD        + +DV F + +               + +N   ++T  +LD+E  +   F +        V +       + +  + V++ D NDN P        I  Q           +I  + + +NL   F  T    D D G NAE+V  L  N +F
Sbjct:  146 INISIPENTLINSRFAIPSATDPDTGPNSV-----HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAI-LQVTVTDVNDNRPVFKESQIEVHIPE----NSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKA---------------VYDNQYLLETSALLDYEGTKEYIFKI--------VASDSGKPSLNQTALVRVRLEDENDNPP--------IFTQP----------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF 513          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 232.261 bits (591), Expect = 7.134e-62
Identity = 203/757 (26.82%), Postives = 356/757 (47.03%), Query Frame = 3
Query:  492 PLDRE--KICSPQTDQNLIQKCC---ESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVK-NEPKDNRLV-LVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLK-ENPN--FSLDMGHNLICL-KNL-HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVN 2720
            P+DRE  K C     +N  + C    E S    I   SP  ++   R+ ++D NDN P FP   + ++V EN  +G    +P A D DT   G+ +Y L +     + F ++  E +  +L  L+    +DRE    ++L + A+D G P +  S  + + + D NDN P FE+S+    V EN   G  + ++K  DSD+G N ++ Y +        +  ++ +   GI + ++  LD E  N  +F ++A+D+G     S   V++ VT+ ND  P +     G +   + +   + E+ P    + L+ V+DKD   + ++  V      F LR   + ++  K+K F LQ     D E    YR+ I   DS   + L+ +  +++++ D NDN PIFS +     + E +  +++    E V++V  +DAD G N+ + Y +    +S+    F ++    +++ + P+D E   +++F + A D G P+   +  + I V D NDN P+     Y+FSVLE  P  + +G +   D D  + N  V    LS++    +      F+I+N TG I + +  D EK+   +F ++  +  +           SS V +T+ ++D NDN+P       ++ + + S      P+    S +   + +E      D D G NAE+V ++   NP+  F +   +  I L K L     G   + +   DR  G  SR A  L++I++  +  N
Sbjct:   79 PIDRETLKDC-----RNKGKPCFLEFEVSVTDLIQNQSP--RLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDR-SSGI-IYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYF-LQTTTPLDYERVRDYRVEIVAVDSGNPA-LSSTNSLKVQVTDTNDNSPIFSPT-----LFEVEFAEEN-QPGEKVVEVVASDADSGTNAELVYSI--IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGE-NAQV---QLSVEPDVGK------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGD--------PPRSSYVGVTINVLDENDNAP-------VVTKPSNSSFIRLSPMAAPDS-VVEVVEAE------DIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDR--GKPSRHAIALVHIYVNETIAN 781          

HSP 2 Score: 131.339 bits (329), Expect = 2.749e-30
Identity = 139/537 (25.88%), Postives = 218/537 (40.60%), Query Frame = 3
Query:  474 KLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRL-----VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRS--------GREIKRIKVTDSDIGANS------------QMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRP 2009
            +LIV G LDRE           ++   + +     G   P      +RV I D NDN P F +S  +  V EN  IGH+++  KA D D    G   Y L           +   PK  R+     ++  K  +DRE  +     V+A D+G   K+    + ++V D NDN P  E   I L    +G +        G  +  ++V+D D G N+            Q+    +      ++YF          LQ  + LDYE    +   I+A D G P L ST ++ V+VT+ ND  P         I  P   ++   E     + ++ +  +D DS  +  L        +     T  +  I+     E++     DRE    Y   +T +D    S    +  + +K+ D NDN P F  S +   ++E       V    G++ V D D G N++++  ++      D   F + +    I +    D EK   + F L AVDGG P  ++   +TI+V D NDN P
Sbjct:  194 QLIVLGSLDRE-----------LKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQ--------AIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYF----------LQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSP---------IFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELV-----YSIIADSSTRGLFEIDPNS-GEVRARSPLDREHKDRYEFRVTAADKGVPSH-RGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPV----GMVTVQDMDEGENAQVQLSVE-----PDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAP 676          

HSP 3 Score: 116.701 bits (291), Expect = 8.303e-26
Identity = 131/543 (24.13%), Postives = 234/543 (43.09%), Query Frame = 3
Query:  465 SHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH--------ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSC----GSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYN-IEDYTSQAQRYFKLFQI-KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFS--SSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSD--ANDNRPE--IGNKFYT 2033
            S G + V GPLDRE+I       NL                SP     Y+ +++ D+NDN P      I +  H        E++ +G  + L +  D D     +    +  D        S   V N+    +  L   T +D E    + + ++A+D G P+ + + S+ ++V D NDN P F  +   +   E  + G ++  +  +D+D G N+++ Y+ I D +++      LF+I  +   ++ +S LD E+K+ +EFR+ A D+G P    TATV ++V + ND  P+ +          +    ++ EN P    + ++ V D D    +   ++S   DV           + +     + + I FDRE  S Y   +   D     + +  V + + + D NDN P+ +  S+  F ++      D  V     V++  D D G N+ + Y +    N  D  Y S ++   +I   + +  + S   +  +   D GKP+  A   + I V++  AN +  E  +G+  YT
Sbjct:  298 SSGIIYVKGPLDREEI------NNLKFYVVARDKG-----PSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNK---RKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRG-----LFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML---------SGYSFSVLENMPPLSPVGMVTVQDMDEG-ENAQVQLSVEPDVG--------KFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPR-SSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVE----VVEAEDIDSGSNAELVYSIAGG-NPHDLFYISPSNG--EITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVSHVEALVGHSLYT 795          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 232.646 bits (592), Expect = 3.288e-62
Identity = 199/718 (27.72%), Postives = 350/718 (48.75%), Query Frame = 3
Query:  459 SLSHGKLIVTGP-LDREKICSPQTDQNLIQKCCESSCCMFIGIT-SPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQD---VHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  ++ +      E+ C   + +   PN     I++ I  +D NDN P+FP + I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDN+P F+ES + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q  LD E   + +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ + S ++C        F  RE         K +++ Q L+E     D E    +   I  +D+   S L Q+  ++++++D NDNPPIFS       ++E  +++ +   +++T   +  +D D G NS I Y L       ++ +F ++ +   +      D E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I A+D+D  + N+ V   +L+          N+ F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ I+D NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSTRIDREKLCAGSSNSD------ENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATK--RLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPS-LNQTALVRVELEDENDNPPIFSQ-----PVIELSVSENNRRGLYLT--TVSASDEDSGKNSDIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGE-NKAVTLSILN---------DNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPP--------RSSTAKVTINIMDANDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDTDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 226.483 bits (576), Expect = 3.922e-60
Identity = 186/639 (29.11%), Postives = 309/639 (48.36%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIED-YTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL 2384
            +DREK+CS    +N   KC        +    P+   ++  IR  IED NDN P+FP + I I++ EN  +     +P A D D    GI +Y+L+  ++      ++    D    L+ +  +DRE    + + +   D G P+++ +  + + V D+NDNRP F+E  I +++ E+   G  + ++  TD+D+G+N+++ +   +  T+ A+R+F +     G+ + ++  LD E     +  ++A D   TP   S ATVT+ +T++ND  P I   +   I++P +  + L E  P +  I LI VTDKD+ L   + C   H  DV +            K +F+ Q L+E     D E+T  Y I I  SDS     L QS  + +KI D NDN P+F+        +E +    ++      I  TDAD G N+ + Y     L       F+++     +     +D EK  ++ F ++A D G P+L  +T +T+SV D NDN P   +  Y F V E  P+   +G I  +DAD+ + N  V   +++           D FII+  TG I+  +  D E+    +F V+  +     G+  K    SS+V +T+ + D+NDN P   +
Sbjct:   89 IDREKLCSGIFTEN---KCFYEVEVAVL----PDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDN-NTGL-ITVKEPLDREESPYHKLTVLASDGSSTP---SRATVTINITDINDNIPSI---DTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDH--DVPF----------RLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGK-PPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTK----ISATDADSGRNAELSY----MLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGE-NAVVTLSLVN---------ARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDK----GSPQK----SSTVKVTIFVEDVNDNKPVFVI 673          

HSP 2 Score: 132.88 bits (333), Expect = 1.063e-30
Identity = 146/559 (26.12%), Postives = 247/559 (44.19%), Query Frame = 3
Query:  336 NIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKNS---QPFSLSH--GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCG-----SCFEVKNEPK------DNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILC-EVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIF---SSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEP-IDYEKSKQFKFFLVAVDGGKP 1949
            NIP  ++    V  L  T + +    K + YF ++  +   + F++ +  G + V  PLDRE+  SP     ++            G ++P+R    + +NI D NDN P     YI   V+  V++     L     L T          ++DK        +CF   + P       DN+ +L     +D E+   + + ++A D GKP    S  ++++++D NDN P F    I LS  EN   G E+ +I  TD+D G N+++SY +      A   F L + + GI L     LD E ++ + F +IAKD G P L +  TVT+ V + ND  P             N     +PEN P + T+ LI VTD DS  + ++   + + +D F +     V          ++  I FDRE    Y   +   D  +  K + +V++ + ++DVNDN P+F   S+++ +  +++T  +   V      +   D D G+N+ ++Y +   +       F++      I  KE  +  +    +K  +   D GKP
Sbjct:  255 NIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREE--SPYHKLTVLASD---------GSSTPSRAT--VTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALIT----------VTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML---GPNAPTIFNLDR-RTGI-LTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH---------NEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGV----------IRPNITFDREQQGSYTFQVKALDKGSPQK-SSTVKVTIFVEDVNDNKPVFVIPSNNYSY-DLVQTSTSPGSV---VARVYAIDNDTGINADLRYSI---IGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 758          

HSP 3 Score: 91.6633 bits (226), Expect = 4.781e-18
Identity = 118/480 (24.58%), Postives = 205/480 (42.71%), Query Frame = 3
Query: 1353 IQLTLPENGPKHQTIILIHVTDKDSKLSDIL-CEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDL-TDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY------TFSVLEEQPIGTKIGQIVASDADTDQ-------LNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN--FSLDMGHN-LICLKNL-HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP 2726
            I +++PEN   +    +    D D  ++ I   E+   ++VF L      ++IE  +  +   LI     DRE    Y + I   D    ++ + ++ +Q+ + DVNDN P+F       K +E ++  D  V  +   +  TDAD+G N++I ++  + + +   ++F++++    I  KEP+D E+S   K  ++A DG      A+  +TI+++D NDN P I  ++       T  + E+ P+ TKI  I  +D D D         + DV F            R   +F   +N   ++T   LD+E  +  +  +   ++      K  L+    S  + +KI D NDN+P   L         G       P     + I++           DAD G NAE+   L  N    F+LD     L  ++ L       +T +VI +D   GN S +    + + +     N P
Sbjct:  142 INISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGL------DVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAI-LQVTVTDVNDNRPVFKE-----KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRAT--VTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPF------------RLKPVF---DNQFLLETAAPLDYESTREYAIKIVASDSG-----KPPLN---QSAMLLIKIKDENDNAPVFTLP------MIGLSFVENNPPGTELTKISAT----------DADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDN--GNPSLQTNTTVTLSVLDQNDNSP 566          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 226.098 bits (575), Expect = 4.469e-60
Identity = 186/639 (29.11%), Postives = 309/639 (48.36%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIED-YTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL 2384
            +DREK+CS    +N   KC        +    P+   ++  IR  IED NDN P+FP + I I++ EN  +     +P A D D    GI +Y+L+  ++      ++    D    L+ +  +DRE    + + +   D G P+++ +  + + V D+NDNRP F+E  I +++ E+   G  + ++  TD+D+G+N+++ +   +  T+ A+R+F +     G+ + ++  LD E     +  ++A D   TP   S ATVT+ +T++ND  P I   +   I++P +  + L E  P +  I LI VTDKD+ L   + C   H  DV +            K +F+ Q L+E     D E+T  Y I I  SDS     L QS  + +KI D NDN P+F+        +E +    ++      I  TDAD G N+ + Y     L       F+++     +     +D EK  ++ F ++A D G P+L  +T +T+SV D NDN P   +  Y F V E  P+   +G I  +DAD+ + N  V   +++           D FII+  TG I+  +  D E+    +F V+  +     G+  K    SS+V +T+ + D+NDN P   +
Sbjct:  109 IDREKLCSGIFTEN---KCFYEVEVAVL----PDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDN-NTGL-ITVKEPLDREESPYHKLTVLASDGSSTP---SRATVTINITDINDNIPSI---DTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDH--DVPF----------RLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGK-PPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTK----ISATDADSGRNAELSY----MLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGE-NAVVTLSLVN---------ARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDK----GSPQK----SSTVKVTIFVEDVNDNKPVFVI 693          

HSP 2 Score: 132.494 bits (332), Expect = 1.248e-30
Identity = 146/559 (26.12%), Postives = 247/559 (44.19%), Query Frame = 3
Query:  336 NIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKNS---QPFSLSH--GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCG-----SCFEVKNEPK------DNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILC-EVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIF---SSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEP-IDYEKSKQFKFFLVAVDGGKP 1949
            NIP  ++    V  L  T + +    K + YF ++  +   + F++ +  G + V  PLDRE+  SP     ++            G ++P+R    + +NI D NDN P     YI   V+  V++     L     L T          ++DK        +CF   + P       DN+ +L     +D E+   + + ++A D GKP    S  ++++++D NDN P F    I LS  EN   G E+ +I  TD+D G N+++SY +      A   F L + + GI L     LD E ++ + F +IAKD G P L +  TVT+ V + ND  P             N     +PEN P + T+ LI VTD DS  + ++   + + +D F +     V          ++  I FDRE    Y   +   D  +  K + +V++ + ++DVNDN P+F   S+++ +  +++T  +   V      +   D D G+N+ ++Y +   +       F++      I  KE  +  +    +K  +   D GKP
Sbjct:  275 NIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREE--SPYHKLTVLASD---------GSSTPSRAT--VTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALIT----------VTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML---GPNAPTIFNLDR-RTGI-LTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH---------NEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGV----------IRPNITFDREQQGSYTFQVKALDKGSPQK-SSTVKVTIFVEDVNDNKPVFVIPSNNYSY-DLVQTSTSPGSV---VARVYAIDNDTGINADLRYSI---IGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          

HSP 3 Score: 91.6633 bits (226), Expect = 5.334e-18
Identity = 118/480 (24.58%), Postives = 205/480 (42.71%), Query Frame = 3
Query: 1353 IQLTLPENGPKHQTIILIHVTDKDSKLSDIL-CEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDL-TDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY------TFSVLEEQPIGTKIGQIVASDADTDQ-------LNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN--FSLDMGHN-LICLKNL-HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP 2726
            I +++PEN   +    +    D D  ++ I   E+   ++VF L      ++IE  +  +   LI     DRE    Y + I   D    ++ + ++ +Q+ + DVNDN P+F       K +E ++  D  V  +   +  TDAD+G N++I ++  + + +   ++F++++    I  KEP+D E+S   K  ++A DG      A+  +TI+++D NDN P I  ++       T  + E+ P+ TKI  I  +D D D         + DV F            R   +F   +N   ++T   LD+E  +  +  +   ++      K  L+    S  + +KI D NDN+P   L         G       P     + I++           DAD G NAE+   L  N    F+LD     L  ++ L       +T +VI +D   GN S +    + + +     N P
Sbjct:  162 INISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGL------DVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAI-LQVTVTDVNDNRPVFKE-----KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRAT--VTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPF------------RLKPVF---DNQFLLETAAPLDYESTREYAIKIVASDSG-----KPPLN---QSAMLLIKIKDENDNAPVFTLP------MIGLSFVENNPPGTELTKISAT----------DADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDN--GNPSLQTNTTVTLSVLDQNDNSP 586          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 226.098 bits (575), Expect = 5.660e-60
Identity = 186/639 (29.11%), Postives = 309/639 (48.36%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIED-YTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL 2384
            +DREK+CS    +N   KC        +    P+   ++  IR  IED NDN P+FP + I I++ EN  +     +P A D D    GI +Y+L+  ++      ++    D    L+ +  +DRE    + + +   D G P+++ +  + + V D+NDNRP F+E  I +++ E+   G  + ++  TD+D+G+N+++ +   +  T+ A+R+F +     G+ + ++  LD E     +  ++A D   TP   S ATVT+ +T++ND  P I   +   I++P +  + L E  P +  I LI VTDKD+ L   + C   H  DV +            K +F+ Q L+E     D E+T  Y I I  SDS     L QS  + +KI D NDN P+F+        +E +    ++      I  TDAD G N+ + Y     L       F+++     +     +D EK  ++ F ++A D G P+L  +T +T+SV D NDN P   +  Y F V E  P+   +G I  +DAD+ + N  V   +++           D FII+  TG I+  +  D E+    +F V+  +     G+  K    SS+V +T+ + D+NDN P   +
Sbjct:  109 IDREKLCSGIFTEN---KCFYEVEVAVL----PDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDN-NTGL-ITVKEPLDREESPYHKLTVLASDGSSTP---SRATVTINITDINDNIPSI---DTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDH--DVPF----------RLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGK-PPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTK----ISATDADSGRNAELSY----MLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGE-NAVVTLSLVN---------ARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDK----GSPQK----SSTVKVTIFVEDVNDNKPVFVI 693          

HSP 2 Score: 132.494 bits (332), Expect = 1.338e-30
Identity = 146/559 (26.12%), Postives = 247/559 (44.19%), Query Frame = 3
Query:  336 NIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKNS---QPFSLSH--GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCG-----SCFEVKNEPK------DNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILC-EVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIF---SSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEP-IDYEKSKQFKFFLVAVDGGKP 1949
            NIP  ++    V  L  T + +    K + YF ++  +   + F++ +  G + V  PLDRE+  SP     ++            G ++P+R    + +NI D NDN P     YI   V+  V++     L     L T          ++DK        +CF   + P       DN+ +L     +D E+   + + ++A D GKP    S  ++++++D NDN P F    I LS  EN   G E+ +I  TD+D G N+++SY +      A   F L + + GI L     LD E ++ + F +IAKD G P L +  TVT+ V + ND  P             N     +PEN P + T+ LI VTD DS  + ++   + + +D F +     V          ++  I FDRE    Y   +   D  +  K + +V++ + ++DVNDN P+F   S+++ +  +++T  +   V      +   D D G+N+ ++Y +   +       F++      I  KE  +  +    +K  +   D GKP
Sbjct:  275 NIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREE--SPYHKLTVLASD---------GSSTPSRAT--VTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALIT----------VTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML---GPNAPTIFNLDR-RTGI-LTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH---------NEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGV----------IRPNITFDREQQGSYTFQVKALDKGSPQK-SSTVKVTIFVEDVNDNKPVFVIPSNNYSY-DLVQTSTSPGSV---VARVYAIDNDTGINADLRYSI---IGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          

HSP 3 Score: 91.2781 bits (225), Expect = 6.190e-18
Identity = 118/480 (24.58%), Postives = 205/480 (42.71%), Query Frame = 3
Query: 1353 IQLTLPENGPKHQTIILIHVTDKDSKLSDIL-CEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDL-TDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFY------TFSVLEEQPIGTKIGQIVASDADTDQ-------LNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN--FSLDMGHN-LICLKNL-HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP 2726
            I +++PEN   +    +    D D  ++ I   E+   ++VF L      ++IE  +  +   LI     DRE    Y + I   D    ++ + ++ +Q+ + DVNDN P+F       K +E ++  D  V  +   +  TDAD+G N++I ++  + + +   ++F++++    I  KEP+D E+S   K  ++A DG      A+  +TI+++D NDN P I  ++       T  + E+ P+ TKI  I  +D D D         + DV F            R   +F   +N   ++T   LD+E  +  +  +   ++      K  L+    S  + +KI D NDN+P   L         G       P     + I++           DAD G NAE+   L  N    F+LD     L  ++ L       +T +VI +D   GN S +    + + +     N P
Sbjct:  162 INISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGL------DVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAI-LQVTVTDVNDNRPVFKE-----KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRAT--VTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPF------------RLKPVF---DNQFLLETAAPLDYESTREYAIKIVASDSG-----KPPLN---QSAMLLIKIKDENDNAPVFTLP------MIGLSFVENNPPGTELTKISAT----------DADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDN--GNPSLQTNTTVTLSVLDQNDNSP 586          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 225.713 bits (574), Expect = 6.319e-60
Identity = 200/787 (25.41%), Postives = 349/787 (44.35%), Query Frame = 3
Query:  429 FTDRKNSQPFSLSHGKLIVTG----------PLDREKI--CSPQTDQNL--IQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCF--EVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQ-DVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL-DMGHN--LICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNK 2723
            + D K+     L H  L V G           +DRE +  C     QNL   +KC          + SP  ++   ++ I D NDN P F    I +++ EN  IG    +P A D D+   G+ +Y+LI        F  +V  +  + +  L+    +DRE    ++L +   D G P++  S  + + + D NDN P FE+      + EN   G  + ++K  DSD G N+++ Y+    +   +R   L +    I++Q    +D E+    +F ++AKD+G     +   VT+ + + ND  P I     G +     +   + E+ P    + L+ V+D D  + + + C V+   DV F L++  +     KKK F LQ     D E+   Y I I   DS     L+ +  +++++ DVNDN P+FS S     +ME    +  D++     +  TDAD G NS++ Y +    + +    FS+N +  QI+    +D E+ + + F +VAVD G P+L  +  + I+V D NDN P+     Y FSV+E  P  + +G +   DAD  + N  +   +    G          F+I+N TG I + +  D E     +F ++  +  +           SS V +T+ ++D NDN+P + +  ++  +          P+    ++              D D G+NAE+  ++     F L  + HN   + L+   +   Y    ++ +  + G  SR    L++ ++  +  N+
Sbjct:   92 YPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESLREC-----QNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQ--GPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVA-NISEDVPVETPVALVQVSDIDEGVNAAVTCVVA--GDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYESVKEYTIEIVAVDSGN-PPLSSTNSLKVQVTDVNDNAPVFSQS-----LMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGE-NAHIHLSVEPESGE---------FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGD--------PPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAE--------------DMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQ 827          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 231.491 bits (589), Expect = 1.337e-62
Identity = 202/719 (28.09%), Postives = 345/719 (47.98%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      + E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +D D  + N+ V   +L+          N+ F+++  +G IK+ V  D E+    +F V+         T       SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGE-NKAVTLSILN---------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVK--------ATDGGQPPRSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDIDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 232.646 bits (592), Expect = 6.880e-62
Identity = 201/719 (27.96%), Postives = 346/719 (48.12%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      + E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +D D  + N+ V   +L+          N+ F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGE-NKAVTLSILN---------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDIDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 232.646 bits (592), Expect = 7.502e-62
Identity = 201/719 (27.96%), Postives = 346/719 (48.12%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      + E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +D D  + N+ V   +L+          N+ F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGE-NKAVTLSILN---------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDIDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 232.646 bits (592), Expect = 8.178e-62
Identity = 201/719 (27.96%), Postives = 346/719 (48.12%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      + E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +D D  + N+ V   +L+          N+ F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGE-NKAVTLSILN---------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDIDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 232.646 bits (592), Expect = 8.178e-62
Identity = 201/719 (27.96%), Postives = 346/719 (48.12%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      + E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +D D  + N+ V   +L+          N+ F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGE-NKAVTLSILN---------DNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDIDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 6.718e-63
Identity = 204/719 (28.37%), Postives = 347/719 (48.26%), Query Frame = 3
Query:  459 SLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFI--GITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKD-QGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD---QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            S S G++  T   +DREK+C+  +         E + C F    +  PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT   G+ +Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+E  + + + EN   G  + ++  TD+DIG+N+++ Y      + A +  +LF + +   L  +Q +LD E   I +  ++A D   TP   + ATVT+ VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C        F  RE         K +++ Q L+E     D E T  +   I  SDS   S L Q+  +++K++D NDNPPIF+       ++E  +++   + +++T   I  TD D G N+ I Y L       ++ +F ++ +   +      D E+ ++F F + A D G P L +   + ++V D NDN P+  +  + F V E  P  + +G I  +DAD  + N+ V   +L+          ND F+++  +G IK+ V  D E+    +F V+  +  +           SS+  +T+ ++D+NDNSP        +V    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   79 SSSTGEIFTTSNRIDREKLCAGAS-------YAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK--RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP---ARATVTINVTDVNDNPPNIDLRY----IISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC--------FIEREVP----FHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPS-LNQTALVRVKLEDENDNPPIFNQ-----PVIELSVSENNRRGLYLT--TISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NKAVTLSILN---------DNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPP--------RSSTAKVTINVMDVNDNSP--------VVISPPSNTSFK---LVPLSAIPGSVVAEV--FAVDVDTGMNAELKYTIVSGNNKGL 725          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 4.677e-61
Identity = 204/702 (29.06%), Postives = 326/702 (46.44%), Query Frame = 3
Query:  471 GKLIVTGP-LDREKICS--PQTDQNLIQKCCESSCCMF---IGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            G++  TG  +DREK+C+  P+ +            C +   + I  P+   ++  IR  IED NDN P+FP + I I++ EN  I     LP A D D  + G+ NY+LI  ++      ++    D    L+ + ++DRE    + + V   D G P ++ +  + + V D NDN P F+E+ I +S+ EN   G  + ++  TD+DIG N+++ ++  +  S   R  +LF +     L  ++  LD E     +  ++A D G   + + A V V VT++ND  P I + Y    IV+P +  + L EN P +  I LI VTDKD+  +  + C   H +  F LR            +F  Q L+E     D E+T  Y I +  +D+     L QS  + +K+ D NDN P+F+ SF    I E +     + +T+  +  TDAD G N+ I Y     L       FS++     +   + +D EK  ++ F ++A D G P LT++  + +S+ D NDN P   +  Y F V E  P    +G I  +D D    N  V   +L          +ND F I++ TG I+  +  D EK +  +F V+  +              SSS  +T+ ++D+NDN P   +  S    +    L S  P  +            F    +D D G+NAEV
Sbjct:   82 GEIFTTGARIDREKLCAGIPRDEH-----------CFYEVEVAIL-PDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIAR--RLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRY----IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDH-EIPFRLR-----------PVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN--SPGIQLTK--VSATDADSGPNAEINY----LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD-NSAVTLSILD---------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS--------RSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL--VLPSTNPGTVV-----------FQVMAVDNDTGMNAEV 711          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 6.645e-61
Identity = 204/702 (29.06%), Postives = 326/702 (46.44%), Query Frame = 3
Query:  471 GKLIVTGP-LDREKICS--PQTDQNLIQKCCESSCCMF---IGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            G++  TG  +DREK+C+  P+ +            C +   + I  P+   ++  IR  IED NDN P+FP + I I++ EN  I     LP A D D  + G+ NY+LI  ++      ++    D    L+ + ++DRE    + + V   D G P ++ +  + + V D NDN P F+E+ I +S+ EN   G  + ++  TD+DIG N+++ ++  +  S   R  +LF +     L  ++  LD E     +  ++A D G   + + A V V VT++ND  P I + Y    IV+P +  + L EN P +  I LI VTDKD+  +  + C   H +  F LR            +F  Q L+E     D E+T  Y I +  +D+     L QS  + +K+ D NDN P+F+ SF    I E +     + +T+  +  TDAD G N+ I Y     L       FS++     +   + +D EK  ++ F ++A D G P LT++  + +S+ D NDN P   +  Y F V E  P    +G I  +D D    N  V   +L          +ND F I++ TG I+  +  D EK +  +F V+  +              SSS  +T+ ++D+NDN P   +  S    +    L S  P  +            F    +D D G+NAEV
Sbjct:   82 GEIFTTGARIDREKLCAGIPRDEH-----------CFYEVEVAIL-PDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIAR--RLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRY----IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDH-EIPFRLR-----------PVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN--SPGIQLTK--VSATDADSGPNAEINY----LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD-NSAVTLSILD---------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS--------RSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL--VLPSTNPGTVV-----------FQVMAVDNDTGMNAEV 711          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.207e-60
Identity = 205/702 (29.20%), Postives = 326/702 (46.44%), Query Frame = 3
Query:  471 GKLIVTGP-LDREKICS--PQTDQNLIQKCCESSCCMF---IGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            G++  TG  +DREK+C+  P+ +            C +   + I  P+   ++  IR  IED NDN P+FP + I I++ EN  I     LP A D D    G+ NY+LI  ++      ++    D    L+ + ++DRE    + + V   D G P ++ +  + + V D NDN P F+E+ I +S+ EN   G  + ++  TD+DIG N+++ ++  +  S   R  +LF +     L  ++  LD E     +  ++A D G   + + A V V VT++ND  P I + Y    IV+P +  + L EN P +  I LI VTDKD+  +  + C   H +  F LR            +F  Q L+E     D E+T  Y I +  +D+     L QS  + +K+ D NDN P+F+ SF    I E +     + +T+  +  TDAD G N+ I Y     L       FS++     +   + +D EK  ++ F ++A D G P LT++  + +S+ D NDN P   +  Y F V E  P    +G I  +D D    N  V   +L          +ND F I++ TG I+  +  D EK +  +F V+  +              SSS  +T+ ++D+NDN P   +  S    +    L S  P  +    IA           +D D G+NAEV
Sbjct:   82 GEIFTTGARIDREKLCAGIPRDEH-----------CFYEVEVAIL-PDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIAR--RLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRY----IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDH-EIPFRLR-----------PVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN--SPGIQLTK--VSATDADSGPNAEINY----LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD-NSAVTLSILD---------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS--------RSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL--VLPSTNPGTVVFQVIA-----------VDNDTGMNAEV 711          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 1.452e-60
Identity = 205/702 (29.20%), Postives = 326/702 (46.44%), Query Frame = 3
Query:  471 GKLIVTGP-LDREKICS--PQTDQNLIQKCCESSCCMF---IGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            G++  TG  +DREK+C+  P+ +            C +   + I  P+   ++  IR  IED NDN P+FP + I I++ EN  I     LP A D D    G+ NY+LI  ++      ++    D    L+ + ++DRE    + + V   D G P ++ +  + + V D NDN P F+E+ I +S+ EN   G  + ++  TD+DIG N+++ ++  +  S   R  +LF +     L  ++  LD E     +  ++A D G   + + A V V VT++ND  P I + Y    IV+P +  + L EN P +  I LI VTDKD+  +  + C   H +  F LR            +F  Q L+E     D E+T  Y I +  +D+     L QS  + +K+ D NDN P+F+ SF    I E +     + +T+  +  TDAD G N+ I Y     L       FS++     +   + +D EK  ++ F ++A D G P LT++  + +S+ D NDN P   +  Y F V E  P    +G I  +D D    N  V   +L          +ND F I++ TG I+  +  D EK +  +F V+  +              SSS  +T+ ++D+NDN P   +  S    +    L S  P  +    IA           +D D G+NAEV
Sbjct:   82 GEIFTTGARIDREKLCAGIPRDEH-----------CFYEVEVAIL-PDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIAR--RLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRY----IVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDH-EIPFRLR-----------PVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN--SPGIQLTK--VSATDADSGPNAEINY----LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD-NSAVTLSILD---------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS--------RSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL--VLPSTNPGTVVFQVIA-----------VDNDTGMNAEV 711          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A5K3EKL9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 1.607e-94
Identity = 254/860 (29.53%), Postives = 419/860 (48.72%), Query Frame = 3
Query:  405 QAEKDNIYFTDRKNSQPFSLSH---GKLIVTG--PLDREKICSP---QTDQNLIQKCCESS------------------CCMFIGITSPNRKINYIRVNIEDENDNEPIF---PQS---------YIKIAVHENVEIGHTIVLPKAEDLD--------------TPSYGID-NYKLISDKSCGSCFEVKNEPKDNRL---VLVFKTKIDRETNSVFNLLVLAIDRGKP-SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYT------SQAQRYFKLFQIK----DGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKH--QTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETD---LTD-QDVHMTEG----------VIQVTDADIGMNSRIKYHL----KDALNST-----DSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD---GGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQN---------DLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGL--NAEVVVTLKENPNFSLDMGHNLICLKNLHLS------PGYFTVSVIGQD 2648
            +A +  ++FTD   S PF + H   G  I+T   P+DRE+IC P       ++ +KCC S+                  CC+F+GIT        +RV + D ND+ P F   P+S          + + + EN   G  I LP+A DLD               P    + ++KL+S           +EP+        L     IDRET S F   ++A D+G+P + + +LS+ + V D NDN P F +S   + V+EN   G+ +  + VTD D G NS++SY +   T        +  + ++  +     DG+ L+L   LDYE+   F+F ++ +D GTP L ST+TV+V V N ND+PP I F+N+G++++ +   L   E+      + I  +HV D+D+ L ++ C++S  + +F LRE  + N ++++K++EL +L + DRE    Y + + C D  T ++L    +I++ + D NDNPP+F  S  FG ++E +   L D +D     G           I+ TDAD G N+ I Y L    +DA NST     D Q F ++    Q+K + P+D+EK   +   L+A D       AL+++ ++TI+V D +DN P +  + Y F V E  P  T +G++ A+D D+   NR + + + +      +   +           F I+ ++G I+T   LD E+  +V+  V   +++  +         SS+  + + ++D NDN+P +    SL+       L ++  I        S +C  F Y F D D+    N  V VTL  NPNF  +  H+ +C+K+          PG ++++V+  D
Sbjct:   75 EARQVPVFFTDATESHPFVIKHAKDGSRILTNELPIDREEICDPFKYPHHASVARKCCASTESKERYGTSPFDPQLNFKCCVFLGITVEGYGTFALRVEVIDINDSHPRFTTPPESTQRHAGKDDLVVVKIAENTHEGTIIPLPRAVDLDEGRNAELLFRVKKPNPMTSWEQHFKLLSGPEDRCATRASDEPEQKEFSPPALCLLKPIDRETVSGFTFDLIARDQGEPVALSTTLSVSIMVLDENDNTPTFRQSEFKVFVKEN-EVGKTLVHLHVTDLDAGENSRLSYFLRPGTHFVGNQKPSSDFLRMHILASPALDGVVLRLIQPLDYESVKSFDFEVVVQDYGTPRLASTSTVSVEVLNTNDQPPVIRFFNKGNLLNSDYASLEREEDTDNQLPKVICHVHVYDQDTSLDEVFCDISSHQRLFDLREVSSENTVQQRKVYELISLAQLDREKAPSYSVGVRCVDGRTTTRLIGQSQIRILLKDANDNPPVFEKSQFFGTVVENEADALVDFKDSFSNYGNPTAKFVGPSHIRATDADTGPNAAISYSLAAWTRDADNSTQSDKADYQSFYIDPVTGQLKTRVPLDFEKKSSYHLLLIATDQPIDASQALSSTAKLTITVKDVDDNPPTMLQQHYAFEVTEGVPSHTVVGRVEATDIDSLPENRIINYHLKATTDPVTKSDASASYAAAAALHYFTIDRHSGVIRTVRPLDREQTPNVTLEVVAHSSSSGISQTASPSSPSSTATVVINVLDKNDNAPYMV---SLLSPDRTRVLLAEVVIPPDRLQGESPICVPFAYAFYDDDDQSCGNGNVSVTLDNNPNFVFNEDHSQLCIKDSKTKSTTLPLPGRYSLNVLAHD 930          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A158QU55 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5774 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 2.161e-94
Identity = 254/860 (29.53%), Postives = 419/860 (48.72%), Query Frame = 3
Query:  405 QAEKDNIYFTDRKNSQPFSLSH---GKLIVTG--PLDREKICSP---QTDQNLIQKCCESS------------------CCMFIGITSPNRKINYIRVNIEDENDNEPIF---PQS---------YIKIAVHENVEIGHTIVLPKAEDLD--------------TPSYGID-NYKLISDKSCGSCFEVKNEPKDNRL---VLVFKTKIDRETNSVFNLLVLAIDRGKP-SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYT------SQAQRYFKLFQIK----DGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKH--QTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETD---LTD-QDVHMTEG----------VIQVTDADIGMNSRIKYHL----KDALNST-----DSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD---GGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQN---------DLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGL--NAEVVVTLKENPNFSLDMGHNLICLKNLHLS------PGYFTVSVIGQD 2648
            +A +  ++FTD   S PF + H   G  I+T   P+DRE+IC P       ++ +KCC S+                  CC+F+GIT        +RV + D ND+ P F   P+S          + + + EN   G  I LP+A DLD               P    + ++KL+S           +EP+        L     IDRET S F   ++A D+G+P + + +LS+ + V D NDN P F +S   + V+EN   G+ +  + VTD D G NS++SY +   T        +  + ++  +     DG+ L+L   LDYE+   F+F ++ +D GTP L ST+TV+V V N ND+PP I F+N+G++++ +   L   E+      + I  +HV D+D+ L ++ C++S  + +F LRE  + N ++++K++EL +L + DRE    Y + + C D  T ++L    +I++ + D NDNPP+F  S  FG ++E +   L D +D     G           I+ TDAD G N+ I Y L    +DA NST     D Q F ++    Q+K + P+D+EK   +   L+A D       AL+++ ++TI+V D +DN P +  + Y F V E  P  T +G++ A+D D+   NR + + + +      +   +           F I+ ++G I+T   LD E+  +V+  V   +++  +         SS+  + + ++D NDN+P +    SL+       L ++  I        S +C  F Y F D D+    N  V VTL  NPNF  +  H+ +C+K+          PG ++++V+  D
Sbjct:   69 EARQVPVFFTDATESHPFVIKHAKDGSRILTNELPIDREEICDPFKYPHHASVARKCCASTESKERYGTSPFDPQLNFKCCVFLGITVEGYGTFALRVEVIDINDSHPRFTTPPESTQRHAGKDDLVVVKIAENTHEGTIIPLPRAVDLDEGRNAELLFRVKKPNPMTSWEQHFKLLSGPEDRCATRASDEPEQKEFSPPALCLLKPIDRETVSGFTFDLIARDQGEPVALSTTLSVSIMVLDENDNTPTFRQSEFKVFVKEN-EVGKTLVHLHVTDLDAGENSRLSYFLRPGTHFVGNQKPSSDFLRMHILASPALDGVVLRLIQPLDYESVKSFDFEVVVQDYGTPRLASTSTVSVEVLNTNDQPPVIRFFNKGNLLNSDYASLEREEDTDNQLPKVICHVHVYDQDTSLDEVFCDISSHQRLFDLREVSSENTVQQRKVYELISLAQLDREKAPSYSVGVRCVDGRTTTRLIGQSQIRILLKDANDNPPVFEKSQFFGTVVENEADALVDFKDSFSNYGNPTAKFVGPSHIRATDADTGPNAAISYSLAAWTRDADNSTQSDKADYQSFYIDPVTGQLKTRVPLDFEKKSSYHLLLIATDQPIDASQALSSTAKLTITVKDVDDNPPTMLQQHYAFEVTEGVPSHTVVGRVEATDIDSLPENRIINYHLKATTDPVTKSDASASYAAAAALHYFTIDRHSGVIRTVRPLDREQTPNVTLEVVAHSSSSGISQTASPSSPSSTATVVINVLDKNDNAPYMV---SLLSPDRTRVLLAEVVIPPDRLQGESPICVPFAYAFYDDDDQSCGNGNVSVTLDNNPNFVFNEDHSQLCIKDSKTKSTTLPLPGRYSLNVLAHD 924          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A158R745 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1523 PE=4 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 4.253e-94
Identity = 275/947 (29.04%), Postives = 444/947 (46.88%), Query Frame = 3
Query:  267 VIIYLRFPIAYPCDYISVITVTE-------NIP--YPSSS------LIDVGHLLLTSSLIS--QAEKDNIYFTDRKNSQPFS---LSHGKLIVTG--PLDREKICSP---QTDQNLIQKCCESS------------------CCMFIGITSPNRKINYIRVNIEDENDNEPIF---PQSYIK---------IAVHENVEIGHTIVLPKAEDLD--------------TPSYGIDN-YKLIS--DKSCGSCFEVKNEPKDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKP---SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSY----------NIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPEN----GPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIME------TDLTDQDVH--------MTEGVIQVTDADIGMNSRIKYHL-----KDALNST-----DSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD---GGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLD---------------GTKRRQRQN---------DLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGL--NAEVVVTLKENPNFSLDMGHNLICLK-------NLHLSP---GYFTVSVIGQD 2648
            + I+    I + C Y+  I + E       N+P   P+ S       I++  +  T   IS  +A +  I+FTD   SQPF+   L  G  ++T   P+DRE+IC P        + +KCC                     CC+F+GIT        +R+++ D NDN P F   P+S +          I + EN   G  I LP+A DLD              +P    ++ +KL+S  +  C +    +++ +D     L     IDRE  + F   ++A D+G+P   S T S+SI+  V D NDN P F++S   + V+EN   G+ +  ++V D D G NS++SY          N +  T   + +       DG+ L+L   LDYE  + F+F ++ +D GTP L STATV+V V N ND+PP I F+N+G++++ +   L   E+     PK   I  +HV DKD+ L ++ CE+S P+ +F LRE  + N I+++K++EL +L + DRE +  Y + + C D  T ++L    +I++ + D NDNPP+F  S  FG ++E       D  D   +        M+   I+ TDAD G N+ I Y L     ++  N T     D ++F ++    Q+K   P+DYE    +   ++A D       AL+++ ++ I+V D +DN P +    Y+F V E  P  T +G++ A+DAD+   NR + +++ +L                G                   F I+ ++G I+T   LD E+   V+  V   + +      +  +  SS+  + + ++D NDN+P +    SL        L ++  I+         +C  FPY F+D DE    N  V VTL  NPNF        +CLK          ++P   G ++++V+ QD
Sbjct:   12 LTIFWSLHITFACKYLQSIQILETNALQKSNLPSYLPAQSGIAQDVSINLTKIFQTELSISVEEARQTLIFFTDASESQPFAIKQLKDGSHMLTNELPIDREEICDPFKFPHHAAVSRKCCAKENSNDRHKTNPFNPQLDFRCCVFLGITVEGYGTFALRIDVVDVNDNPPRFHLPPESTLSHAGKETPGVIKIMENTAQGTIISLPQAFDLDEGRNADLLFRVEKISPLATWEHHFKLLSGPEDRCITNSLTESQQRDVTFPALCLLGTIDREAVTGFAFDLVARDQGEPVALSTTLSMSIV--VLDENDNAPTFKQSEFKVFVKEN-EVGKTLVHLRVVDFDSGENSRLSYFLRPGGHFVANQKLPTDFLRMHVLASPAPDGVVLRLMQPLDYETVSSFDFEVVVQDHGTPRLASTATVSVEVLNTNDQPPIIRFFNKGNLLNFDYANLEREEDTDNQSPK--VICHVHVYDKDTSLDEVFCEISSPQRLFDLREVRSENTIQRRKVYELISLAQLDRERSPSYLVNVRCVDGRTATRLLGQSQIRIILKDANDNPPLFQKSQFFGTVVENEANALVDFRDSFTNNGQSSTQFMSTSHIRATDADAGPNAAIHYSLAPWNREEDTNLTVPEKEDYEFFHIDKITGQLKTLVPLDYETKSSYYLLVIATDQPLNASQALSSTAKLIITVKDLDDNLPTMLQHNYSFEVTESMPSHTVVGRVEATDADSLPENRIITYQLRALSVPLPGGDSAASSAAAGVTTSIATTTTTTSTATLHFFTIDKHSGIIRTTRPLDREQTPKVTLEVVAHSGSPERFRSNNANSPSSTATVVITVLDKNDNAPYMV---SLASPDKKRVLLAEVVILPDELQGEPPVCVSFPYAFIDDDEQFSGNGNVTVTLDSNPNFEFSEDRTKLCLKMDKKRGTKKSITPPPLGRYSLNVLAQD 950          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A158QIS0 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10064 PE=4 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 7.741e-94
Identity = 263/876 (30.02%), Postives = 429/876 (48.97%), Query Frame = 3
Query:  405 QAEKDNIYFTDRKNSQPF---SLSHGKLIVTGPL--DREKICSP---QTDQNLIQKCC------------------ESSCCMFIGITSPNRKINYIRVNIEDENDNEPIF---PQSYIK---------IAVHENVEIGHTIVLPKAEDLD--------------TPSYGID-NYKLIS--DKSCGSCFEVKNEPKDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKP-SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIE---DYTSQAQRYFKLFQIK-------DGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKH--QTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIME------TDLTD-------QDVHMTE-GVIQVTDADIGMNSRIKYHL-----KDALNST-----DSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD---GGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEML---SLDGTKRRQRQN--------DLFIIENNTGFIKTRVVLDHEKDQHVSFLV--------RVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASN--LCSEFPYTFLDADEGL--NAEVVVTLKENPNFSLDMGHNLICLKNLH---------LSPGYFTVSVIGQD 2648
            +A++  I+FTD   S+PF    L  G  I+T  +  DRE+IC P        + QKCC                  + +CC+F+GIT        +R+++ D NDN P F   P++ +          I + EN   G  I LP+A DLD              +P    + ++KL+S  + SC +    ++  +DN    L     IDRET   F   ++A D+G P + + +LS+ + V D NDN P F++    + V+EN   G+ +  + VTD D G NSQ+SY++       +  +      Q+        DG+ L+L   LDYE  + F+F ++A+D GTP L STATV+V V N ND PP I F+N+G++++     +   E+   H  + I  +HV D+D+ L ++ C++  P+ +F LRE  N N I+++K++EL +L++ DRE T  + +++ C D  T ++L    +I++ + D NDNPP+F  S  FG ++E       D  D       Q    T    I+  DAD G N+ I Y L     ++  NST     D Q+F ++    Q+K + P+D+E    +   ++A D       AL++S +I I+V D +DN P +  + YTF V E  P  T +G++ A+DAD+   NR + +++    S DG       +          F I+ + G I+T   LD E+   ++  V        R+R T    G+       SS+  + + ++D NDN+P +    SL   +    L ++  ++I +  +  +  +C  FPY F D D+ +  N  V VTL  NPNF L+     +CLK            + PG ++++++  D
Sbjct:   75 EAQQAVIFFTDATESRPFVIKQLKDGSRILTNEMAIDREEICDPFKYPHHAAVSQKCCGKERGDGEYKKNSFNPQLDFNCCVFLGITVEGYGAFALRIDVVDVNDNIPSFSIPPEATLGHVGKDKSAVIKIDENTSQGTIIPLPQAFDLDEGKNSDLLFRVEKVSPLAAWEQHFKLLSGPEDSCVTYSLTESRNRDNSFPALCLLGTIDRETVPGFTFDLVARDQGDPVALSTTLSMSISVIDENDNAPTFKQKDFKVFVKEN-EVGKTLVHLHVTDLDAGENSQLSYHLRPGNHLIANQKPSADFLQMHILASPAVDGVVLRLIQPLDYEAVSSFDFEVVAQDYGTPRLASTATVSVEVLNTNDMPPVIRFFNKGNLLNSEYASIEREEDTDNHLPKVICHVHVYDQDTSLDEVFCDIRSPQRLFDLREVSNGNTIQRRKLYELISLVQLDREKTPSHSVSVRCVDGRTATRLIGQSQIRIFLKDANDNPPLFEKSQFFGTVIENEANALVDFKDSFSNYGKQPSQFTSPSHIRAIDADAGPNAAIAYSLAPWTREEDSNSTVSEKADYQFFHIDRFTGQLKTRVPLDFETKSSYYLMVIATDQPLNASQALSSSAKIIITVKDLDDNPPMMLQQTYTFEVTEGMPSHTVVGKVEATDADSLPENRIINYQLRAPPSEDGPSSTDTTSTIPVNVAFQFFTIDKHHGIIRTIRPLDREQTPKITLEVVAVSGSPARLRAT----GSTSP----SSTATVVITVLDKNDNAPFMI---SLAAPEKKRVLIAE--VVIPSDKLQGDPPICVPFPYAFNDDDDKMSGNGNVTVTLDANPNFELNESQTSLCLKTDKKAGQKKQSIIPPGRYSLNILALD 936          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A3R7JVJ3 (Protocadherin-9 (Fragment) OS=Clonorchis sinensis OX=79923 GN=PCDH9 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 7.266e-86
Identity = 244/865 (28.21%), Postives = 391/865 (45.20%), Query Frame = 3
Query:  423 IYFTDRKNSQPFSLSHG-------KLIVTGPLDREKICSPQT---DQNLIQKCC---------------ESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFP-----------QSYIK-------IAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLIS--DKSCGSCFEVKNEPKDNRL-----------------------------VLVFKTKIDRETNSVFNLLVLAIDRGKP-SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQ-------AQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQL-------TLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDV-HMTEG---------VIQVTDADIGMNSRIKYHLKDAL---------------------------NSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPA---LTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLD------------FYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTS-DIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLIC 2591
            +YF+D + S+PF +          +L  T   DRE IC  +       + Q CC                  CC+++G+T  ++   +IR+++ D NDN P F             +Y K       I++ E         LP A D D    G   Y + +  ++     F + N  K   L                             ++V +T +DRE+ + FNL ++A D G+P  ++ ++ + + V D NDN P FE++   + V EN ++G  +  +K  DSD   N ++ Y ++   +         + + +L  + DG++L+L   LDYE    F F ++A DQG   L S+A++ + V N+ND PP I F+  G  ++ +  +L       T+P+       +  +HVTD DS L  I C V      F LRE     +++++KI+EL      DRE+T    ITI C D +  S+L    ++ + + DVNDNPP F    + G + E  +    V H++           VI   D D G+N+ I+Y L+  L                           +S D+  F ++    Q++ +  +D EK K ++F  VA+D  +P     TA+ ++TI V D NDN P +  + Y F V E  P  +++GQI  +DAD    NR  ++E+  +      Q    +  IE++TG I+TR VLD E+ Q + F+V  RN   Y   +   D            FY  + ++TV++ D NDN+P +  + S         LS+   I   T+  I  + C EFPY F DAD+  N EV V ++ NP F   + + LIC
Sbjct:   95 VYFSDAEQSRPFVIRRQTDGHPWYQLTTTVLPDRENICDKRMYPERMTVSQACCPLEFTAPAELSLTPTNYPCCVYLGVTVLSKGTYFIRIDVGDVNDNAPFFTAVNSNTNRNFMSTYRKEIIGKVIISIPEGTPPNSWFALPMATDPDEGMNGAIRYSISTSGEERWAEYFRLLNNLKTASLPVNSTQVNVAWNNAGTTGHLSLGDYSGPGLMVLQT-LDRESIADFNLRLVAADLGEPIGRSSTIQLQILVLDENDNAPVFEKTVYEVEVNEN-QAGIPLLYVKANDSDSDNNGRVVYFMKPSRTDNTVSFDFLRTHIQLVPMNDGVTLRLSQPLDYERSPAFHFDLVAADQGRVPLSSSASILITVRNMNDHPPLIRFFLHGEPLEHDYARLSVTEHFGTVPKQSLHDNLLCHVHVTDADSNLDKIQCNVESGDRKFVLREVMTDQLVQRRKIYELIATTLLDRESTPTQLITIRCQDDDGPSRLVSQKQLHLTLKDVNDNPPKFLQEQYHGYVSENAVNAIVVFHLSNATWKDGIDSNVICAVDNDTGINANIQYLLQRWLEEEKVTKHGTENGSQIEDEKNSVLRYDHSQDANQFYIDPTTGQLRTRTALDCEKQKLYRFVAVAMDKAQPPESRYTATVRVTIEVRDENDNPPVMDKRHYVFKVKENLPRHSRVGQIHTTDADVSPENRRTVYELRDIVNINASQ----MLFIESHTGVIRTRKVLDREEIQQIPFVVIARNEFPYTTQQTLRDSIQGHSNMNNSKFYDEA-SVTVEVEDENDNAPVMLPRGSDRQSSTTDGLSTVADITFNTNIKIQHSPCVEFPYYFADADDQSNGEVDVVMEPNPYFEFRLANTLIC 952          

HSP 2 Score: 98.2117 bits (243), Expect = 9.612e-17
Identity = 152/638 (23.82%), Postives = 264/638 (41.38%), Query Frame = 3
Query:  381 LLTSSLISQAEKDNIYFTDRKNSQPFSL---SHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLI---SDKSCGSCF---EVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRP---------HFEESTISLSVEEN-GRSGRE------IKRIKVTDSDIGANSQMSYNIEDYTSQAQRYF--------KLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTP-YLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHV---TDKDSKLSDILCEVSHPKDV---------FYLRE-------TENVNIIEKKK--------------------IFELQNLIEFDRETTSIYRITITCSDSNTI--SKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIG-MNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD----GGKPALTASTQ---------------ITISVSDANDNRP 2009
            L T+SL   + + N+ + +   +   SL   S   L+V   LDRE I     D NL  +   +     IG +S  +    +++ + DENDN P+F ++  ++ V+EN + G  ++  KA D D+ + G   Y +    +D +    F    ++  P ++ + L     +D E +  F+  ++A D+G+   + S SI++ V ++ND+ P           E     LSV E+ G   ++      +  + VTD+D   + ++  N+E       R F        +L Q +    L   + LD E+       I  +D   P  L+S   + + + ++ND PP+ L       V  N++             I++ H+   T KD   S+++C V +   +          +L E       TEN + IE +K                      +L+     D E   +YR      D      S+ T +V + +++ D NDNPP+     +  K+ E    +   H   G I  TDAD+   N R  Y L+D +N   SQ   + S    I+ ++ +D E+ +Q  F ++A +      +  L  S Q               +T+ V D NDN P
Sbjct:  272 LKTASLPVNSTQVNVAWNNAGTTGHLSLGDYSGPGLMVLQTLDRESIA----DFNL--RLVAADLGEPIGRSSTIQ----LQILVLDENDNAPVFEKTVYEVEVNEN-QAGIPLLYVKANDSDSDNNGRVVYFMKPSRTDNTVSFDFLRTHIQLVPMNDGVTLRLSQPLDYERSPAFHFDLVAADQGRVPLSSSASILITVRNMNDHPPLIRFFLHGEPLEHDYARLSVTEHFGTVPKQSLHDNLLCHVHVTDADSNLD-KIQCNVE----SGDRKFVLREVMTDQLVQRRKIYELIATTLLDRESTPTQLITIRCQDDDGPSRLVSQKQLHLTLKDVNDNPPKFLQEQYHGYVSENAV-----------NAIVVFHLSNATWKDGIDSNVICAVDNDTGINANIQYLLQRWLEEEKVTKHGTENGSQIEDEKNSVLRYDHSQDANQFYIDPTTGQLRTRTALDCEKQKLYRFVAVAMDKAQPPESRYTATVRVTIEVRDENDNPPVMDKRHYVFKVKE----NLPRHSRVGQIHTTDADVSPENRRTVYELRDIVNINASQMLFIESHTGVIRTRKVLDREEIQQIPFVVIARNEFPYTTQQTLRDSIQGHSNMNNSKFYDEASVTVEVEDENDNAP 878          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 241.506 bits (615), Expect = 2.326e-65
Identity = 212/765 (27.71%), Postives = 355/765 (46.41%), Query Frame = 3
Query:  492 PLDREKICSPQTDQNLIQKCC----ESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCF--EVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLK-ENPN--FSLDMGHNLICL-KNLHLSPGYFTVSVIG-QDRNGGNGSRRAECLINIHLKSSTVNKPINNPKL 2744
            P+DRE +     D  +  K C    E S    I   SP  ++   R+ ++D NDN P FP   + ++V EN  +G T  +P+A D DT   G+  Y L +     + F  ++ N+  +    L+    +DRE    ++L + A+D G PS+  S  + + + D NDN P FE+S+    V EN   G  + ++K  DSD+G N ++ Y I   +       K+ QI+     + ++  LD E  + F+F +IA+D+G     ST  V++ VT+ ND  P +     G     + +   + E+ P    + L+ V+DKD   + ++  V      F LR   + ++  KKK F LQ     D E    YR+ I   DS   + L+ +  +++++ D NDN PIFS       + E +  +++    E V+ V   DAD G N+ + Y +    +S+    F ++    +++ + P+D E  ++++F + A D G P+   +  + I V D NDN P+     Y+FSVLE  P  + +G +   D D  + N  V   +    G          F+++N TG I + +  D EK+   +F ++  +  E           SS V +T+ ++D NDN+P       ++ + + S      P+    S +   + +E      D D G NAE+V ++   NP+  F +      I L K L    G     V+   DR  G  SR A  L++I+     VN+ I+N  L
Sbjct:   79 PIDRETL----KDCRIKGKPCFLEFEVSVTDLIQNQSP--RLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVP---KMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF-LQTTTPLDYERIRDYRVEIVAVDSGNPA-LSSTNSLRVQVTDTNDNSPIFSP-----PLFEVEFAEEN-QPGEKVLDVIALDADSGTNAELVYSI--IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGE-NAQVQLSVEPDVGN---------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGE--------PPRSSYVGVTINVLDENDNAP-------VVTKPSNSSFRRLSPLAAPDS-VVEVVEAE------DIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDR--GKPSRHAIALVHIY-----VNETISNVSL 784          

HSP 2 Score: 119.783 bits (299), Expect = 6.360e-27
Identity = 130/544 (23.90%), Postives = 229/544 (42.10%), Query Frame = 3
Query:  465 SHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH--------ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISD-----KSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYN-IEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFS--SSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDN----RPEIGNKFYT 2033
            S G + V GPLDRE+I S +       K             SP     Y+ + + D+NDN P      I +  H        E++ +G  + L +  D D     +    +  D     +  G    V N+ K     L   T +D E    + + ++A+D G P+ + + S+ ++V D NDN P F      +   E  + G ++  +   D+D G N+++ Y+ I D +++      LF+I      ++ +S LD E+K  +EFR+ A D+G P    TATV ++V + ND  P+ +          +S   ++ EN P    + ++ V D D K  +   ++S   DV         N + +     + + I FDRE  S Y   +   D     + +  V + + + D NDN P+ +  S+  F ++      D  V     V++  D D G N+ + Y +         + F ++    +IK  + +  +     +  +   D GKP+  A   + I V++   N       +G+  YT
Sbjct:  298 STGIISVKGPLDREEISSFKFHVIARDKG-----------PSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDS-SVDNKKK---YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRG-----LFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML---------SSYSFSVLENMPPLSPVGMVTVLDMD-KGENAQVQLSVEPDVG--------NFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR-SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVE----VVEAEDIDYGSNAELVYSIA---GGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVSLVEGLVGHSLYT 795          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 243.047 bits (619), Expect = 2.857e-65
Identity = 208/757 (27.48%), Postives = 351/757 (46.37%), Query Frame = 3
Query:  492 PLDREKICSPQTDQNLIQKCC----ESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCF--EVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLK-ENPN--FSLDMGHNLICL-KNLHLSPGYFTVSVIG-QDRNGGNGSRRAECLINIHLKSSTVN 2720
            P+DRE +     D  +  K C    E S    I   SP  ++   R+ ++D NDN P FP   + ++V EN  +G T  +P+A D DT   G+  Y L +     + F  ++ N+  +    L+    +DRE    ++L + A+D G PS+  S  + + + D NDN P FE+S+    V EN   G  + ++K  DSD+G N ++ Y I   +       K+ QI+     + ++  LD E  + F+F +IA+D+G     ST  V++ VT+ ND  P +     G     + +   + E+ P    + L+ V+DKD   + ++  V      F LR   + ++  KKK F LQ     D E    YR+ I   DS   + L+ +  +++++ D NDN PIFS       + E +  +++    E V+ V   DAD G N+ + Y +    +S+    F ++    +++ + P+D E  ++++F + A D G P+   +  + I V D NDN P+     Y+FSVLE  P  + +G +   D D  + N  V   +    G          F+++N TG I + +  D EK+   +F ++  +  E           SS V +T+ ++D NDN+P       ++ + + S      P+    S +   + +E      D D G NAE+V ++   NP+  F +      I L K L    G     V+   DR  G  SR A  L++I++  +  N
Sbjct:  115 PIDRETL----KDCRIKGKPCFLEFEVSVTDLIQNQSP--RLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVP---KMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF-LQTTTPLDYERIRDYRVEIVAVDSGNPA-LSSTNSLRVQVTDTNDNSPIFSP-----PLFEVEFAEEN-QPGEKVLDVIALDADSGTNAELVYSI--IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGE-NAQVQLSVEPDVGN---------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGE--------PPRSSYVGVTINVLDENDNAP-------VVTKPSNSSFRRLSPLAAPDS-VVEVVEAE------DIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDR--GKPSRHAIALVHIYVNETISN 817          

HSP 2 Score: 120.168 bits (300), Expect = 6.356e-27
Identity = 130/544 (23.90%), Postives = 229/544 (42.10%), Query Frame = 3
Query:  465 SHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH--------ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISD-----KSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYN-IEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFS--SSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDN----RPEIGNKFYT 2033
            S G + V GPLDRE+I S +       K             SP     Y+ + + D+NDN P      I +  H        E++ +G  + L +  D D     +    +  D     +  G    V N+ K     L   T +D E    + + ++A+D G P+ + + S+ ++V D NDN P F      +   E  + G ++  +   D+D G N+++ Y+ I D +++      LF+I      ++ +S LD E+K  +EFR+ A D+G P    TATV ++V + ND  P+ +          +S   ++ EN P    + ++ V D D K  +   ++S   DV         N + +     + + I FDRE  S Y   +   D     + +  V + + + D NDN P+ +  S+  F ++      D  V     V++  D D G N+ + Y +         + F ++    +IK  + +  +     +  +   D GKP+  A   + I V++   N       +G+  YT
Sbjct:  334 STGIISVKGPLDREEISSFKFHVIARDKG-----------PSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDS-SVDNKKK---YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRG-----LFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML---------SSYSFSVLENMPPLSPVGMVTVLDMD-KGENAQVQLSVEPDVG--------NFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR-SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVE----VVEAEDIDYGSNAELVYSIA---GGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVSLVEGLVGHSLYT 831          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 239.58 bits (610), Expect = 1.174e-64
Identity = 184/647 (28.44%), Postives = 309/647 (47.76%), Query Frame = 3
Query:  615 RVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCF--EVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            R+ I+DENDN P FP   +++A+ EN  +G    +P A D D  S GI +YKL S     + F  +V +   +    L+    +DRE    ++L +  ID G P +  S  + + + D NDN P FE S     + EN   G+ + ++K  D D+GAN Q++Y+    +   QR   +     GI +Q++ ++D E   + +F + A+D G     S A VT+ V + ND  P I     G +   + I   + E+ P    + L+ V+DKD   + ++  V      F LR     +   K+K F LQ     D E    YRI I   DS   + L+ +  +++++ D+NDN P+FS S +     E D  +++    + V+ V  TDAD G N+ + Y +    +S     F +N    +++    +D E  ++++F + A D G P+L  +  + + V D NDN P+     Y+FSVLE  P  + +G +   DAD  + N  V   +         + +N  F+I+N TG I + +  D EK+   +F ++  +  +           SS V IT+ ++D NDN+P        + + + S     +P+    + +   + +E      D D GLNAE+V ++
Sbjct:  130 RIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDH-NTGI-IQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIA-NVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYF-LQTTTPLDYERIKEYRIEIVAVDSGNPA-LSSTNSLKVQVTDMNDNAPVFSPSLY-----EVDFAEEN-QPGDKVLDVVATDADSGTNAELLYSI--ITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGE-NAHVQLSV---------EPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPP--------RSSYVGITINVLDENDNAP-------YVTKPSNSSYKFLQPLTSPDTRV-EKVDAE------DIDTGLNAELVYSI 731          

HSP 2 Score: 143.665 bits (361), Expect = 2.780e-34
Identity = 144/574 (25.09%), Postives = 245/574 (42.68%), Query Frame = 3
Query:  948 LEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGI-----SLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSH---PKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETD-----LTDQDVHMTEGVIQVTDADIGMNS--------RIKYHLKDALNSTDS----QYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLK-ENPNFSLDMGHNLIC 2591
            +E++D NDN P F    + L++ EN   G         D D G+N    Y + +  S A   F L Q+ D        L +   LD E ++ ++  I   D GTP   S+A + + +T+ ND  P+          + +  +  + EN P  Q+++ +   D D   +  +    H   P     L    N  II+ K           DRE   + + ++   D+   +K ++++ + + + D NDN P       FG +   D       D  V     +++V+D D G N+         + + L+ A +++DS    +YF        ++   P+DYE+ K+++  +VAVD G PAL+++  + + V+D NDN P      Y     EE   G K+  +VA+DAD+   N ++++ +++   TK       LF I  NTG ++    LD E  +   F V   +          +     +  + V+++D NDN PK  L          S L +  P           L      T +DAD+G NA V ++++ EN  F +  G   I 
Sbjct:  131 IEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKL-NSGSDAMNLFSL-QVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKF---------ERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKG--------SVDREEVPLLKFSVQARDNGPQAKSSKAM-VTITVKDRNDNAPSIRIR-GFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSA-SASDSTSKRKYF--------LQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSG-TNAELLYSIITDSATK------GLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKG--------VPSLKGTATVVVRVLDRNDNDPKFMLNGYSF-----SVLENMPP-----------LSPVGMVTVIDADKGENAHVQLSVEPENGKFVIQNGTGTIL 643          

HSP 3 Score: 108.997 bits (271), Expect = 1.327e-23
Identity = 130/547 (23.77%), Postives = 227/547 (41.50%), Query Frame = 3
Query:  471 GKLIVTGPLDREKI----CSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH--------ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDN-----RLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFS----SSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDN----RPEIGNKFYT 2033
            G + V G +DRE++     S Q   N  Q   +SS  M             + + ++D NDN P        +  H        E++ +G  + L +  D D     +    +  D      F++++    +     +  L   T +D E    + + ++A+D G P+ + + S+ ++V D+NDN P F  S   +   E  + G ++  +  TD+D G N+++ Y+I   T  A +   LF I      +++ + LD E K  +EF + A D+G P L  TATV VRV + ND  P+ +          N    ++ EN P    + ++ V D D        E +H   V    E EN   + +     + + I FDRE  S Y   +   D     + +  V I + + D NDN P  +    SS+ F +     LT  D  + +  +   D D G+N+ + Y +           F ++S   +I   +    + +   +  +   D GKP+   +  + I V++   N       +G+  YT
Sbjct:  312 GIIQVKGSVDREEVPLLKFSVQARDNGPQ--AKSSKAM-------------VTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGD----VPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSI--ITDSATK--GLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFML---------NGYSFSVLENMPPLSPVGMVTVIDADK------GENAH---VQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPR-SSYVGITINVLDENDNAPYVTKPSNSSYKFLQ----PLTSPDTRVEK--VDAEDIDTGLNAELVYSIT---GGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFVNETISNVTLVESLVGHSLYT 807          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 232.646 bits (592), Expect = 2.772e-62
Identity = 202/702 (28.77%), Postives = 334/702 (47.58%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGIT-SPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            +DREK+C   + +       +S C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D D     +  Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+ES I + + E+   G  + +++ TD+D+GAN+++ Y      S A R  +LF +     L  +Q  LD E     +  ++A D  +    + ATVT+ VT++ND  P I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       + E +   +D+++T   I  TD D G N+ I Y L       ++ +F ++ +   +      D E  ++F F + A D G  AL +   + +++ D NDN P+  +  + F V E  P  + +G I  +DAD  + N  V   +L+          N+ FI++  TG IK+ V  D E+    +F VR  ++             SS+  +T+ +ID+NDN P        IV    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   92 IDREKLCPGPSYE-------DSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATR--RLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSS--SARATVTINVTDVNDNAPNIDLRY----IISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELTVSENN--KRDLYLT--TITATDEDSGRNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVSLSILN---------DNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPP--------CSSAAKVTINVIDVNDNPP--------IVIYPPSNTSFK---LVPLSAIPGSVVAEV--FAVDGDTGMNAELKYTIVNGNNKGL 724          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 231.491 bits (589), Expect = 5.372e-62
Identity = 202/702 (28.77%), Postives = 334/702 (47.58%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGIT-SPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            +DREK+C   + +       +S C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D D     +  Y+L++ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDNRP F+ES I + + E+   G  + +++ TD+D+GAN+++ Y      S A R  +LF +     L  +Q  LD E     +  ++A D  +    + ATVT+ VT++ND  P I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       + E +   +D+++T   I  TD D G N+ I Y L       ++ +F ++ +   +      D E  ++F F + A D G  AL +   + +++ D NDN P+  +  + F V E  P  + +G I  +DAD  + N  V   +L+          N+ FI++  TG IK+ V  D E+    +F VR  ++             SS+  +T+ +ID+NDN P        IV    S  S +   ++  S I  ++ +E     +D D G+NAE+  T+    N  L
Sbjct:   92 IDREKLCPGPSYE-------DSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATR--RLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSS--SARATVTINVTDVNDNAPNIDLRY----IISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELTVSENN--KRDLYLT--TITATDEDSGRNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVSLSILN---------DNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGH--------PPCSSAAKVTINVIDVNDNPP--------IVIYPPSNTSFK---LVPLSAIPGSVVAEV--FAVDGDTGMNAELKYTIVNGNNKGL 724          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 203.371 bits (516), Expect = 8.967e-54
Identity = 186/662 (28.10%), Postives = 318/662 (48.04%), Query Frame = 3
Query:  471 GKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFIGI----TSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLI-SDKSCGSCFEVK-NEPKDNRLV--LVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNI------EDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD-SKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLK-DALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKES 2393
            G+L   G  +DRE +C  Q   +      E    + +G+      P  K+  +R+N+ED NDN P F    + ++V EN   G    +  A D D+ + G+  Y+L+ SD +  S FE+   E  +   V  LV +  +DRE   ++ + + A+D G P  +GS  + + V D NDN P F+++ +++ + EN   G  + ++  +D D G+N+++ Y +             +R F+L Q   G+ + +   L+ E   ++   I+A D+G   + +TATVTV VT++ND  P I   +   IV P +  + + E    +  + LI V+D D      + C + +P+  F L          KK  +  Q L+E     D ET + Y + I  +D+   S L++++ + +K+ D NDN P+F+   +   + E ++  +  H+    +  TD D+  N+ + Y L  DA        F ++ E   I   E +D EK   + F ++A D G P L  +  + ++V D NDNRP      + F V E  P  + +G +  +D+D  +  R      LS+ GT  RQ    LF I+  +G I++ V  D E+  +    V+  +  E V         SS+V + + ++DINDNSP + +  S
Sbjct:   93 GELFAAGRKMDREALCGGQDPGD------ECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQ-NSGL-VTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRD---IVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQL----------KKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATS-LSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGK--HLI--TVSATDRDMDKNAEMVYFLGPDA-----PTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGR----VRLSILGTDNRQ----LFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPV--------RSSTVKVVIHVMDINDNSPIVLMPPS 707          

HSP 2 Score: 130.568 bits (327), Expect = 5.704e-31
Identity = 139/596 (23.32%), Postives = 255/596 (42.79%), Query Frame = 3
Query:  690 NVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNI--EDYTSQAQRYFKLFQIKDGIS---LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYL--RETENVNIIEKKKIFEL-QN--LIE----FDRETTSIYRITITCSDSN---------------TISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKE 2390
            N+E+ + ++L KAED   P   +       +   G  F      K +R  L        E +    + VL +  G   K   + + + VEDINDN P F    +++SV EN  +G+        D D  AN    Y +   D  + +     + +  +G     L ++ +LD E + ++E  + A D G+P    +A + + VT+ ND  P         + D   + + +PEN P    ++ +H +D+D+         S+ + V+ L        +    K++F L QN  L+      +RE + +YRI I  +D                  ++  + ++EI+  +  VN            G I  ++ +   V++   +I V+D DIG N  +  ++ +       +  +  ++Y  ++ +E +DYE   ++   + A D G  +L+ +  +TI + D+NDN P      Y  SV E   IG  +  + A+D D D+ N ++++  L  D          +F ++  TG I     LD EK  + SF +  ++          +     +  + V ++D+NDN P+ +L E
Sbjct:   66 NLELTYKVMLSKAEDAAPPLVRV-------NPRTGELFAAGR--KMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKL--IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSP---------VFDQAEVNVEIPENSPVGTHVVQLHASDRDAG--------SNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVN------------GVIYISEAS--HVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQY-LLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDK-NAEMVY-FLGPDAPT-------MFHMDPETGIISLTEQLDREKKANYSFTILAKDQG--------IPVLEGNATVIVNVLDVNDNRPRFSLAE 601          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 1.512e-47
Identity = 173/691 (25.04%), Postives = 303/691 (43.85%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESS--------CCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCG------SCFE------------VKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHF-EESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIE-DYTSQA-QRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP--EILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDIL---------CEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTE----GVIQV----TDADIGMNSRIKYHLKD-ALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPE-IG-----NKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNT--GFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            G+L V   LDRE +C  + D       C S+          M  G  S N ++  +++ + D ND+ P F   ++ +++ E+  +G  + LP+A D D  +  I +Y++ +    G      S  E              +    +R +L  + ++DRE    + LL+   D G P  +GS+ + + V D NDN P F +  T  + + E+ + G  + +++  D D G N  ++Y+     TS A Q    +      ++++    LD E   +    ++A+D G     ++ TVTV + + ND  P  E++   +G  +    +++   EN P    ++LI V+D D   S  +          E++ P  V +L +T  +                 D E    Y +++  +D  T  KL++ + + + + D+NDN P+F +       +E D+   +V + E    G + +    TDAD G N  I + L + A   + ++ FS+N    Q+    P+D EK  +++  + A DGG P   A   + ++V D NDN P  +G     N  Y F V EE  +GT +G +  SD D    N  V   ++       R+   D      +T  G ++T VVLD E        VR  ++             S+S  +++ + D NDN+P
Sbjct:   81 GELSVALRLDREALCMEEPD------ACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIAL-QGEYLPDGGVKIV--ENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRL----------------LDYEEAQQYNVSVLAADRGT-PKLSKLLNLIISVVDINDNTPVFMNPAS----IEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGD-NARVALNLV-------REAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPA--------LSASCRVSITVSDTNDNAP 725          

HSP 2 Score: 151.369 bits (381), Expect = 1.991e-37
Identity = 152/586 (25.94%), Postives = 269/586 (45.90%), Query Frame = 3
Query:  624 IEDENDNEPIF---PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKT-KIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVE----------ENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQST--LDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSI-VDPNSIQLTLPENGPKHQTIILIHVTDKDS----KLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQD--VHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQ--IKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEI--------GNKFYTFSVLEEQPIGTKIG-QIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIK-TRVVLDHEKDQHVSFLVRVRN 2276
            + D NDN P+F   P   ++I  H   ++G ++V  +A D D    G   Y   +  +  +     +      LV V    K+DRET  V  L+V+A D G+ S++ S+++ +E+ D NDN P FE   I+L  E          EN  SG  +  I V+D D+G++  +   +E + + A+         + +   L++T  LDYE    +   ++A D+GTP L     + + V ++ND  P  +F N  SI  D    +++L ENGP    ++ +  TD DS     ++  L E++  + V    E  ++N+    +  +L      DRE    Y +++   D  +  +  +++ +++ + D NDN P F    +    M     +++  V    G +  +D D G N+R+  +L   +      +     + P   ++    +D E   Q++  + AVD G+PAL+AS +++I+VSD NDN P I             TFS     P G  +G  + A+D D     R  ++E++             +F++  ++G +   R V   ++  H   +VRVR+
Sbjct:  262 VVDANDNAPVFVDPPTRPVRITEHS--KVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFE--VIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE-FPTGAE-----LASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTP--VFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESV---AELFSLNM----RTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAI-VRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNL---VREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFS-----PAGMLVGVSVTANDIDAGDNGRP-LYEIIG-------GNPKGIFLLNADSGALSLARTVSSLDEGLH-RLVVRVRD 810          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 9.695e-45
Identity = 181/727 (24.90%), Postives = 303/727 (41.68%), Query Frame = 3
Query:  297 YPCDYISVITVTEN--IPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDR--------EKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEEN----GRSGRE-IKRIKVTDSDIGANSQMSYNI---EDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDIL---CEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDS--NTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQD--VHMTEGVIQVTDADIGMNSRIKYHLK------DALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL 2384
            +P DY S I + +   IP PSS      +L L   L  + E   ++FT        +  HG   V  PLD            C      +L+    ++    FI    P    N + +++ED NDN P+F    +++ V EN   G  I    A D D     +  Y ++S        +  +       VL    ++DRE  + + L V A D G  +    LS+   V D NDN P F     S  V E+    G++ R  I  +   D+D G   +++Y +   ED +  A   F L  +    +L +   LD E++  +  R  A D G   L +TA + V V + ND  P          V  +S+   +PE+ P   +++ I  TD D  ++  L        P+  F +     +++               DRE  S Y + +  SD   +  ++L+ +V + + + DVNDN P F+S         + L  +D  V      +Q  D D G NS ++Y L                 F++N+   +++    +D E  + +   ++AVD G+P LT++  + ++V DANDN P    + Y  ++ E++P GT++ ++ A D D +  N ++ +++ S D T         F ++   G +     LD E+       VR R+              S + ++ V + D+ND SP   L
Sbjct: 1401 FPQDYESPINLLQGQTIPMPSS------YLFLRHHLDWEPEGQLVFFTLLLG---VTRGHG---VINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFI--RPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASG------VLRASRRLDREERASYLLTVRASD-GTHATDARLSVA--VRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSED-SDWADGAFGLHPVTG--ALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPS---------VQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARA-----------LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP-------RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPD-EGANGELRYDIASGDPTGD-------FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPA--------RSDTASVRVTLSDVNDCSPAFQL 2056          

HSP 2 Score: 161.77 bits (408), Expect = 2.636e-40
Identity = 169/705 (23.97%), Postives = 316/705 (44.82%), Query Frame = 3
Query:  435 DRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGI-SLQL---QSTLDYENKNIFEFRIIAKDQGTPY-LMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRET-ENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEI--GNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVE----QAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDA 2507
            D++ S     S G++     +DRE+       Q   Q    ++     G  S       + V + D N++ P+F ++  ++++ E+  +       +A D D+   G   Y+ I + + G  F +  + +     L  + ++DRET   ++L V A+D G    + S+++ + V D+NDN+P F  S+      E    G  +  ++ TD+D G+N  ++Y+ E    + Q  F+L      I SL++   ++ +       F F ++A D G P  L   ATV V V ++ND PP+            +  Q ++ E+      ++ +  +D D  ++  L         + + E  E           ++  L   DRE T+ Y + ++ +DS T S L  S  + +++ D NDNPP F+ S      +E+        + E +I +T  D D G +  ++Y +   +       F+++     +     +D+E  + ++  + A DGG+P  +++T + + V D NDN P    G+ F   S++E  PIGT++  + A D D D +N ++ + +       R+      F I+  +G I T   +D E    + F V VR T++ +    +    S+   +TV + D NDN+P+     +++V+     AGS + + +    +  D A N    +  T  DA
Sbjct:  699 DQRGSFSIEWSGGRIFTANAIDREE-------QAFYQLRVVANSGGVAGEAS-------VSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYE-IGEGNGGEKFGIFPDGQ-----LYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE----KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA---------KSVYQASVSESASNLTQLLRVTASDVDEGVNGALR--------YAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGT-SPLAASCTVAVQVLDENDNPPRFTESLLSVDALES------TRVGELLITLTASDEDTGPSGDVRYAI---VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFA--SIMENIPIGTRVITVTARDPDAD-VNGELHYSI------ARQFPPGAHFTIDPESGEICTAAEIDREVTGGL-FEVTVRATDKAIPVHTR---RSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQ---ASDPDEAENAAVRYAVTGGDA 1336          

HSP 3 Score: 157.147 bits (396), Expect = 8.576e-39
Identity = 148/602 (24.58%), Postives = 262/602 (43.52%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQ-SYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDN--YKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKL-FQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVS----HPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRR-------QRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            +RV + D NDN P FP+   +++A  E+  +G  ++L  A D D    G+++  YK++S    G     +   K   L L     +DRE N  + L V A D G P + G L + + V+D NDN P FE+     SV E              DS +GA       + D   + +    + F  K G+ +  +  LD+E +  +   + A D G P L   AT  +++ ++ND  P I F      + P +   ++ E+        L+ VTD DS  ++    VS    + +  F L    +   +   ++ ++ +  + DRE   +Y +TI  SD+      + +  + + ++DVND+ P F+ S +   + E       V      +   DAD G+N++++Y +   ++  D  +FSV+     +     +D E +      + A D G    TA T +T+++ D ND  P      Y  + +E    G  +  + A+D+D            L  +GT R         +  ++F +++ TG + T   LD E+ +    +V+ ++               S+  +TV + D+NDN P
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAE--------------DSPVGA------ALRDLLHRGRGPLAVPFDPKTGM-VSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFV----YLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVL----HAPGVPGLRVLKVAS--QLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKD----VTAMDADSGLNAKLRYSI---VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSD------------LGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPP--------LGSTAKVTVVVGDLNDNHP 552          

HSP 4 Score: 154.836 bits (390), Expect = 3.582e-38
Identity = 188/726 (25.90%), Postives = 314/726 (43.25%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIF-PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKI--DRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIK-DGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIF---ELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSS---FHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHL-KDALNSTDSQYFSVNSEYPQIKNKEPIDYEK------SKQFKFFLVAVDGGKP-ALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLI-VEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICL-KNLHL-SPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP 2726
            + V + D NDN P+F P  Y   ++ EN   G  +    A D D  + G   Y+L +  +    F+V      N +     T++  DRE  +V+ L V A+D G         + + V D  D  P F     S  V EN   G  +  +  +  D+ AN  ++Y I    S  QR    F I+  G  +   + +D E +  ++ R++A   G   +   A+V+V V ++N+  P         + D  S ++++ E+ P +     +  TDKDS  +    EV +        E    N  EK  IF   +L    E DRET   Y +T++  D+  +  L+ SV + + + DVNDN P+F+SS   FHF +       +Q+V    G +Q TDAD G N  + Y   K  +N      F ++SE  +I +    D E       +  F F +VA DGG+P  L     + + V D NDN P+     Y  SV E     T++ ++ ASD D + +N  + + +           +   F ++ +TG I     LD E+    + +V   ++    GT       ++S  + V+++D NDN P+    ESL+ V+   S    +  I +T SD  +    +  Y             +V    +  F++D     + L + L   +   + ++V  +D  GG   R +  ++ +H++    N P
Sbjct:  540 VTVVVGDLNDNHPVFYPVQYFA-SILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAA--RFQV------NAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN--VTYLI---VSGDQR--GSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAP---------VFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKN---GEVKY--------EIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTG-VEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCE-------EQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN------FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD-EGVNGALRYAI-------NEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDS----GTSP----LAASCTVAVQVLDENDNPPR--FTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRY------------AIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAED--GGRPPRSSATILVVHVRDFNDNPP 1180          

HSP 5 Score: 135.576 bits (340), Expect = 3.547e-32
Identity = 144/586 (24.57%), Postives = 257/586 (43.86%), Query Frame = 3
Query:  618 VNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIE-DYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            V + D ND+ P F  S    A+ E    G  +    A D D+       Y ++S    G  F V     ++  ++    K+DRE  S   L + A D+G   KT   S+ + + D+ND  P F ++    +  EN   G  +  +   DSD+G N  + YN + D  +Q +  F+L  +   ++  L+S LD E    +   + A+D+G+P L STA VTV V +LND  P  +FY       P     ++ EN P    +  +  TD D   +  +       D    +    VN +       +   +  DRE  ++Y++ +T  D   +   + ++ + + + D  D PP F+   +   + E      +V     V  V+ + + +N+ + Y +   ++      FS+     +I     ID E+   ++  +VA  GG   +     +++ V D N++ P      Y  S+ E++P+ ++   + A+D D+ + N +V +E+   +G ++       F I  + G +  R  LD E  +  S  V   +T         ++  SSSV + V ++D+NDN P
Sbjct:  329 VYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG-WFSVD----ESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVT-TLKS-LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHP--VFY-------PVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQ----VNAVTGA----VSTRVSLDREERAVYQLQVTALDGGHLRARSPAI-VTITVADAQDTPPTFARDDYSFVVFE------NVAPGTLVGSVSASTLDLNANVTYLI---VSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGK-NGEVKYEIGEGNGGEK-------FGIFPD-GQLYVRYELDRETREEYSLTVSAMDTG--------VEPLSSSVTVNVTVLDVNDNKP 860          

HSP 6 Score: 134.806 bits (338), Expect = 6.003e-32
Identity = 151/645 (23.41%), Postives = 263/645 (40.78%), Query Frame = 3
Query:  477 LIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRP-----HFEESTISLSVEENGRSGREIKRIKVTDSDI-GANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMS-TATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLA 2381
            L  TGPLDRE   S      L  +  +          SP R+   ++VN+  +D NDN P F +   + +V E+  +G  +      DL     G                 V  +PK    ++  +  +D E    + L + A D G P  +G  + ++++ D+NDN P     +   +  S SV+E+   G     + VTD+D   AN ++S +I     +         +     L++ S LD E   ++   I+A D G P   S TA++ V V ++ND  P             ++    L E  P    +  +   D DS L + +   +    D+ +    E+  ++            + DRE  S   + I+  D     K T    + + + DVND PP+F+ + +    +E  L    V      +   D+D+G N  ++Y+    + +   + F ++S   ++   + +D E+ +++   + A D G P L ++ ++T+ V D NDN P      Y  S+LE +P GT +  + A+D D    N  V +++ + D  +        F +   TG + TRV LD E+       V   +               S   +T+ + D  D  P  A
Sbjct:   88 LATTGPLDREANPS----YALAVQAEDGG--------SP-RRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRG--------------PLAVPFDPKTG--MVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFAL---------SAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDG--------KVDREVASSVVLNISAQDQGAQPK-TAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVS----VSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGA-NGTVRYQLTAGDAAR--------FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRA--------RSPAIVTITVADAQDTPPTFA 659          

HSP 7 Score: 111.694 bits (278), Expect = 7.174e-25
Identity = 119/512 (23.24%), Postives = 205/512 (40.04%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVE---------IGHTIVLPKAEDLDTPSYGIDNYKLI-SDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGT--PYLMSTAT-VTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDIL--CEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEE-QPIGTKIGQIVASDAD 2099
            + V + D NDN P F +      V E+           IG  +    A D D+  +G   Y L  S+ S  +       P    L +     +DRE+ + + L   A D G  + T  L +   V D NDN P  +  +++  V E+   G  + RI  TD D G N+++ ++I     + +     F + +   L +   LD E ++ +   +   D+    P  +S+A  V++ +T++ND  P        +   P S     PE+ P    +  +   D DS  +  +     +  ++                   E++ + E DRE    Y +T+   D      LT +  + + + D NDN P F    +   I E +    +V      +   D D G N  ++Y +     + D   F ++     +    P+D E++  ++  + A DGG PA + +  + +++SD ND  P      YT    E  Q     I Q+VA D D
Sbjct: 1603 LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVL----AGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVT--RPLDRESRACYVLRARATDGGGLAATARLYV--NVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR-----FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAP--------AFTSPRSA--LAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGR-PPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLR----LSAWDPDEGANGELRYDIASGDPTGD---FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDD 2083          

HSP 8 Score: 98.5969 bits (244), Expect = 5.682e-21
Identity = 87/332 (26.20%), Postives = 145/332 (43.67%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSC--------FEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLS 1436
            G+L V   LDRE+    Q+  NL+ +  + +         P R  + +RV++   D NDN P F      +A  E+  +G  +   +A D D+       Y L +D   G          F +     + RLV     ++DRE    + L VLA+D+G+P  T + ++ + V D NDN P F       ++ E+   G E+ R+   D D GAN ++ Y+I   +      F+L  +    +L +   LD E    +E  + A+D G P    TA+V V ++++ND  P            P ++       GP    ++++ V  +D  L 
Sbjct: 1783 GQLSVARALDRER----QSFYNLVVRVSDRARH------PPARLSSAVRVSLILTDVNDNAPAFTSPRSALA-PEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLV----RELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIA--SGDPTGDFRLDPVLG--TLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQL-------SPYTVHARENTQGPP---VLILQVVARDDDLG 2085          

HSP 9 Score: 95.1301 bits (235), Expect = 6.434e-20
Identity = 96/393 (24.43%), Postives = 165/393 (41.98%), Query Frame = 3
Query: 1245 PYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTD-QDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQY----FSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQ 2408
            P + S   V + V ++ND PP         +     ++L + EN  + + I  +  TD D   + ++           L  +E   +++      L+     DRE  + Y +T+  SD    +    SV ++    D NDN P FS   +   + E    D +      G +   DAD G    + Y L     S DS +    F ++     +    P+D E    +     A DGG   L A+ ++ ++V DANDN P + N      V E+ P GT + +I A+D D + +N ++ F + S D   R       F + N+ G +     LD E+    + +VRV +   +   +      SS+V +++ + D+NDN+P      S +  +
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPP---------VFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVT-------YSVLSGSEGAFVVDAASGV-LRASRRLDREERASYLLTVRASDGTHATDARLSVAVR----DANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAP---SEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATD-DDEGVNAELEFSISSGDPEGR-------FAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPAR-----LSSAVRVSLILTDVNDNAPAFTSPRSALAPE 1846          

HSP 10 Score: 69.707 bits (169), Expect = 4.496e-12
Identity = 62/263 (23.57%), Postives = 106/263 (40.30%), Query Frame = 3
Query: 1611 SKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVI--QVTDADIGMNSRIKYHLKDALNSTDSQYF-----SVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            S+ T   E+++ + DVNDN P    SF    +ME     +D  +   V+     D D+G N  + +H    ++  +              +  +    P+D E +  +   + A DGG P      Q+ ++V DANDN P      Y  SV E+ P+G  +              RD++           R R       +  TG + TR  LD E  +  +  +R  +     G    L   +++V   ++++D+NDN P +
Sbjct:    1 SQPTYPTEVRVVVGDVNDNAP----SFPEPGVMEVAFK-EDAAVGRQVLLDTAVDRDVGPNG-VNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL--------------RDLL----------HRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAAD-----GGNPPLSGRATAV---IQLLDVNDNDPAI 225          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 159.844 bits (403), Expect = 3.118e-40
Identity = 128/503 (25.45%), Postives = 229/503 (45.53%), Query Frame = 3
Query:  543 QKCCESSCCMF---IGITSPNRKINYIRVNIE--DENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI--KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI----LFYNRGSIVDPNSIQLTLPENGPKHQTII-LIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHL--KDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRP 2009
            Q+C ++  C+    +  T P      +   +E  D ND+ P F +S + + + E+V +G  + L  A DLD     +  Y L  ++  G     + +       LV K+++DRE    + L + A D G P ++G+  + + V D NDN P F +++ +++V E+   G  +  +  TD D G N ++ Y+         R  +LFQ+  K G  L L+  LD+E  + +E  I A+D G   + +   V V V ++ND  PEI    +  +RG  V            G  +++ + L+ V+D DS  + ++          +LR   +  ++  +  + +      DRE  + Y + +  SD  T  ++  + +  +++ D NDN P F  S +   ++E +      ++T   +   DAD   N  I Y++   +   ++ S Y S+N     I    P+DYE      F + A D G P L  +  +++ + D NDN P
Sbjct:   94 QQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGA-KYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVR--RLFQLDPKTG-KLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTV--------FVSEGAAYESFVGLVTVSDIDSAENGLVA--------CHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVA-ARQFTVRLLDENDNEPRFHRSTYEASLLENN--SPGAYVT--TVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAP 571          

HSP 2 Score: 112.464 bits (280), Expect = 2.169e-25
Identity = 113/489 (23.11%), Postives = 203/489 (41.51%), Query Frame = 3
Query:  948 LEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRY-FKLFQIKDGI---SLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI-------EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTE--GVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            +E+ DIND+ P F  S + + + E+   G  +      D D+G N+  +Y+++    + +R+   L    DG     L ++S LD E +  +  ++ A D G P    T  V + V + ND  P         +    S  +T+ E+      ++ ++ TD D     +++   S P D             E +++F+L           + D E  S Y I+I   D    S +    ++ + ++D+NDN P     F      +T    +        G++ V+D D   N  +  HL+        +      +Y  + N   +D E+   +   L A DGG P   A+ Q T+ + D NDN P      Y  S+LE    G  +  + A DAD +  N  + + ++  +        +    I  ++G I     LD+E    ++F V+ R+        D +    ++  ++V+I+D NDN+P
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLD----ENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSP---------VFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDA------------EVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGP-SSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR---GHPHFKLLPYRDDYVVVTNSS-LDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEH-NGMIAYNVVESEVAG--ASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARD--------DGVPPLVTNATVSVRIVDENDNAP 571          

HSP 3 Score: 84.7297 bits (208), Expect = 6.784e-17
Identity = 102/402 (25.37%), Postives = 175/402 (43.53%), Query Frame = 3
Query: 1425 SKLSDILCE--VSHPKDVFYLRETEN---VNIIEKKKIFELQNLIEFDRET----TSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKD------ALNS-TDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLS-LDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKII----DINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
             +LSD L      HP   F L   ++   V++ E       + +I+ +++     + + R  + C+       L Q V  ++++ D+ND+ P F+ S    +I E+      V + EG     D D+G N+   YHL +      AL + TD       ++Y ++  K  +D E+  ++   L A DGG P  + +T + I+V D+NDN P         +V E+   GT +  + A+D D +  N +V++   S +D   RR     LF ++  TG +  +  LDHE +      ++ R            D   SS+    K++    DINDN+P++ L    I++  G          +  S+ A+        T  D D   N  V   L+ +P+F L
Sbjct:   46 GRLSDDLQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCT---LPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPL-EGA---RDLDVGGNALRAYHLDENERFGLALRARTD------GAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVD-EGPNGEVVYSFSSPVDAEVRR-----LFQLDPKTGKLSLKGQLDHELNSEYEISIQAR------------DMGPSSIPAHCKVLVHVEDINDNAPEIKLD--FIMQSRGD--------TVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKL 406          

HSP 4 Score: 65.4698 bits (158), Expect = 5.793e-11
Identity = 62/280 (22.14%), Postives = 112/280 (40.00%), Query Frame = 3
Query:  477 LIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDN-----RPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYE-NKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLND 1298
            ++    LDRE++     D  L+ +  +       G T P        V + DENDNEP F +S  + ++ EN   G  +    A D D    G+  Y ++  +  G+          +   +     +D E  +     V A D G P    + ++ + + D NDN      P     T  + +  +   G  +  ++  DSD  AN ++SY I       +  F++ ++   +     S  D   +       ++ +D+G+P L +TA + +RV    D
Sbjct:  415 VVTNSSLDREQMA----DYFLVLEASD-------GGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRI--VQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGD 681          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 8.536e-39
Identity = 170/654 (25.99%), Postives = 273/654 (41.74%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYEN--KNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTIS-KLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNK---------EPIDYEKSKQFKFFLVAVDGGKPA--LTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV 2531
            + + + +ENDN PIF      ++V EN  +G ++V   A DLD   +G  +Y    D    S      +P     ++     +D E    F + V+A D G     G + I L   D+NDN P F+  +   +  EN  S   + R++ TD D   N+Q++Y+I   TS    YF +        + L   LDYE          I+A D G+P L ST T  V V + ND  P         I D NS  + +PEN     T++ ++ TD D        E      ++ L  +    I  +    ++ +    DRE  S Y + +   D    + + T    + + + DVNDN P +    +   I+E      D+      +   D D+  N  + Y + D  N     ++ +N+   +I+            PI +   +     +   D G P    TAS  +T+ + D NDN P      Y   VLE  P  + + Q+ A+D D +  N +V + M     T    R +  F ++  TG I T V LD E     ++ +R+      V T       SS+  +++ ++D+NDN+P            A S +S  + +   +  I+ N C+       DAD GLNAE+
Sbjct:   16 VHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSL-----DPASG--LISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINL--LDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILP-TSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSP---------IFDRNSYSIAIPENILAGATVLYVNATDGDQS-----PEYGQLSLIYSLEGSTQFRINARSG--DITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIF----TVSAADPDLNENGTLVYAI-DPPN----PFYRINAASGKIRTTGLQLDREDLNPISFASMR--SIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPD-EGANGNVTYSM-----TAALPRPD--FQLDAATGLITTLVQLDREA--VAAYQLRL------VATDRGTPALSSTTTLSLVVLDVNDNAPTF--------HPARSAVSLMESVARDSVVISLN-CT-------DADSGLNAEL 600          

HSP 2 Score: 134.42 bits (337), Expect = 7.241e-32
Identity = 166/681 (24.38%), Postives = 288/681 (42.29%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQ-SYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGAN-SQMS--YNIEDYTSQAQRYFKLFQIKDGISLQLQST--LDYE--NKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI--LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKK-KIFELQNLIEFDRET------TSIYRITITCSDSNT-ISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV---VVTLKENPNFSLDMGHNLIC 2591
            +R+N+ D NDN P+F + SY+  A  EN      +V  +A D D+P      Y ++   +  S F +        + L      ++      +L ++A+D G P    +++ I+EV D NDN P F+ ++ S+++ EN  +G  +  +  TD D      Q+S  Y++E  T         F+I +  S  + ST  LD E  ++ I   R +    G       ATV + + ++ND  P    L Y            +T+ EN P    I  +   D D   +  L     P + FY      +N    K +   LQ     DRE        S+  I ++ +D  +   + T S  + + + DVNDN P F    +  +++E    +  +      +  TD D G N  + Y +  AL   D   F +++    I     +D E    ++  LVA D G PAL+++T +++ V D NDN P         S++E     + +  +  +DAD+  LN ++ F +           Q+  F +    G ++T V LD E     S ++   + N   G++      + +  + V ++D+NDN P L L+ S  V    +       + +  +DI               DEG+N  V   +++  ++ NF +++   LI 
Sbjct:  117 VRINLLDVNDNTPVFQRDSYVGTA-RENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ--------FRI-NARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPY-----------AVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFY-----RINAASGKIRTTGLQ----LDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQ----VTATDPDEGANGNVTYSMTAALPRPD---FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSG-LNAELSFFITG-------GNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAID-NGPAGSR-----RTGTTTLDVLVLDVNDNRP-LFLEGSYEVSVPENVTRGAIILQVQATDI---------------DEGINGRVWYRIISGNQDGNFLVNVSSGLIS 730          

HSP 3 Score: 129.028 bits (323), Expect = 3.720e-30
Identity = 150/634 (23.66%), Postives = 265/634 (41.80%), Query Frame = 3
Query:  504 EKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHEN-VEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVL-AIDRGK-PSK--TGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIF---ELQNLI----EFDRETTSIYRITITCSDS--NTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNK--EPIDYEK--SKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQP-IGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKI 2348
            +++C+    + L+++   +S        +P +    + + I DENDN P F  +  ++ + E     G  +    A D D        Y ++S  +  + F + N       VL     +D E ++   LLV+ A D+ + P++  T + ++ + V D+ND  P F  S         G+ G  I     +D D G N ++ Y+I D     +  F +      + ++    LD E +  +   I+AKD GTP L ST TV VRV +++D  P               + L LP N    +   ++ +  +  + SD     +  ++   L +    +    ++ F       L+      DRE  + YR+T+T  D+  N       S  + + I D NDN P+FS   +  +I E       + +  G I  +DAD G+N+ + Y L        S YF ++ +   +     + +D E     + +  ++  DGG+    A+ ++ ++V D NDN P       T  VLE  P +GT +  + A D D    +   +   ++  G       ND F I+ +TG I T   +D+E       +V        V T     F+++S  + V +
Sbjct: 1126 QRLCT----KVLVKRAASASTRGICLTATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTA-ATFGIDNGTG----VLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIID--GDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDP---------------VFLNLPANASLSEAAAVLAIVSR-VRASD----ANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGG----SSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGG-------NDTFGIDESTGLIVTVAPIDYETRPEYLLMV--------VATDQAPPFHTASCELRVSL 1707          

HSP 4 Score: 125.561 bits (314), Expect = 3.949e-29
Identity = 137/542 (25.28%), Postives = 228/542 (42.07%), Query Frame = 3
Query:  588 SPNRKINY-IRVNIEDENDNEPIF--PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD-SKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIF------SSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVD--GGKPALTAS-----------TQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSL 2144
            SP R   + + V + D NDN PIF  P  Y  ++V E    G  +    A D D    G   +++ S    G   ++   P D  + +     IDRET + + L+V+A+DRG P  +GS  + + V+D+ND RP F     ++SV E+   G  +  +K T++  G N++ +Y I      A   F +     G+    +    YE    F    +A D G P L   A + V V ++ND  P         ++ PN   + + E  P    I+ +   D D  +   +     H   V   R+ E+  I     I         DRE+ ++Y + +  SD         +  +Q+ +DD++DN P+F       + +    I E       V    G +   DAD+G N+ I Y+   A N  +   F++ S +  +     +D E S  +   + A       PA+T              ++ + + D ND  P   N  YT  V  +  +G+++ Q+ A D D    N  V++ +LS+
Sbjct: 1930 SPPRSTTFNLSVIVLDVNDNVPIFLSPGGY-AVSVVELGAPGTLVASVWATDADAGPNGQVTFRIES----GGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNA---FTV-HATSGLVTSTRLLKSYER---FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVF-------VLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGS-RDWESFRINATSGIISTAR--ALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAV---DADVGANA-IVYYFIAAGN--EGNKFNL-SRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGN-NSIVLYRILSI 2441          

HSP 5 Score: 104.76 bits (260), Expect = 8.431e-23
Identity = 147/589 (24.96%), Postives = 240/589 (40.75%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPK----AEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRET--NSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRS-GREIKRIKVTDSDIGA--NSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQ-STLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDS--KLS---DILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSN---TISKLTQ--SVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTE-GVIQVTDADIGMNSRIKYHLKDALNS-TDSQYFSV--NSEYPQIKNKEPIDY-EKSKQFKFF-LVAVDGGKPALTASTQITISVSDANDNRP-EIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTK 2156
            G + V  PLDRE++   +    +       S           +  + + V I DENDN P+F Q   +  + EN   G  + +      A D D   +G++     S     S + + +  + N + +     +DRE        L +L  D G+ + T  L +   V D+NDN P F  ++ +  V EN  + G  +  +K  D D+G      + Y+I      A      F I +   L +  + +DYE +  +   ++A DQ  P+   TA+  +RV+ L +E  E L ++  +       Q  L E       ++ +      +  KL     IL +  H       +E++N  +I   +  E+      DRE T  Y +T+   D      I+ LT      + + + D NDN P     F  G     ++ +     T   V+  TD D G N  +         +    QY  +  N     I +    D+ EK+ QF  F +VA+DGG P  + +  +++ V D NDN P  +    Y  SV+E    GT +  + A+DAD    N  V F + S  G K
Sbjct: 1447 GLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYA--------RKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDAD---FGVNATLAYSLLGGSSAYFLIDRDRGN-VSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGV--TVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSI------ASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPF--HTASCELRVS-LQNELDEKLSFSLAAY------QAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQ-GEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSP----EFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGP-NGQVTFRIESGGGDK 2000          

HSP 6 Score: 104.375 bits (259), Expect = 1.162e-22
Identity = 142/632 (22.47%), Postives = 265/632 (41.93%), Query Frame = 3
Query:  591 PNRKIN---YIRVNIEDENDNEPIFPQSY-IKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGAN--SQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTA-----TVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIIL----IHVTDKDSKLSDILC-EVSHPKDVFYL--RETENVNIIEKKKIFELQNLIEFDRETTSIYR--ITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGM--NSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTD---QLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSS--SVAITVKIIDINDNSPKLALKESLIVE 2405
            P R++     + V++ D ND  P F +SY   I V E  + G  I    A D D+   G   Y +I D    + F +   P D  L +    ++DRET + +NL ++A D G P    +L++ + V D++DN P F     + S+ E       + R++ +D++ G N  + + ++   + +  + ++   Q   G+ + +   LD E   + E+R+    +  P   S A      + V + + ND  P         +    + +  +PEN P    + +    I+ +D D  ++  L   +      ++L  R+  NV++   + +         DRE     R  +TI   D     +   +V + + + DVNDN P F+ +     ++E       V  +  V++  D D+G+     ++Y +    N T    F ++     I    PIDYE   ++   +VA D   P  TAS ++ +S+ +  D +       Y  ++ E    GT + ++ A          L   ++ +    D   ++Q  ++  +I    G I T+  LD E        V  R+     G ++ +   ++     + V + D NDNSP+     + +VE
Sbjct: 1258 PARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEG-QPGPRIATFMASDQDSGLNGELEYSII-DGDPRNEFVIS--PADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQT--GL-VYVNRPLDRE--RVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSP---------VFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGL---------DREGIPGGRLELTILVQDGG---RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLE---NSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT----FGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDG----GPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVE 1848          

HSP 7 Score: 94.7449 bits (234), Expect = 1.036e-19
Identity = 119/503 (23.66%), Postives = 211/503 (41.95%), Query Frame = 3
Query:  939 SIILEVEDINDNRPHFEESTISLSVEEN-GRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYE-NKNIFEFRIIAKDQG---TPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVS----HPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKP-----ALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKI----GQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRV--VLDHEK--DQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            S+++ + D NDN P F  +T  + + E    +G  +  +  +D D G N+++ Y I    + A      F I +G   L     LD+E +  ++   + A DQ       L STATV+V V ++ND  P  L    G       I ++  + GP+  T +    +D+DS L+  L E S     P++ F +   +            ++  +E DRET + Y +TI   D  T   L  ++ + +++ DV+DN P+F +      + E       V      ++ +DA+ G N                + F  +S+   +    P+D E+  +++  L   D   P     A   S  + +++ D NDN P      Y   + E  P GT +    G I ASDAD   +N  + + +L           +  F+I+ + G +   +   LD E      +   + V++              +++V + V ++D+NDN+P  
Sbjct: 1157 SVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAAT-----FGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEG------PIDVSEGQPGPRIATFM---ASDQDSGLNGEL-EYSIIDGDPRNEFVISPADG--------DLRVRRYVELDRETQAFYNLTIMAKDMGT-PPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEA----AAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRD--NPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFG-VNATLAYSLLG--------GSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGR----------RNATVRLGVTVLDVNDNTPTF 1610          

HSP 8 Score: 60.4622 bits (145), Expect = 2.827e-9
Identity = 71/284 (25.00%), Postives = 133/284 (46.83%), Query Frame = 3
Query: 1605 TISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLV-AVDGGK-PA--LTASTQITISVSDANDNRPEIGNKFYT-FSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTR--VVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPK-LALKESLIVEQAGSCLS 2426
            T +    +  + ++I D NDN P F ++ +     E  LT+        V  VT  D D G N+R+ Y +   ++   +  F +++    +   + +D+E S      +V A D  + PA  LT++  +++ V+D ND  P     +     V E QP G +I   +ASD D+  LN ++ + +  +DG  R +     F+I    G ++ R  V LD E     +  +  ++    +GT       +S++ + V+++D++DN P  L L  +  + +A + L+
Sbjct: 1148 TATPAQATTSVLIRITDENDNAPAFGAATY-----EVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAI---VSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDSG-LNGELEYSI--IDGDPRNE-----FVISPADGDLRVRRYVELDRETQAFYNLTIMAKD----MGTPP----LNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLA 1406          

HSP 9 Score: 59.6918 bits (143), Expect = 5.321e-9
Identity = 61/251 (24.30%), Postives = 106/251 (42.23%), Query Frame = 3
Query: 1626 SVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            S  + + + + NDN PIFS   +   + E      +  +   V+QV  TD D G+  ++ YH  D     DS  FS++     I     +D+E + +F   ++A DGG      + ++ I++ D NDN P      Y  +  E     T + ++ A+D D+   N  + + +L                +    G +     LD+EK    +  + +   +   G    L+   S+V   V++ D NDNSP
Sbjct:   13 SARVHITLINENDNRPIFSLPLYNVSVWE------NATLGTSVVQVLATDLDAGVFGQVSYHFSD-----DSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGG--GQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPP-NNQITYSILPTSAYSSYFS----ITVSGGYGVVTLARALDYEKIPGGTISLTIMALD---GGSPPLN---STVTAIVEVFDENDNSP 239          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 224.942 bits (572), Expect = 1.234e-59
Identity = 214/782 (27.37%), Postives = 336/782 (42.97%), Query Frame = 3
Query:  465 SHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIF-PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD--SKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL---ALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP-INNPKLRPS----EPQEKMI 2774
            S G + V   LDRE       +  L+ +  E+        +      N   + + D NDN P+F P SY K ++HEN+ IG T+    A D D      +N K+  + S G   + +  P     ++  K  +DRE  + ++L V A+D GKPS++   +I L + D+NDN P F +S  +L+V EN  +G  I R+  +D D GAN +++Y+I      +  +   F+I      + +   +D E    +   I AKD G P  +STA V + V + ND  P         I   N     + E       + ++  TD+D  S        V      F +     V  ++K          E +RET   Y +TI  SD  +   +T   E+ + ++DVNDNPP+F+S  + G + E       V      +   D+D+G N+ ++Y +   ++  D + F +NS    I    P+D+E+  Q+   + A D      TA T +TI V + ND  P    + YT SV E  P  T + ++ ASD D+        F  LS   +    + +D F I+  +G I T  VLD E     +  VRV +              S+   +T+KI+D NDNSPK    +   S++   A S  S                   F     DADEG NA +   L  N  F +     +I L          T  +  Q R+ G   + +   I + +     ++P IN+  LR S    +P+E  +
Sbjct: 1047 SSGLISVAKRLDRETTA----NYTLVVRATETG-------SQGESVYNNATIRVLDVNDNAPVFNPGSYAK-SLHENLPIGQTVAKVTATDRDEG----ENAKVTYELSVGDTSKFEVNPATG--LVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI-----ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP---------IFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKK----------EINRETVPTYTLTIRASDRGS-PMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVL----TVAADDSDVGANAVLRYSI---ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--------FGSLSY--SIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPP--------LSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFS-------------------FKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHV 1738          

HSP 2 Score: 211.075 bits (536), Expect = 2.749e-55
Identity = 184/643 (28.62%), Postives = 294/643 (45.72%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNT--ISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVA-ITVKIIDINDNSPKLALKE 2390
            G++ V G +DRE + S     NL     +S    ++          ++ + + DENDN PIF  +     + E V IG  + +  A D D  S     Y ++   +        N       VL  K +I+RET   + L + A DRG P  T    + + V D+NDN P F   +   SV EN      +  +   DSD+GAN+ + Y+I   +   ++ FK+     G+ +   + LD+E K+ +   + A D  + Y   T  VT+RV NLND  P     N            ++ EN P   +++ +  +D+DS        +S+   +   ++++  +I ++  I    +++  DRE  S+Y I +  +D+    +S LT    + +KI D NDN P F SS +   I+E              +  TDAD G N+RI Y+L      + +  F + +    I   +P+D E    +   + A D G P   +S  I ++V D ND+RP I +     SV E QP  T + +I+ASDADT  LN ++ F +LS            +F ++N TG I T+V LD E  Q   + +R       +G  DK +   SSVA + + +ID +DN P+    E
Sbjct: 1258 GRITVVGVVDREALAS----YNLTISAKDSGVPPWVSTA-------FVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNG------VLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI--ISGNDEKRFKINSTS-GV-IMTTTPLDFEEKSQYGLEVTATD--SKYTAKT-NVTIRVINLNDITPAFTQQN---------YTASVRENSPTSTSVVKVSASDRDS-----FGSLSYS--IVGGKDSDKFSIDQRSGIISTADVL--DRELVSLYAIQVRVTDAGNPPLSNLTW---VTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFK----LAATDADEGTNARITYNL------SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADT-GLNAELTFSLLS-------NEHKSVFTLDNTTGDISTKVPLDRE--QQAVYTLR-------IGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTE 1828          

HSP 3 Score: 193.356 bits (490), Expect = 9.631e-50
Identity = 175/638 (27.43%), Postives = 301/638 (47.18%), Query Frame = 3
Query:  618 VNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEV---SHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPI-IITTSDIASNLCSEFPYTFLDADEGL 2519
            + ++D NDN P F  S  K  V+E+V +G  +    A DLD       +Y L+S  +  S F V     D++ V+  K   DRET + + + + A D G PS++G  ++ +E+ D+NDNRP F  +  + SV+E+   G  +  +  +D D G N+ + Y+   +TS    +        G+ + +  +LD+E ++ +   +   D+G+P L  T+ + + V ++ND PP         +  P++ Q  + EN P       +  TD+DS  +  L       +   VF +  +  +  I K            D E  + Y +T+   D     K   + ++ + I+DVND+ P+FS S +  +I E+ +    +  T   +  TD D G   R++Y L   ++      F++++    I+    +D E +  +   + A DGG  + ++ST++TI++ D NDN P I    Y F V E    G +IGQ+ A+DAD D  N DV + +             D+F I  +TG I  +  LD+EK     ++V V  T +  GT  +    SS   + V + D+NDN P+ A  +SL     G  L++   +  +T +D  S    +  Y+ L  +E +
Sbjct:  156 ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDT--SYFTV-----DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYS---FTSGNTNHAFTLDAVTGV-VTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP---------VFSPSAYQSRVKENTPAGTQ---VSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSP----------DYENKTRYDLTVQARDRGVPVKY-DTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTV----IGSTVVTVTATDLDSGPRGRLEYRL---ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP-IFQGPYVFRVSESSSPGHQIGQVAATDAD-DSSNGDVRYAL---------SDNTDVFSINTSTGLITLKTQLDYEKKTQ--YMVTV--TAKDGGTPSR----SSLTVVKVMVDDVNDNPPQFA--KSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENM 731          

HSP 4 Score: 176.792 bits (447), Expect = 1.105e-44
Identity = 205/853 (24.03%), Postives = 380/853 (44.55%), Query Frame = 3
Query:  312 ISVITVTENIPYPSSSL--------IDVGHLLLTSSLISQAEKDN-------IYFTDRKNSQPFSLSH--GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITS----PNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDK-DSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGV----IQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL--KENPNFSLDMGHNLICLKNL-HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP-INNPKLRPSEPQEKMIDT 2780
            I ++ V +N P  SS+         + +G  ++T   ++ ++KDN         FT    +  F+L    G + V+  LD E+                SS  + + +T     P    +++ +N+ D NDN P+F  S  +  V EN   G  +    A D D+ + G   + +I     G  F +         ++      D E  + ++L V A DRG P K  +  + + +ED+ND+ P F  S  S  + E+   G  +  +  TD D G   ++ Y +   +   +  F +     G S+++ S LD E    +  ++ A+D G+    S+  VT+ + ++ND  P  +F        P   +++   + P HQ I  +  TD  DS   D+   +S   DVF        +I     +  L+  ++++++T   Y +T+T  D  T S+ + +V +++ +DDVNDNPP F+ S +   + E        ++  GV    +  TDAD G N +I Y +   L+  ++  F+++    +I  + P+D E    +   + A DG      A+T + IS++D NDN+P        F++ E+ P GT++GQ+ A+D D    N  V + ++S         Q + F ++  +G +  R  LD E     + +V+  +     G+  +    S + +I V ++D+NDN+P+   ++SL   +     S    ++    +              D DEG N  + ++L  + + NF++D    ++    L + +   + ++V    R+GG+ S+ A   + I + +   N P   +P    S P++  I+T
Sbjct:  259 IEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVT---VTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQ---------------RSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDG-VFTIDGSTG----IISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL--ISGNVKGAFNI-DANSG-SIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP--IFQG------PYVFRVS-ESSSPGHQ-IGQVAATDADDSSNGDVRYALSDNTDVF--------SINTSTGLITLKTQLDYEKKTQ--YMVTVTAKDGGTPSRSSLTV-VKVMVDDVNDNPPQFAKSLYTCTVGE--------NLAAGVAVCYVTATDADSGANGKISYSI---LSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGP-SRFNISEDSPTGTRVGQLTATDRDIGP-NGAVTYAIIS-------GNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASD----AGSPQQ----SITASIHVSVLDVNDNAPR--FEKSLFSGEIREDASVHSTVLQVKVE--------------DKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTA--RDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINT 1014          

HSP 5 Score: 173.711 bits (439), Expect = 9.777e-44
Identity = 169/667 (25.34%), Postives = 297/667 (44.53%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGS---CLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVV--VTLKENPNFSLDMGHNLICLK 2597
            + + ++D NDN PIF   Y+   V E+   GH I    A D D  S G   Y L SD +    F +         ++  KT++D E  + + + V A D G PS++    + + V+D+NDN P F +S  + +V EN  +G  +  +  TD+D GAN ++SY+I   +      F + +    I+ ++   LD E    +   I A D      M+  TV + + + ND  P     +R            + E+ P    +  +  TD+D   +  +        +    +  +  +  +  I  +++ +  DRET   Y + +  SD+ +  + + +  I + + DVNDN P F  S   G+I E    D  VH T   ++V D D G N  I      +L+   S  F+++S    + +K P+DYE +  ++  + A DGG P+ +A+ Q+ I++ + NDN P   +     S+ E+  I T + ++ A+D+D   L  D++                  F I+ ++G I     LD E   + + +VR   T    G++ +  + ++    T++++D+NDN+P         V   GS    L    PI  T + +          T  D DEG NA+V   +++ +   F ++    L+  K
Sbjct:  569 VTIALQDINDNSPIFQGPYV-FRVSESSSPGHQIGQVAATDADDSSNGDVRYAL-SDNT--DVFSINTSTG----LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI--LSGNENMAFAMDRFTGEITTRVP--LDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSR----------FNISEDSPTGTRVGQLTATDRDIGPNGAVTYA-----IISGNQGNSFQLDPRSGILSVRSTL--DRETIPSYTLVVKASDAGS-PQQSITASIHVSVLDVNDNAPRFEKSLFSGEIRE----DASVHSTVLQVKVEDKDEGSNGAITL----SLSGEGSDNFTIDST-GFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIV-----------EGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATET----GSQGESVYNNA----TIRVLDVNDNAP---------VFNPGSYAKSLHENLPIGQTVAKV----------TATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTK 1158          

HSP 6 Score: 153.68 bits (387), Expect = 1.541e-37
Identity = 183/727 (25.17%), Postives = 317/727 (43.60%), Query Frame = 3
Query:  603 INYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDIL---CEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN---FSLDMGHNLICLKNLHL---SPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSE 2756
            +  I + I D NDN P F QS   + V EN   G  I+   A D D  + G   Y +IS  + G+ F +  +    R+ +V    +DRE  + +NL + A D G P    +  + + V D NDN P F  +  S  ++E    G  +  +  TD D G+N+Q+ Y+I    + A   F +  + +G+ L ++  ++ E    +   I A D+G+P + S   +TV V ++ND PP    +N  S +       ++ EN  +  +++ +   D D   + +L       + +  F +  T  V          +      D E  S Y + +T +DS    K T    + +++ ++ND  P F+   +   + E   T      +  V++V+ +D      + Y +   +   DS  FS++     I   + +D E    +   +   D G P L+  T +TI + D NDN P+  +  Y+ S+LE     +   ++ A+DAD +  N  + + +           +ND F+I  ++G I     LD E        ++ R+     GT  +    +SS+ I V +IDIND+ P L    SL     GS   +Q         +AS           DAD GLNAE+  +L  N +   F+LD     I  K + L       +T+ +   D+   + S  A+ +I++      +++  N P+ +P+E
Sbjct: 1186 VAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIIS-GNHGNAFRI--DSTTGRITVV--GVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA---FAINAM-NGV-LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP---VFNSQSYIG------SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV----------IMTTTPLDFEEKSQYGLEVTATDS----KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPT------STSVVKVSASDRDSFGSLSYSI---VGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDAD-EGTNARITYNL----------SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDH----GTPPQ----ASSITIRVTVIDINDHRP-LINSSSL----RGSVRENQPKETHVMRILAS-----------DADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTK-VPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDV------IDEDDNCPRFQPTE 1828          

HSP 7 Score: 148.673 bits (374), Expect = 4.679e-36
Identity = 158/608 (25.99%), Postives = 266/608 (43.75%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKI--DRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI---LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLA 2381
            G T     +  ++V ++D NDN P F +S     V EN+  G  +    A D D+ + G  +Y ++S       F +      +R      T++  DRET + ++L + A D        + ++ + + D NDN+P F   +   ++ E+  +G  + ++  TD DIG N  ++Y I   +      F+L   + GI L ++STLD E    +   + A D G+P    TA++ V V ++ND  P     LF               + E+   H T++ + V DKD        E S+      L    + N       F L      D ETT+ Y++T+T  D  + SK + + ++++ I +VNDN P F S      I E      DV +   V+++  TD+D    + + +   D +       F ++     I   + +D E +  +   + A + G    +     TI V D NDN P      Y  S+ E  PIG  + ++ A+D D  + N  V +E+   D +K        F +   TG + T+  LD E     S+ +RV   +    ++      S+  AIT+ I D+NDNSP+ +
Sbjct:  660 GGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNE-NMAFAM------DRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPS-RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAI--ISGNQGNSFQL-DPRSGI-LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGE------------IREDASVHSTVLQVKVEDKD--------EGSNGAITLSLSGEGSDNFTIDSTGFVLSK-TPLDYETTAAYQLTVTARDGGSPSK-SATAQVKITIINVNDNVPSFVSPAQVTSIPE------DVAINTHVVKLNATDSD---GTPLTF---DIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGE-NAKVTYELSVGDTSK--------FEVNPATGLVTTKRPLDRE--DQASYSLRVTAMDHGKPSQ------SAVAAITLTINDLNDNSPQFS 1204          

HSP 8 Score: 145.591 bits (366), Expect = 4.772e-35
Identity = 169/716 (23.60%), Postives = 297/716 (41.48%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI-------EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGV-IQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN-FSLDMGHNLICLKNL--HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKP 2726
            + ++++DENDN P FP +     + EN      + +  A D D+ +     Y L S ++    F + ++  + R V    T +D ET   + + + A D     K  +   ++ V+D+NDN P F  S     V E+   G  ++++   D D+G N+++SY++    S    YF +     G+ ++ +   D E K  ++  + A+D G+P     ATV + + ++ND  P        + VD         E+      ++ +  +DKD+          +  D+ Y   + N N       F L  +          D E  S Y + ++ +D  +   LT +  + + ++D+NDNPP+FS S +  ++ E        +   G  +  TD D   N  + + +   +   D   F+++     I   +  DYE   ++   + A D G P    + Q+TI + D ND+ P      Y+  + E   IG+ +  + A+D D+    R    E   + G  +       F I+ N+G I+    LD E     S  V  R+              SSS  +T+ + DINDNSP                   Q P +   S+ +S           DAD+  N +V   L +N + FS++    LI LK    +     + V+V  +D  GG  SR +  ++ + +     N P
Sbjct:   56 VVIDVKDENDNAPEFPLNSYVFNIRENTPAAQ-VAIVTATDRDSGTNAAITYSLFSGENK---FMMNSKTGEIRTV----TPLDHETKDSYTMRISAFD----GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSL---VSGDTSYFTV--DSQGV-IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVD---------EDVAIGAAMVTVTASDKDN---------GNNADLRYSFTSGNTN-----HAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGS-PPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKE--------NTPAGTQVSATDRDSSTNGALVFGI---IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGR---LEYRLISGNVK-----GAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTS--------RSSSTRVTIALQDINDNSPIF-----------------QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKD--GGTPSRSSLTVVKVMVDDVNDNPP 683          

HSP 9 Score: 127.102 bits (318), Expect = 1.915e-29
Identity = 128/510 (25.10%), Postives = 228/510 (44.71%), Query Frame = 3
Query:  855 KIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP--EILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            K DRE+ S + L VLA D       G   ++++V+D NDN P F  ++   ++ EN  +  ++  +  TD D G N+ ++Y++       +  F +   K G  ++  + LD+E K+ +  RI A D       +T    + V ++ND  P   +  Y  G           + E+      +  +   D D  ++  L       D  Y    ++  +I  K          FDRET + Y++ +   D  + S+  Q+  ++++I DVNDN P+FSS+ +   +      D+DV +   ++ VT  D D G N+ ++Y      +   +  F++++    +     +D+E+   +   L   D G P LT ++ + I+V+D NDN P      Y   V E  P GT   Q+ A+D D+   N  ++F ++       +   + +F I+ +TG I      D+E        V+ R+     G   K D    +  +T+ I D+ND+SP
Sbjct:   27 KFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSL----FSGENKF-MMNSKTG-EIRTVTPLDHETKDSYTMRISAFDGK----HTTFVPLITVDDVNDNAPFFALSVYKTG-----------VYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYF-TVDSQGVIRTKG--------AFDRETKASYQVALRAQDGGSPSRSGQAT-VEIEILDVNDNRPVFSSAQYTASV------DEDVAIGAAMVTVTASDKDNGNNADLRYSFT---SGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDS-STNGALVFGII-------KGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDR----GVPVKYD----TAQVTIFIEDVNDHSP 476          

HSP 10 Score: 122.479 bits (306), Expect = 5.653e-28
Identity = 127/497 (25.55%), Postives = 222/497 (44.67%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIF-PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDAD 2099
            + V + D NDN P+F  QSYI  +V EN     +++   A+D D  +  +  Y +IS        E + +      V++  T +D E  S + L V A D    +KT   ++ + V ++ND  P F +   + SV EN  +   +  +KV+ SD  +   +SY+I     +    F + Q + GI +     LD E  +++  ++   D G P L +   VT+++ + ND  P+          D +S   ++ EN         +  TD D        E ++ +  + L   +   I     +  L      DRE  S Y + I   D  T  + + S+ I++ + D+ND+ P+ +SS   G + E     ++ H+    I  +DAD G+N+ + + L   L++     F++++    I  K P+D E+   +   +   D G P+L++   + I V D +DN P      Y  ++ E  P G  I Q+ A D D
Sbjct: 1398 LTVVVNDVNDNPPVFNSQSYIG-SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND-----EKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKT---NVTIRVINLNDITPAFTQQNYTASVRENSPTSTSV--VKVSASDRDSFGSLSYSI--VGGKDSDKFSIDQ-RSGI-ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKF---------DSSSYSSSILENSAPSSFSFKLAATDAD--------EGTNARITYNLSRNDAFMIGASSGVITLAQ--PLDRENKSTYDLAIQARDHGTPPQAS-SITIRVTVIDINDHRPLINSSSLRGSVRENQ--PKETHVMR--ILASDADTGLNAELTFSL---LSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 11 Score: 94.3597 bits (233), Expect = 2.142e-19
Identity = 74/278 (26.62%), Postives = 127/278 (45.68%), Query Frame = 3
Query:  591 PNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD 1424
            P   + ++ + I DENDN P F  S    ++ EN           A D D  +    N ++  + S    F +         V+     +DRE  S ++L + A D G P +  S++I + V DIND+RP    S++  SV EN      + RI  +D+D G N+++++++   +++ +  F L      IS ++   LD E + ++  RI   D+G P L S A V + V + +D  P            P    +T+ E+ P+  +I+ +   D D
Sbjct: 1596 PLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGT----NARITYNLSRNDAFMIGASSG----VITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSL--LSNEHKSVFTLDNTTGDISTKVP--LDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF---------QPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 12 Score: 57.7658 bits (138), Expect = 3.406e-8
Identity = 71/313 (22.68%), Postives = 128/313 (40.89%), Query Frame = 3
Query: 1818 LNSTDSQYFSVNSEYPQIKNK-EPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHE-KDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL---KESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL--KENPNFSLDMGHNLICLKNL--HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPI 2729
            ++  D   F+++S    I       D E   +++  ++A D         T + I V D NDN PE     Y F++ E  P   ++  + A+D D+   N  + + + S +         + F++ + TG I+T   LDHE KD   S+ +R+             D   ++    + + D+NDN+P  AL   K  +  + A   +  Q                    T +D D G+NA +  +L   +   F++D    +I  K      +   + V++  QD  GG+ SR  +  + I +     N+P+
Sbjct:    4 MDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDS-GTNAAITYSLFSGE---------NKFMMNSKTGEIRTVTPLDHETKD---SYTMRIS----------AFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQ-------------------LTAVDLDVGINARLSYSLVSGDTSYFTVD-SQGVIRTKGAFDRETKASYQVALRAQD--GGSPSRSGQATVEIEILDVNDNRPV 270          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 221.476 bits (563), Expect = 1.392e-58
Identity = 201/715 (28.11%), Postives = 323/715 (45.17%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLIS-DKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDP-NSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLD-FYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEV---VVTLKENPNFSLDMGHNLI-CLKNL-HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPI 2729
            ++V ++D NDNEP FP  Y  + + E++++  T  +  A D D  + G  +Y + S D +          P  + L ++ K  +DRET   + L + A DRG P+  G   I + + D ND+ P F +++   S+ EN + G  I R+   D D G+N  + Y I+    Q+   F L     G+ ++ +  LD+E KN + F +IA D G P     ATVT+ V + ND  P++    + + + P N  +    EN   +  I  I VTDKDS   S    ++++  D       E    +E    + +Q     DRE    Y +T+  +D    S+ T    + + + DVNDN P F+S+ +   I E  L     ++ +  +  TD D G N  + Y +       D  +F V+ +   +   +P+D E+       + A D G    T ST +T+++ D NDN+P      Y  ++ E   IG  + Q+ A+D D+    R + +E+ S D      + N LF +   TG + T+  LD E     SF V           KD  D    SSV + + I DINDN+P         VE   S + ++ P                  T  DADEG NA +   ++    N NFS+D    +I  L +L H    +F  S+I   ++GGN       ++N+ + +   N P+
Sbjct:   81 VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDL-DSSTGV-IRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQL----KITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDD-------EGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGF-VLIDVTDVNDNSPAFTSNAYTANISE--LAQNGSYVLQ--LNATDPDEGDNGTVSYSIT---GGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGR-ITYEISSSDA-----QVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLA---------KDHGDPQLMSSVKVELTISDINDNAPVF-----YPVEYFASIMENEPP------------GKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFF--SLIISAKDGGNKYAAKTAVVNVTVLNKADNLPV 740          

HSP 2 Score: 175.252 bits (443), Expect = 3.193e-44
Identity = 166/631 (26.31%), Postives = 282/631 (44.69%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYI------KIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI--KDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHP----KDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQ 2432
            G+ S N  +  + +N+ D NDN P    +Y+      K    EN  I   I      D D+ +      K+ +    G CF+V+         +  +  +DRE    +NL +   D+G PS++    ++++V D+NDN P F  +  + ++ E  ++G  + ++  TD D G N  +SY+I             FQ+  + G+ +     LD E  +     I A+D G+     + TVTV + + ND  P  +          +S + T+ E      T++ +  TD DS  +  I  E+S        +F L     V          L    + DRET S+Y  T+   D     +L  SV++++ I D+NDN P+F    +F  IME +   + + +T      TDAD G N+ I Y   D +   ++  FS++S    I     +D+E  + F   + A DGG      +  + ++V +  DN P    + Y F+V E  P GT +G++ A+  D    N  + + ++S D T       +LF++++  G IK    +D E+       V  R     VGT   L   S+   + ++++D NDN+P+ +   S+IV+  G+ L  Q
Sbjct:  289 GVPSKN-DLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEG-CFKVEFL---GFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI-----TGGNDLGWFQVDFQSGL-VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFM---------KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGV----------LWTKSQLDRETKSLYSFTVLAKDHGD-PQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVT-----ATDADEGTNAVISY---DIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK---NGSISYAIVSGDPT-------NLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR-----VGTVKPL---SAQATVNIEVLDRNDNAPQFS-TSSVIVDIDGTWLVGQ 861          

HSP 3 Score: 127.872 bits (320), Expect = 1.292e-29
Identity = 171/764 (22.38%), Postives = 304/764 (39.79%), Query Frame = 3
Query:  321 ITVTENIPYPSSSLIDVGHLLLT--------SSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTI--ILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRE------TTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQND----LFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPY---TFLDADEGLNAEVVVTL 2543
             TV EN+P  +     VG +  T        S  I   +  N++  D         + G + + G +DRE+       Q L+           +G   P      + + + D NDN P F  S + + +     +G  +    A DLD    G+  Y+L S+        + +       V+    K+     + + + VLA D G P +  +++I + +  IN + P F  S+    V  +     +   +   D D G N Q+ Y+I     +      LF I  G  L ++ +L    K  ++  + A D G P   ++  VT+ + + ND     LF N       N+ +  + EN      +  ++ H  D            S  KD+ Y   +   +     +  ++   +  DRE       +++Y +      ++T  K  +++ I + + D+NDN P+FS + +   + E  L    V      I+  DAD G N++  Y L   ++ T    F +NS   ++   + +D E +  +   + A D     L ++ +I I+V D+ND RP      YT ++ E+  IG+ +  + ASD D  Q            +G  +    N     +F +E+ TG +     LD E  Q     +  ++          L   SS+V +TV ++D+NDN+P                L   +P+ +T   +  N+ + FP    T  D D G NA +  ++
Sbjct:  748 FTVYENVPKGTL----VGRVYATTKDKNGSISYAIVSGDPTNLFLVDS--------TGGIIKINGDMDREEKA-----QYLLAVIAR------VGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAE--GLLWINSTSG----VIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS-IN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEG-----LFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDH--RSLFVN-------NTFRFAVAENSSPGTLVGTLVAHALDH-----------SRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVI-VTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFR----IKAMDADEGDNAKFFYSL---VSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQ------------NGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQD--------HGLIPLSSTVNVTVNVLDVNDNAP----------------LFPTQPVTLT---VRENVNTGFPVGRCTASDRDTGTNAHIAFSM 1408          

HSP 4 Score: 117.857 bits (294), Expect = 1.420e-26
Identity = 139/548 (25.36%), Postives = 231/548 (42.15%), Query Frame = 3
Query:  882 FNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVN-IIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEK--DQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEG 2516
            ++L+V A D G PS + S+ + + ++D ND+R  F  +T   +V EN   G  +  +     D      + Y++    S      +  QI   + L  +  +     N++  +  A    T      A V V VT+LND  P    ++R ++      +L+LP        +  I   D D        E  + K  + L     ++         EL      DRETTS Y + +  +D++  + L  + +I++ + D ND  P+F  S +   I E  L    V      +  +D DIG N  IKY +    N   +  F V S   ++   + +D+E ++ ++  + A D G   L+++  +T++V D NDN P    +  T +V E    G  +G+  ASD DT   N  + F M S       Q  +  F + + T  I T   +D E       SF + V  T++      KL   S+  +ITV++ D NDNSP        +   A +  SS   + IT  D   N   +  Y+ +  + G
Sbjct: 1016 YDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP---VFSR-AVYAITVSELSLP-----GSPVFRIKAMDAD--------EGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASN-ANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVIN----LNASDKDIGQNGLIKYSIS---NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGT-NAHIAFSMYS-------QTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQ---GSPKL---STRKSITVQVTDENDNSP------GFVSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNG 1518          

HSP 5 Score: 114.39 bits (285), Expect = 1.704e-25
Identity = 156/637 (24.49%), Postives = 264/637 (41.44%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSI----YRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSS--SFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDIN 2360
            G++     LDRE++    T  N+     E    M+   T+  R    + V + D NDN P+F ++   I V E    G  +   KA D D        Y L+S       F   +  +     L     +DRET S +NL+V A D    +   +  I + V D ND RP F ES  ++++ E+   G  +  +  +D DIG N  + Y+I +    A     +F ++     L +  +LD+E   ++E  I A+D G   L ST  VTV V ++ND  P  LF  +        + LT+ EN      +     +D+D+  +      +H     Y  +T +          E+  +   D ET       +++ +  +D  +  KL+    I +++ D NDN P F S  +   G  +          MT   I   D D   N ++ Y +    N     YF+++    Q++    I  +    ++  + A DGG+P+    T +++         P   +  Y  SV E +  GT +  ++A+   +  LN ++ + + S D +K        F +  +TG +KT   +D E     SF + V     Y   K      +SS  +T+ + D+N
Sbjct: 1103 GQITTRVRLDREELIK-NTGSNVYIMQAE---AMY-NDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGE-----LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAA-----MFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFPTQ-------PVTLTVRENVNTGFPVGRCTASDRDTGTN------AHIAFSMY-SQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGS-PKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNV--------MT---ITAEDPDRNSNGKVTYSIISGNNG----YFNLHPSTGQLQMIHQIP-DNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQS-SLNGNIEYYLTS-DSSKGG------FEVVKSTGVVKTTRGIDREG-MGASFNLVV-----YAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 108.612 bits (270), Expect = 8.420e-24
Identity = 150/654 (22.94%), Postives = 270/654 (41.28%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIF-PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCE--VSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISK-LTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYP--QIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKL----DFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL 2543
            + + I D NDN P+F P  Y   ++ EN   G  + +  A D D  +  + +Y +I   + G+ F + +       V+     +D E    F+L++ A D G      +  + + V +  DN P F     + +V EN   G  + R+  T  D   N  +SY I    S       L     GI +++   +D E K  +   +IA+      L + ATV + V + ND  P+  F     IVD +   L         Q +      D D+  + ++     S+ + + ++  T  V  + +K       L + D    + Y + +  SDS +  +  T ++ I + I+    +PP F+ S +   +    L  Q +      +   D D G N ++ Y +       +   F +   +P  ++  ++ +       +   + A DGG P+ +AS  +TI + D+ND+R    N  + F+V E    GT +G +VA   D  +  +D+++ ++S             F ++  +G I TRV LD E+      L++   +N Y+   + +            + V + D+NDN+P                  S+    IT S+++      F    +DADEG NA+   +L
Sbjct:  623 VELTISDINDNAPVFYPVEYFA-SIMENEPPGKLLQV-TATDADEGTNAVISYDIIGGNNNGN-FSIDSSTG----VISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAI---VSGDPTNLFLVDSTGGI-IKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQ--FSTSSVIVDIDGTWLV-------GQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARK-------LTDGDE---TQYTVQVLASDSGSPPQHSTMTIHITLSIN----HPPKFTLSSYVTHV----LASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQG---NEEGLFGI---FPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSR-TKDIVYSLIS---------SESHFAVDVRSGQITTRVRLDREE------LIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVF----------------SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSL 1198          

HSP 7 Score: 93.9745 bits (232), Expect = 2.613e-19
Identity = 79/284 (27.82%), Postives = 139/284 (48.94%), Query Frame = 3
Query: 1551 DRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEY-PQ-----IKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL 2384
            DRETT+   + +      T++   Q + +Q+++DD+NDN P F + ++  +I E+     DV+ T  +   TD D G N  + Y +    N+     FS+ +   P      +  K+P+D E +  ++  + A D G PAL     I I++ D ND+ P      Y  S+ E    G  I ++ A+D D+   N D+ +  +  D  +     N +F ++++TG I+T+  LD E     +F   V  ++  V +K+ L        +T+ ++D NDNSP+L +
Sbjct:   58 DRETTTQISLQL-----RTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRES----MDVNTTNPINTATDPDAGNNGTVDYTIASGDNTAT---FSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGS-NGDIKY-AIDWDAIQ----SNSIFDLDSSTGVIRTKQNLDFEVKNSYTF--NVIASDGGVPSKNDL------ATVTINVLDTNDNSPQLKI 315          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 193.356 bits (490), Expect = 1.068e-49
Identity = 191/719 (26.56%), Postives = 319/719 (44.37%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEV-----SHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLAL-KESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN-FSLDMGHNLICLKNLHLSP------GYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPI 2729
            + V++ D NDN+P+F  S   +   EN  IG +I   KA D D+P + I  + +I   +    F V     D   ++     +DRET   + L V A+D G         + + V D+ND  P F ++  + +++E+ ++   I  +     D G N+++ Y+I    +       +  I    +L LQS +D+E        + AKD+GTP L   A VT+ V ++ND  P+          + +SI + LPE+ P   T   + V D DS    +L  V     S+P  +F        N+        L  LI++     S Y + +   D  +  + + +  +++K+ DVND  P+F +  +   ++ET  T  D ++ E  +  TD D G N RI Y     +++  S++   N     IK+K  +D E  +++   ++A+D G P  ++S  + + V D NDN P      Y F V E +P+ T +G + ASD+D          E  +   T R   Q   FI++  TG I T  VLD E     S++  +  T+   G+  ++D       +TV + D+ND SPK +  K S+ V +     SS   +I T  D                 +G N+++   +   P  FSL+    ++ L    +SP          + V+  D+ GGN S      I I++     N P+
Sbjct:  585 VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRF-IIEQGNADEVFSV-----DGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTD-----NIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF---------NSSSILVRLPEDTPIGHTFYTVSVFDADSG---VLGRVSFSLLSNPGTLF--------NLDSNTGALSLTKLIDYGNSARS-YTLPVQAQDGGSPPR-SSTAMLELKVVDVNDYSPVFGNWSYTAHVLET--TPPDSNIIE--VVATDVDSGENGRISYAFDSKVDT--SKFGLRNGGKIFIKSK--LDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSD----------EGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREA--KASYVFSIVATDG--GSSPRVD----KTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDD----------------QQGPNSDITYMIVAGPKAFSLNQVTGVLTL----VSPLDREVTHRHILHVVASDK-GGNQSLETITYIEINVLDVNDNYPV 1223          

HSP 2 Score: 174.096 bits (440), Expect = 1.062e-43
Identity = 180/679 (26.51%), Postives = 293/679 (43.15%), Query Frame = 3
Query:  579 GITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL--SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQ-ITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKII--DINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDAD--EGLNAEVVVTLKENPNFSLDMGHNLICL 2594
            G + P      + + + D ND  P+F        V E       I+   A D+D+   G  +Y   S K   S F ++N  K     +  K+K+DRE    +NL V+AID G P ++ S  + + V+D+NDN PHF++++ +  V+EN      +  +  +DSD G+N  ++Y  +   +Q          K    +     LD E K  + F I+A D G+   +    VTV V ++ND  P+            N   +T+ E+ P   +++ +  TD D +   SDI   +      F L +   V          L  +   DRE T  + + +  SD      L     I++ + DVNDN P+F +   F  + E       +      +   D+D G N +++Y +   +N      F +N     I     +D+E + ++   + A D GK     S Q +TI V DANDNRP          + E  PI T +  I A D D+  LN  + +   ++D    R      F I + TG I+T   +D E+    S  ++VR T++    +D+L  Y+++   T+KII  D+NDN+PK   +    V +        +P     + I          T LD D  +G N E  +   +   FSLD+   ++ L
Sbjct:  887 GGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDS-KVDTSKFGLRNGGK-----IFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ------FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF---------SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGV----------LTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEK----LPIGSVVAAVLAVDSDQGDNGKVRYKI---VNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDS-GLNSRIWY---TIDSQSPRAH----FKINSETGLIQTTHPIDREEISEYS--LKVRATDQAFTEQDRL--YNTA---TLKIIIQDLNDNAPKFVSRNLTYVME-------DEPFNFQVTSI----------TALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKL 1495          

HSP 3 Score: 151.369 bits (381), Expect = 9.748e-37
Identity = 154/601 (25.62%), Postives = 274/601 (45.59%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQ-SYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEV---KNEPKDNRLVLVFKTK---IDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPY-LMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDS-KLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQ----YFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            + V ++D NDN P F + +  K+ V EN +     ++  A D D  S    +Y ++S  + G+ F++   ++   D    LV       +DRE    + L + A D G P+  G L + + VED NDN+P F   + S ++ EN   G  I ++  +D DIG N+++ Y+IE + S  Q  F +      I   ++  LDYE K  +   + A+D+G+ + L S+A V + V ++ND  P I + Y  G      S Q+T  EN      +  + V+D DS K  ++   +      F ++     +++  + I  +      DRET   + +   C D     + T+    ++ + DVND  P F    +  ++ E    +  V+    ++   D D G NS + Y +    N+T+S+    +F+++     I     +D E+  Q    ++  D G P L+ +  + ++++D+NDN P      Y  S+ E  P G+ + Q++A D D  + N  +++ +L+          N  F ++   G +     LDHE     +F V   +     G +      S +  + V + D+NDN P
Sbjct:   44 VLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI--AVDSDFGSNSTQSYTIVS-GNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETH-SDPQAIFGIHPTTGVIVNNVR--LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGG-----SYQVT--ENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMK----FDVLNDESIIAVGQ--SLDRETHDHFFLKAVCIDKGDPPRTTEK-SFRINVGDVNDCAPKFDRHTYETRVWE----NATVNTLVAIVNAVDQDFGSNSELVYTIA---NTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGE-NSLILYSILT---------PNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDG----GGR------SCNATVHVSLTDLNDNQP 597          

HSP 4 Score: 144.436 bits (363), Expect = 1.340e-34
Identity = 175/707 (24.75%), Postives = 296/707 (41.87%), Query Frame = 3
Query:  288 PIAYPCDYISVITVTENIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVE----IGHTIVLPK-----AEDLDTPSYG-IDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYEN-KNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHE-KDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            P +Y  +Y     + ++I    +   D     +T  +I Q   D ++  D           G + +   LDRE     Q +  L  K  +       G  S N+ I  + + + D ND  PIF ++     + E+ +    IGH   + +     AE + + S G  DN  LI+  S G+ +               ++++D E      L V A D+G P   G  ++ + V DINDN P F  S+I + + E+   G     + V D+D G   ++S+++    S     F L    +  +L L   +DY N    +   + A+D G+P   STA + ++V ++ND  P  +F N        S    + E  P    II +  TD DS  +  +      K      +T    +    KIF    L   DRE    Y + +   D  T  + + S ++++ +DDVNDN P F  + +   + E    ++ V    G +  +D+D G N  + Y        T    F V+ +  +I   + +D E    + F +VA DGG       TQ+T+ V D ND  P+     Y+ +V E+ P+G+ +  ++A+D D    N D+ + +++  G K        F +   TG +     LD E   +H+  +V         G    L+   +   I + ++D+NDN P
Sbjct:  601 PSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVD---------GSGLITLAKLLDRET----QDNYLLTVKAVDGG-----GQDSVNKAI--VNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLIN--STGTLY--------------LQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSL---LSNPGTLFNL--DSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSP--VFGNW-------SYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSK-----VDTSKFGLRNGGKIFIKSKL---DREDIEEYNLKVIAIDHGT-PRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKE----NEPVATYLGAVSASDSDEGSNGHVTYRFD-----TQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVA--GPK-------AFSLNQVTGVLTLVSPLDREVTHRHILHVVASDK-----GGNQSLE---TITYIEINVLDVNDNYP 1222          

HSP 5 Score: 135.961 bits (341), Expect = 4.864e-32
Identity = 166/619 (26.82%), Postives = 271/619 (43.78%), Query Frame = 3
Query:  591 PNRKINYIRVNIEDENDNEPIF-PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRS--GREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTI--ILIHVTDKDSKLSDILCEVSHPKDVFYLR----ETENVNIIEKKKIFELQNL------IEFDRETTSIYR-ITITCSDSNT---ISKLTQSVEIQMKIDDVN---DNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMN-SRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHE--KDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            P R    +++ I +  D+ P F  Q+  ++++ EN ++G  I   +A      S     Y +IS    G  F V  +P    + +     +D E+   F L ++A  +G  S  G + + + V D NDN P F  S +   + E+  +   R + ++  TD D G N +++Y+I  +T      F +      I+      LD E    F+  I   D G P   +   V V VT+LND PP         + DP S ++ + E+      +  ++   TDK+S+L+  L   S P  +  LR    + ++ +  + K  F + N       I+ D    S  R I +   DS     +  + Q V  Q  +  V       P F    +FGK+ E  +    V      ++VTD   G+   RI Y++++      S YF +      I   +P+DYE  ++F   + A+D   P+      + I+VSD ND +P  G   Y     E  P+GT +  + A+D D+    R V F + S D           F I+  TG I+T+  LDHE  K  HVS    VR T+E  G+        + V++T++++D+NDN P
Sbjct: 1941 PLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNK-GRAFYV--DPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSI--WTGNEAGVFTIDSTTGEITTA--KLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP---------LFDPLS-EVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPG-IAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVL----TVRVTDNAAGLPLGRISYNIEN------SNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGR-VWFAIQSGDDKGS-------FAIDRKTGVIRTQRALDHETIKTHHVS----VRATDE--GSPP----MHTDVSVTIRVLDLNDNPP 2510          

HSP 6 Score: 130.954 bits (328), Expect = 1.492e-30
Identity = 166/648 (25.62%), Postives = 272/648 (41.98%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGID-NYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSII-LEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQG-----TPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILC---EVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTIS--KLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            GK+  +  LDRE   S              S     G +SP      + V + D ND  P F ++   + V+E++ +G +++   A D D      D  Y +++     S  +V         VL   + +DRE      L V+A D+G      +++ I + V D+NDN P F   T   +V E    G  +  +   DSD G N ++ Y I +  +     FK+ +   G+   L++ LD+E  N +  R+ A D G     T Y +    VT+ V + ND  P           D N I   + EN P +  +  I   D DS L+  +    +   P+  F +     +          +Q     DRE  S Y + +  +D       +L  +  +++ I D+NDN P F S  +   +ME    D+  +     I   D D G    ++Y +     S D+  FS++ +   +K    +DYE   Q+   + A D G P LT+     + V D NDN PE     +  +V E +P GT + ++ A D D+   N ++ + + S         + D F I+ ++G I T  +LD EK    ++ + V  T           F  SS ++ + ++D NDN PK 
Sbjct: 1069 GKITTSQVLDREAKAS-----------YVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTG-------VLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGT--FKINETT-GVISTLRA-LDFEVTNRYVLRVSATDMGKKQQKTSYQL----VTIYVEDANDNRPTF---------DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGL----------IQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSR-NLTYVME----DEPFNFQVTSITALDPDTGQGGNVEYRIV----SPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGS-NAELTYSIPS-------GVEMDKFSIDKHSGLIVTNSILDREKKD--TYFLTVHATGV------SYPFRVSSTSVRINVMDRNDNPPKF 1646          

HSP 7 Score: 122.865 bits (307), Expect = 5.234e-28
Identity = 138/529 (26.09%), Postives = 228/529 (43.10%), Query Frame = 3
Query:  828 NRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTIS-LSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDG-----ISLQLQST---LDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD----SKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTE-GVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            N  V+  KT +DRE  S +NL +  ++   P K  S ++++ V+D+NDN P F   T + L V EN +  R+  ++   DSD G+NS  SY I   +      FKL   +D        L + ++   +D E  + +   I A D G P       +++ V + ND  PE  F N        S   T+PEN     +I+ +  +DKD    +++   +   S P+ +F +  T  V          + N +  D E    Y I +   D  +  +L+ S  +++++ DVNDN P+   S+  G   +  +T+     T+   + V+DAD G N  +   L+   +   S  F V ++   I   + +D E    F    V +D G P  T      I+V D ND  P+     Y   V E   + T +  + A D D    N ++++   ++  T   +     F I+ ++G I T   LD E+   V   V V +              S + ++ V + D NDN P
Sbjct:   10 NAGVITTKTVLDREKVSAYNLTI--VEFSTPPK--SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQ--KLIAVDSDFGSNSTQSYTI--VSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPE--FSNV-------SYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGV----------IVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQ--VTENATIGTQVARVSVSDADSGKNGEVNVTLEGG-DGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGS-NSELVY---TIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGS--------PPLSDNCSVIVNLTDSNDNDP 496          

HSP 8 Score: 118.627 bits (296), Expect = 1.012e-26
Identity = 132/583 (22.64%), Postives = 257/583 (44.08%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEI--GHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIK--DGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNL----------NDEPPE-ILFYNRGSIVDPNSIQL-----TLPENGPKHQTIILIHVTDKDSKLSDILCEVSHP-KDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEI---GNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTN 2282
            + +N+ D NDN P F  S +   + E+        +V   A D+D+ + G   Y + +    G  F + +   +    +     +DRET + F+L++   D G P K+ +  + + V D+NDN P F+  +  +++ E+ R+G  +  +  TD+D    S+++YN++  ++      ++       G + Q++ +    N +  +++I   D  T  + +  T+ VR+ +              PP+  L Y R  I      +L      +PEN     +++ + VTD  + L   L  +S+  ++  Y R  +   +I   K          D ET   + + ++  D    SK  + V + + + DVND  P+F  S +  +  E       + +   V+ V+  D D G N R+ + ++   +  D   F+++ +   I+ +  +D+E  K     + A D G P +     +TI V D NDN P     G       VLE  P+ +++ +I A+D D+   N  + F ++   G         LF+I+  +G++ T +  D+E      + + ++ T+
Sbjct: 2053 LDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAG-VFTIDSTTGE----ITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLS-EVNIREDTRTGAVVTSVVATDTD--KESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKI---DADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLP--LGRISYNIENSNYFRIGQRSGVISVNK--------PLDYETKRRFLLVVSAIDDTAPSKPVR-VPVYINVSDVNDEKPVFGQSGYMAQWSE------GIPVGTIVVNVSAADKDSGANGRVWFAIQ---SGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPN--DVQVLENLPLNSRLYEINATDRDSGA-NARLSFTVIGGTG-------QGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATD 2594          

HSP 9 Score: 111.309 bits (277), Expect = 1.690e-24
Identity = 141/587 (24.02%), Postives = 236/587 (40.20%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKIN-YIRVNIEDENDNEPIF-PQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLIS------------DKSCGSCFEVKNE-PKDNRLVLVFKTKID------------RETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGAN-SQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGV--------IQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLV--AVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNR 2117
            G++     LDRE   S     +L+ +  +S          P +  N  ++V + D NDN P+F P S + I   E+   G  +    A D D  S    N K  S            D+  GS  ++K   P  N   + +K   D            R  +S   + V A+D+G P +      ++ V  I    P FE  +    V EN   G  +  ++VTD+  G    ++SYNIE+       YF++ Q + G+ + +   LDYE K  F   + A D   P       V + V+++NDE P  +F   G +           E  P    ++ +   DKDS  +  +       D     +  +  I  K  +   Q  +  D ET   + +++  +D  +   +   V + +++ D+NDNPP+F                 DV + E +        I  TD D G N+R+ + +   +  T    F ++     +      DYE +  +++ L   A D G P L+++  I ++V+D ++  P      Y F V     IG  +GQ+ A+D D+    R
Sbjct: 2124 GEITTAKLLDRETTAS----FDLVIRGTDSGI--------PPKSTNCQVKVVVTDLNDNPPLFDPLSEVNI--REDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRA----LVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIEN-----SNYFRIGQ-RSGV-ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKP--VFGQSGYMAQ-------WSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD-----DKGSFAIDRKTGVIRTQRAL--DHETIKTHHVSVRATDEGS-PPMHTDVSVTIRVLDLNDNPPVFRVP-----------GPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTV---IGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGR 2654          

HSP 10 Score: 107.071 bits (266), Expect = 3.099e-23
Identity = 165/693 (23.81%), Postives = 283/693 (40.84%), Query Frame = 3
Query:  468 HGKLIVTGP-LDREKICSPQTDQNLIQKCCESSCCMFIGITSPNR-KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDN---YKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYEN--KNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVN--IIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTE-----GVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTK------IGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL-ALKESLIVE--QAGSCLSSQKPIIITTSDIASNLC 2477
            H  LIVT   LDREK            K          G++ P R     +R+N+ D NDN P F    + + V EN      I     +DLD   YG +    Y ++S  + G  F +     +    L   TK+DRET + + L V A D   P  T   +I + +ED NDN P F++S  S ++ E    G  I  +  +D D G+N  + Y + + T      + ++ I D  +  + S   +E   K  + F  IAKDQG    M+   V +++ + N+  P+         + PN+    L         + ++  TD D+  S      ++ K  + L +++N     + +     ++    F       + + I   D  +   L     +Q+ I ++ D+PP F            + T   V + E       I    A    ++++ Y +    N   + Y    +    + + + +DYE +K F+  LVA   G  +L     + I+V D NDN P     F+  ++L +    T       + ++ A+D D+   N  V + + +         +  +F I++ TG I T  +LD E       ++R        GT   +   S++  + V + D+NDN P    L E  I E  + G+ ++S   ++ T +D  S L 
Sbjct: 1594 HSGLIVTNSILDREK------------KDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSP-ARLIYTLTVQDLD---YGNNTKVLYSIMSGNTDG-AFTIGRSTGE----LSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDT------YGVYSI-DSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASAL---------VTMVTATDADTDKS------TNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGS-PPLRGYGIVQIVIGNIQDDPPRF-----------LNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISG-NKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSP----AFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGT-NGKVTYSIWT-------GNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIR--------GTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTS---VVATDTDKESRLT 2207          

HSP 11 Score: 86.6557 bits (213), Expect = 5.971e-17
Identity = 103/380 (27.11%), Postives = 168/380 (44.21%), Query Frame = 3
Query: 1461 PKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKD----------ALNSTDSQYFS---VNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNF 2561
            P D+ Y     N  +I  K +         DRE  S Y +TI        S   +S  + + + D+NDN P    SF  G   +  + + D    + +I V D+D G NS   Y +            +   TD   ++   VN+      +   +D E+   +   + A DGG PA     +++I+V D NDN+PE  N  Y+ ++ E   +GT I Q+ ASD D    N ++ + +      +       +F I   TG I   V LD+E  +  S+L+ V+  ++  G+  +L   SSS  + ++++D+NDN+P + +  +L     GS   ++   I T   +A    S       DAD G N EV VTL+    +
Sbjct:    4 PADLEY-----NAGVITTKTVL--------DREKVSAYNLTIV-----EFSTPPKSYTVLVYVQDLNDNSP----SFVRGTSAKLVVFENDKDFRQKLIAV-DSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNA------SSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGT-NAEIQYSI------ETHSDPQAIFGIHPTTGVIVNNVRLDYEAKR--SYLIVVKAEDK--GSSHQL---SSSAIVRIEVLDVNDNNPVIHVSYTL----GGSYQVTENATIGT--QVARVSVS-------DADSGKNGEVNVTLEGGDGY 327          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 181.415 bits (459), Expect = 6.120e-47
Identity = 185/717 (25.80%), Postives = 309/717 (43.10%), Query Frame = 3
Query:  588 SPNR-KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKP--SKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMST--ATVTVRVTNLNDEPPEIL--FYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL--------------------------------------------------SDILCEVSHPKD------VFYLRETENVNIIEKKKIFELQNLI-------EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT-----DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALK-ESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDAD 2510
            SP R  I  I V I D NDN PIF     +  V EN  +G  +   KA D D+ S     Y + +  + GS F + N   +    ++ + + D E    +NL +   D G P  S     ++++ V D NDN P F +   + +V EN   G  + R+   D D G N+ + Y+I  ++      F +  I D   + L   LD E    +   +I  D G P L S     V V V+ +N+  P  L  FYN            ++PEN P   +I+ +   + D  +                                                  + +L   +H +D      VFY   T +V     K +F   +         E DRE+   Y + +   D  +  + T S  +++++ D NDNPP+F++ ++  ++ E         +   +++V+     D D G+N+ I+Y LKDA+ S   + FS+N    QI  K+ +DYE+   + F + A DGG+  LT S+ + I++ D NDNRP      Y   ++E   IGT + Q+ ASD D+  LN  V+F +L  +   +       F+I+ NTG + T   LD+E     + +++  +        D     S    + V +++INDNSP  + K  S  +++  +       + +T SD+ S+L  +  ++ L+ +
Sbjct:   86 SPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGS-FTIDNSTGE----IMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSI--HSGNTDDAFVI--IADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNA-----------SIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSV-----KGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPR-TASAHVKVEVLDCNDNPPVFTTLYYTLQLSEA------TSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVS---KKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDS-SLNGKVLFSILGGNSDGK-------FVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCG------DPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTV--GHVILRVTASDLDSSLNGKVLFSILEGN 751          

HSP 2 Score: 131.339 bits (329), Expect = 5.060e-31
Identity = 151/659 (22.91%), Postives = 271/659 (41.12%), Query Frame = 3
Query:  624 IEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEV--EDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIED----------------------YTSQAQRYFKLFQ---------------IKDGISLQ------------------------LQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPP--EILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI-------EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTAST--QITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            + DENDN P F Q      V+EN  +G  ++   A D D+    +  Y + S  +    F +  +  D    +     +D+ET   + L+++  D G P       +++ V    +N++ P F     + S+ EN   G  I R++  + D+   ++  Y I+D                      Y ++ +  F++++                 +GI+ Q                        L + LD E+   +   ++A+D G+P   ++A V V V + ND PP    L+Y            L L E       I+ +   D+D K   +  E+      ++L++     I+ KK  F + +           D E  S Y   +  SD    ++LT S  +++ I DVNDN P F  + ++ +++E      +V +   V QVT  D D  +N ++ + +   L       F ++     +   + +DYE   ++   + A D G P L +S    + +SV + NDN P    K Y+ S+ E   +G  I ++ ASD D+  LN  V+F +L  +   +       F+++ NTG + T   LD+E     + +++  +        D     S    + V +++INDNSP
Sbjct:  206 VVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHS-GNTDDAFVIIADSGD----ISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYT-----------LQLSEATSIGTRILRVSANDRDDKDEGVNAEIR-----YFLKDA----IVSKK--FSINDTTGQITIKQAVDYEERSSYSFEVFASDGGE-ARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVE------NVAIGTPVTQVTASDLDSSLNGKVLFSI---LGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDS-SLNGKVLFSILEGNSDGK-------FVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCG------DPPLNSSQPGMLHVSVVNINDNSP 813          

HSP 3 Score: 112.079 bits (279), Expect = 4.478e-25
Identity = 139/585 (23.76%), Postives = 253/585 (43.25%), Query Frame = 3
Query:  978 PHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQST--LDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSN--TISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEG--VIQVT--DADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISV--SDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADT-----------DQLNRDVIFEMLSLDGTKRRQ------RQNDLFIIENNTGFIKTRVVLDHEKDQHV----------SFLVRVRNTNEYVGTK------DKLDFY----------------SSSVAITVKIIDINDNSPKL-ALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKE 2549
            P F ++  S  + E+   G  +  +   D D   N++++Y+I  +++++  YF    + D I+  ++S+   DYE + ++ F + A+D+G+P   + AT+ V++T+ ND  P         I  P   +  + EN P    +  +   DKDS   +D++  + +  +        N +        E+    EFD E T  Y +TI+ SD+    +S L  +  + + +D+ NDNPP F+   +   + E        + T G  V++VT  D D G N+ +KY +    N+ D+  F + ++   I   +P+D E  + +   L+  D G P L +  ++ ++V  S  N++ P   N+FY  S+ E  P+GT I ++ A + D            D  +  V     + D T  R+      R+ +  + EN T   +   +  H++D+ +          S +  V  TN   G        D+   Y                ++S  + V+++D NDN P    L  +L + +A S  +    +     D              D DEG+NAE+   LK+
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESD-YF----VIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRP---------IFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNN--------NGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDE-NDNPPEFAQKRYTATVYE--------NFTVGTVVLRVTAHDKDSGPNAMLKYSIHSG-NTDDA--FVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRD--------------DKDEGVNAEIRYFLKD 537          

HSP 4 Score: 84.7297 bits (208), Expect = 1.205e-16
Identity = 96/407 (23.59%), Postives = 172/407 (42.26%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDN--YKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMST--ATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSD-ILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPI 1676
            G + +T  LDRE +       N++    +       G + P     +++V + D NDN P+F   Y  + + E   IG  I+   A D D    G++      + D      F +     D    +  K  +D E  S ++  V A D G+   TGS S+ + + D+NDNRP+F  +   + + EN   G  + ++  +D D   N ++ ++I    S  +  F + Q   G+ +    +LDYE+   +   I A D G P L S+    + V V N+ND  P         +        ++ EN      I+ +  +D DS L+  +L  +            +N  ++   K  + +++ E+    T + + T  C D    S  +Q   + + + ++NDN P+
Sbjct:  443 GVVSLTAELDRESVYQ----YNMLVVAQD-------GGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSIN----DTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGK--FVIDQ-NTGV-VTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP---------VFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEY----TLVIQAT-DCGDPPLNS--SQPGMLHVSVVNINDNSPV 814          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 169.474 bits (428), Expect = 2.057e-42
Identity = 159/619 (25.69%), Postives = 286/619 (46.20%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTI--VLPKAEDLDTPSYGIDNYKL---ISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISL-QLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVN----IIEKKKIFELQNLIE--FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETD--LTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRP--------EIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFL 2261
            G +    PL+RE+  S      L  +  +S+     G T        + + + D ND+ P F QS    +V E+V++GHT+  V    ED++      DN ++   IS  +    F V     +   ++   + +DRE N+ + L++ A D G P+   + S+++ +ED+NDN+P F +S  ++++ E+     ++ ++  TD D GAN Q +Y I      A     +F I     L  +++ LDYE  +++   + A+D GTP L     V + V++++D  P  +F+              L EN  +   +I ++ TD D        E SH K V+Y  E+ N +    I E+  +  L        +RET + Y + +       +++    V   + + DVNDN P F S  +   ++E    +TD  +      ++  D D G +  I + +   ++  ++  F ++++   +    P+D E +  +   ++A D G+PAL++S  + I+V D NDN P         I  +  TFSV E    G  +G + A D DT    +++I+  ++         +   FI+   +G ++TR+ LD E D  V +L
Sbjct: 1453 GNITTREPLNREETGS----YTLTLRAVDSAIRAREGTTR-------VIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDIN------DNARVRYYISSGNTSLMFSVN----ETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKI-----TAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAP--VFHKP-------RYSAELYENVTRGHHVITVNATDID-------AEASH-KRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATIL----TVKAQDGDEGESGEIIFTI---VSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDT----KNLIYYYIT------NTEEQKYFILNETSGELRTRITLDRE-DSSVHYL 2010          

HSP 2 Score: 153.68 bits (387), Expect = 1.715e-37
Identity = 163/713 (22.86%), Postives = 308/713 (43.20%), Query Frame = 3
Query:  636 NDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMS-TATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLI---------EFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPN---FSLDMGHNLICLKNL--HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPI 2729
            ND  P+F +S   + V E+   G  I    A D D    GI+     S     + F V     D    ++  + +DRE  +V+ L V A +    ++  +  + + V D+ D++P+F  S++++ + EN   G  + +I   D DIG    +SY+I +        + LF I D ++ ++++  + + +N+ ++ +  + + +  L+S    V V+V ++ND PP  +F   G  ++         E  P+  +I+ +   D D         +     V Y       +I+E    +   N I         + DRE    +  TI  +DS   SK + +  + +K+ D+NDN P+F+++ ++  + E    +Q       V+  +D D+G N+++ Y L   L +     F+++ +   I  +EP++ E++  +   L AVD    A   +T++ I+V+DAND+ P+     Y FSV E+  +G  +G++  +D D +   R  +   +S   T        +F +   TG I T   LD E++   + ++  ++          +    S+ ++ + I D+NDN P  +     +  +    L +Q   +I T                D DEG N +    +        F +D    LI +K    +     + ++V  QD   G       C + IH+     N P+
Sbjct: 1083 NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDE---GINAIIFYSSNGAEAKFYVSRSTGD----IIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIG--DTISYSIANGDP-----YGLFTI-DNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPP--VFSMPGYTIE-------YWEESPEGTSILQVKAIDAD---------IGDNAAVLY-------SIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSK-SSTASVAIKLVDINDNSPVFNNTDYYAYVRE----NQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTR----FAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNAR--VRYYISSGNTSL------MFSVNETTGIISTTSTLDREQNASYTLIITAKDHG--------IPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIAT----------------DPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDL--GTPPLTGACFVEIHVSDVDDNAPV 1712          

HSP 3 Score: 148.288 bits (373), Expect = 7.112e-36
Identity = 174/720 (24.17%), Postives = 299/720 (41.53%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFK---TKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNII--EKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDH--EKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTL---KENPNFSLDMGHNLICLKNL--HLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPI 2729
            + V +ED NDN P+F      I   E    G +I+  KA D D        Y ++ +        V +    N +  V     +++DRE    FN  + A D G PSK+ + S+ +++ DINDN P F  +     V EN  +G  +  +  +D D+G N+++SY +         Y +     D  ++  +  L+ E    +   + A D        T  V + VT+ ND  P+  F   G          ++ E+     T+  +  TD+D         ++    V Y   + N +++    +    +      DRE  + Y + IT  D + I  L  +  + + I+DVNDN P+FS S +   + E+      V +   V+QV  TD D G N +  Y +  A ++ D  Y   N+    IK K  +DYEK+  +   + A D G P LT +  + I VSD +DN P      Y+  + E    G  +  + A+D D +  ++ V + + S          + +F+I   +G I           ++ H  + ++V   +    T+ K     S V   + ++D+NDN+P+    ES +     S L    PI   T                D DEG + E++ T+    EN  F +D    ++            ++++ V+ +D+  G  +  +   +NI +     N PI
Sbjct: 1280 VVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVEN--------VTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVL-----SGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQ--FTQSG-------YAFSVREDVKVGHTVGRVATTDED---------INDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKD-HGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRES------VFLKTQVVQVIATDPDEGANGQFTYKIT-AGDTDDVFYIDANTGLITIKAK--LDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIES-------GNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQK-----SLVPAVITVLDVNDNAPRFD-SESYV----RSVLEDTGPITDATI---------LTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDK--GEPALSSSVTVNITVLDMNDNLPI 1930          

HSP 4 Score: 145.206 bits (365), Expect = 7.178e-35
Identity = 174/676 (25.74%), Postives = 288/676 (42.60%), Query Frame = 3
Query:  537 LIQKCCESSCCM---FIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEIL-----FYNRGSIVDP-----NSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRE-------------TTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGK-PALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESL---IVEQAGSCLSSQKPIIITTSDIASN 2471
            LIQ   E +  +   F G     R   +  + ++D NDN P+F +      + EN  +G TI+   A D D+ +     YK  +  +  + F   N        L     +D E    + L+V+A D G P      ++I+EV DI+D  P F +S     +EEN   G  +  ++  D D+G N+ + Y I    S       +F I      + +  ++D E  ++F   + A +   P   +T TV V V ++ND  P  L     F  R  +  P     + +Q+T  +  P  +  +L H+   DS             D F +  T     I K   +E Q    FD E             T       +  ++++T  K + +  + + + +VNDN P+F+ S  +   M+ ++T    H+ +  I  TDAD+G    + Y L+       + YFSVN++   I   + +DY+  +Q++F LV  DGG      A   +T+++ D NDN PE     YT  + E  P GT + Q+ A+D D+ +  R + F + + D           F I N +G + T   LD E     ++ + V   +  V ++ K       V +TV ++D NDN+P++    ++   I E AG        I     D  SN
Sbjct:    4 LIQDNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGE---LTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDG-----VFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRR-VLYHLVGADS-------------DKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKS-SYNYTMDEEIT-PGTHIAD--ITATDADLGTFGALTYELRGG----QAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGR-LSFNISAGDDGGH-------FSI-NGSGLVTTARELDRET--IATYTLTVSAYDHGVSSRHK------HVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSN 632          

HSP 5 Score: 134.035 bits (336), Expect = 1.496e-31
Identity = 160/631 (25.36%), Postives = 269/631 (42.63%), Query Frame = 3
Query:  612 IRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILF----YN---RGSI-VDPNSIQL--TLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEG--VIQVTDADI---GMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEP---IDYEKSKQFKFFLVAVDGGKPALTASTQIT---ISVSDANDNRPEIGNKFYTFSVLEEQ-PI-GTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQK 2435
            + + + D NDN P+F  +     V EN   G  +++  A D D  +    N KL    S         +P    +    +  ++RE    + L + A+D    ++ G+  +I+ V D ND+ P F +S  + SV E+ + G  + R+  TD DI  N+++ Y    Y S           +    +   STLD E    +   I AKD G P L S  +V + + ++ND  P  LF    YN   R S+ +    +Q+  T P+ G   Q    I   D D              DVFY+     +  I+ K           D E TS+Y +T++  D  T   LT +  +++ + DV+DN P+F    +  ++ E        ++T G  VI V   DI     + R+ Y ++    +TDS +           N  P   ++ E   +++  + A+   +  LT    +    I+V D NDN P   ++ Y  SVLE+  PI    I  + A D D  + + ++IF ++S         +N +F ++N TG +     LD E     S +V   +  E           SSSV + + ++D+NDN P L     +++ +  +  S ++
Sbjct: 1385 VAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGT----NAKLSYVLSGVLYTRFAIDPDTGNITT--REPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRY----YISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKP--LFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTD--------------DVFYIDANTGLITIKAK----------LDYEKTSLYNLTVSAQDLGT-PPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYE--------NVTRGHHVITVNATDIDAEASHKRVYYRIESG--NTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAI--SRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGE-SGEIIFTIVS-------GNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPA--------LSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKE 1950          

HSP 6 Score: 124.02 bits (310), Expect = 1.826e-28
Identity = 159/658 (24.16%), Postives = 275/658 (41.79%), Query Frame = 3
Query:  429 FTDRKNSQPFSLSH--GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDS-NTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGV----IQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIK-NKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
             T+      FS+++  G++ V G +DRE + +      ++    E       G  S  +    + + ++DENDN P F  +  +  + EN  +G TI +                 +   K   S    ++ P+    +L  + K                   +P       I L    IND  P FE+S   ++V E+   G  I R+  TD D G N+ + Y      S      K +  +    + + S LD E KN++   + A +       +T  V + VT++ D+ P   ++N       +S+ + L EN      +  I   DKD  + D +       D + L   +NV         E++ + E DRE  + Y + +   DS N +S L   +++ ++++DVNDNPP+FS   +  +  E           EG     ++  DADIG N+ + Y + +  N TD  Y +VN+    I      +D E  + F F + A D G P+ +++  + I + D NDN P   N  Y   V E QP GT +  + ASD D    N  + + +  +  T+        F I+ +TG I TR  L+ E+    S+ + +R  +  +  ++       +  + + + D ND+ P+ 
Sbjct:  959 LTNGNKDDAFSINNVTGEITVAGVIDREAVHT-----FVLTVQAEDQ-----GEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITM-----------------VPDQKISSSTLRPRSSPRAPAALLTAREK-------------------RP-------ITL----INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFY------SSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKP---YFNS------SSLTVKLSENASIGTNVTKITALDKD--IGDTISYSIANGDPYGLFTIDNVT-------GEIRTVAELDRENVTQYELFVQAKDSVNLVSDL---LKVVVQVEDVNDNPPVFSMPGYTIEYWE--------ESPEGTSILQVKAIDADIGDNAAVLYSIVE--NVTD--YVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGT-NAKLSYVLSGVLYTR--------FAIDPDTGNITTREPLNREETG--SYTLTLRAVDSAIRARE------GTTRVIITVTDANDHVPQF 1503          

HSP 7 Score: 115.546 bits (288), Expect = 8.011e-26
Identity = 176/664 (26.51%), Postives = 274/664 (41.27%), Query Frame = 3
Query:  603 INYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEES-TISLSVEENGRSGREI-KRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQST-LDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQ------LTLPEN-GPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYR---------ITITCSDSNT-IS-KLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALK--ESLIVEQA--GSCLSSQKPIIITTSDIASNLCSEFPYTFLDADE 2513
            I  + V ++D NDN+P F        + EN+  G  +    A D D+   G  ++  IS    G  F +      + LV   + ++DRET + + L V A D G  S+   + + + V D NDN P   +  TI+ ++ E    G  +   I   D D G+N Q++Y++    S     F L        LQ+  T LD E K+ ++  I   D G+P   ++ TV V + ++ND  P           DPN  Q      +T+ E  G  ++T+I I+ TD D+         ++ K  + L   E+          EL    E DRE+  + R         + IT +D  T IS + + +V + + + D NDN P F S  +  ++ E             VIQV  TD D+    ++ Y++ D   +   +   +   Y   K K  +  ++SK                   T + I V D NDN P      Y   VLE  P GT + ++ ASD D    N  + +++   +G K     +D F I N TG I    V+D E        V+  +  E    K       + V ITVK  D NDN P+ +    E  I E +  GS ++      I++S +        P   L A E
Sbjct:  477 IATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFN-ISAGDDGGHFSING----SGLVTTAR-ELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM----SGGDSRFTLNSATG--RLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAF---------DPNPAQSLATYVITVDEGPGTINKTLIDINATDPDAD--------ANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEA------ARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWHK-KNCVLCKESK--------------CSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRD-QGANGKITYKL--TNGNK-----DDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRK-----TFAEVVITVK--DENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTARE 1075          

HSP 8 Score: 114.775 bits (286), Expect = 1.163e-25
Identity = 142/564 (25.18%), Postives = 239/564 (42.38%), Query Frame = 3
Query:  456 FSLSHGKLIVTG-PLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEP-IFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEE------STISLSVEEN-GRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNI---------FEFRIIAKDQGTPY---LMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTAS-TQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQI 2081
            FS++   L+ T   LDRE I +             +      G++S ++ +  + VN+ DENDN P I     I   + E    G T++L     +D P  G  N +L    S G      N     RL  +  T +DRE    ++L++   D G P  T S ++ + + D+NDN P F+       +T  ++V+E  G   + +  I  TD D  AN +++Y++   +     +F+L  +   +S++ +  LD E+  +         F   I A DQ TP      +T  V++ V + ND  P+    N          +  L E       +I +  TD+D         + +   V Y     N+   ++ +  E++ L+   R      +  + C +S    + T  V   + +DDVNDN P+F+ S +   ++E   T   V      +  +D D G N +I Y L    N      FS+N+   +I     ID E    F   + A D G+P+   +  ++ I+V D NDN P+     Y   + E  P+G+ I  +
Sbjct:  542 FSINGSGLVTTARELDRETIAT----------YTLTVSAYDHGVSSRHKHVQ-LTVNVLDENDNTPQITDGLTITTNISEGAG-GGTVLLSSIAAVD-PDAG-SNGQLTYSMSGGDSRFTLNSAT-GRL-QISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL---SGDEHGFFRLDPVTGELSVRKE--LDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQN---------YETRLSEAARPGSNVIQVSATDQD---------LEYKGKVIY-----NITDGDENRKCEVEKLV---RHYNWHKKNCVLCKESKCSVERTYVV---IYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLR----VHASDRDQGANGKITYKLT---NGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV 1048          

HSP 9 Score: 113.62 bits (283), Expect = 2.927e-25
Identity = 164/702 (23.36%), Postives = 281/702 (40.03%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITS-------PNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTG--SLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMST-ATVTVRVTNLNDEPPEILFYN-RGSIVDPNSIQLTL--------------PENGPKHQTIIL---------------------------------------IHVTDKDSKLSDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIK-TRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSP 2372
            G+L V   LDRE   SPQ  +N      +      + IT+        +RK   +RV+I   D NDN P F     +  + E    G  ++   A D D    G   Y +        C EV+              K+ R  N      VL     K SK       +++ V+D+NDN P F +S  +  V EN  +G  + R+  +D D GAN +++Y + +        F +  +   I+  +   +D E  + F   + A+DQG P    T A V + V + ND  P+  F    G I + + +  T+              P + P+    +L                                       +  TD+D  ++ I+   S+  +  FY+  +    I++             DRE  ++Y + +T ++    ++ T + ++ + + DV D+ P F+SS    K+ E      +  +   V ++T  D  +   I Y +    N      F++++   +I+    +D E   Q++ F+ A D     ++   ++ + V D NDN P      YT    EE P GT I Q+ A DAD    N  V++ ++        +   D   +   TG I      LD E +++ +F +R  ++    G   K    SS+ ++ +K++DINDNSP
Sbjct:  765 GELSVRKELDRE---SPQMSRN-----AQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKC-EVE--------------KLVRHYNWHKKNCVLC----KESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTN--GNKDDAFSINNVTGEIT--VAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDIIVDSP----------LDREFKNVYILNVTAANIVAGAQDT-TTQVHITVTDVIDDKPYFNSSSLTVKLSE------NASIGTNVTKITALDKDIGDTISYSIA---NGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVN-LVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGD-NAAVLYSIV--------ENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDS----GVPSK----SSTASVAIKLVDINDNSP 1397          

HSP 10 Score: 87.8113 bits (216), Expect = 2.442e-17
Identity = 170/695 (24.46%), Postives = 276/695 (39.71%), Query Frame = 3
Query:  456 FSLS--HGKLIVTGPLDREKICSPQ---TDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDN---YKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEEN-GRSGREIK-RIKVTDSD------------IGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEF-----------------------RIIAKDQGTPYLMST-ATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKD-SKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVI----QVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKI--GQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIK-TRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKL 2378
            FSL+  +G+L + GPLD E   S       ++L     ES   + I +T              D +D  P F QS+    + EN  IG T+V  +A D D    GI+N   Y++IS  S G  F + +    N  V+     ID E   VF + V A +   P+   ++++++ V D+NDNRP F +S     V E+    GR +  +++VTD D            +GA+S   + I D TS               +L +  TLDYE +  F F                       +++A +  T    S  A+VT+ + N+ND  P         +   +S   T+ E       I  I  TD D      +  E+   +  ++    +N   I   +I         D +T   Y+ ++   D     +      + + + DVNDN P F+   +   I E        ++  G I      TD D G N R+ +++       D  +FS+N        +E +D E    +   + A D G  +     Q+T++V D NDN P+I +     + + E   G  +    I A D D    N  + +   S+ G   R      F + + TG ++ +   LD E       ++ V +      T        +S  + V I+D+NDN+P  
Sbjct:   96 FSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVT--------------DISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDV---GINNPILYEIISGNSDG-VFTIDS----NTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSD-KFAI-DPTSG--------------TLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKP---------MFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADN-GTISAAQI--------LDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAE--------NLPAGTIVFQVTATDKDSGENGRLSFNISAG---DDGGHFSINGSGLVTTARE-LDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGS-NGQLTY---SMSGGDSR------FTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNT--------NSTTVHVTILDVNDNTPAF 704          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 235.343 bits (599), Expect = 2.614e-63
Identity = 199/701 (28.39%), Postives = 333/701 (47.50%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGITS-PNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            +DREK+C   + +       ++ C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT    +  Y+LI+ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDN+P F E+ I + + EN   G  + +++ TD+DIG N+++ Y      S A +         G+ + +Q  LD E   I +  ++A D  +    + ATV + VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       +ME +   +D+ +T   +  TD D G N+ I Y L       ++ +F ++ +   +      D E   +F F + A D G P L A   + ++V D NDN P+  +  + F V E  P  + +G I  +D+D  + N  +   +L+          N+ FI++  +G IK+ V  D E+    +F VR  ++             SS+  +T+ +ID+NDN+P        IV    S  S +   ++  S I  ++ +E     +D+D G+NAE+  T+    N  L
Sbjct:   92 IDREKLCPGSSFE-------DAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGL-ITVQRPLDREETAIHKLSVLASDGSSS--PARATVIINVTDVNDNPPNIDLRY----IISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELAVMENN--KRDLFLT--TLSATDEDSGKNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGE-NAAISLSILN---------DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPP--------CSSAAKVTINVIDVNDNTP--------IVIYPPSNTSFK---LVPLSSIPGSVVAEV--FAVDSDTGMNAELKYTIVSGNNKGL 724          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 235.343 bits (599), Expect = 7.395e-63
Identity = 199/701 (28.39%), Postives = 333/701 (47.50%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGITS-PNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            +DREK+C   + +       ++ C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT    +  Y+LI+ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDN+P F E+ I + + EN   G  + +++ TD+DIG N+++ Y      S A +         G+ + +Q  LD E   I +  ++A D  +    + ATV + VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       +ME +   +D+ +T   +  TD D G N+ I Y L       ++ +F ++ +   +      D E   +F F + A D G P L A   + ++V D NDN P+  +  + F V E  P  + +G I  +D+D  + N  +   +L+          N+ FI++  +G IK+ V  D E+    +F VR  ++             SS+  +T+ +ID+NDN+P        IV    S  S +   ++  S I  ++ +E     +D+D G+NAE+  T+    N  L
Sbjct:   92 IDREKLCPGSSFE-------DAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGL-ITVQRPLDREETAIHKLSVLASDGSSS--PARATVIINVTDVNDNPPNIDLRY----IISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELAVMENN--KRDLFLT--TLSATDEDSGKNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGE-NAAISLSILN---------DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPP--------CSSAAKVTINVIDVNDNTP--------IVIYPPSNTSFK---LVPLSSIPGSVVAEV--FAVDSDTGMNAELKYTIVSGNNKGL 724          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 235.343 bits (599), Expect = 7.713e-63
Identity = 199/701 (28.39%), Postives = 333/701 (47.50%), Query Frame = 3
Query:  495 LDREKICSPQTDQNLIQKCCESSCCMFIGITS-PNRKINYIRVNI--EDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEI-LFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKL-SDILCEVSHPKDV-FYLRETENVNIIEKKKIFELQNLIE----FDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL 2567
            +DREK+C   + +       ++ C   I +   PN     I++ I  +D NDN P+FP   I I++ EN  I     +P A D DT    +  Y+LI+ +S      V+    +    L+ +  +DRE    + + +   D G P K+ +  + + V D+NDN+P F E+ I + + EN   G  + +++ TD+DIG N+++ Y      S A +         G+ + +Q  LD E   I +  ++A D  +    + ATV + VT++ND PP I L Y    I+ P +  + L E  P +  I LI V+DKD+ +   ++C +   KDV F+L           K +++ Q L+E     D E T  Y   I  SDS   S L Q+  ++++++D NDNPPIF+       +ME +   +D+ +T   +  TD D G N+ I Y L       ++ +F ++ +   +      D E   +F F + A D G P L A   + ++V D NDN P+  +  + F V E  P  + +G I  +D+D  + N  +   +L+          N+ FI++  +G IK+ V  D E+    +F VR  ++             SS+  +T+ +ID+NDN+P        IV    S  S +   ++  S I  ++ +E     +D+D G+NAE+  T+    N  L
Sbjct:   92 IDREKLCPGSSFE-------DAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGL-ITVQRPLDREETAIHKLSVLASDGSSS--PARATVIINVTDVNDNPPNIDLRY----IISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIE--KDVPFHL-----------KAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPS-LNQTALVRVRLEDENDNPPIFTQPVIELAVMENN--KRDLFLT--TLSATDEDSGKNAEIVYQL-----GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGE-NAAISLSILN---------DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPP--------CSSAAKVTINVIDVNDNTP--------IVIYPPSNTSFK---LVPLSSIPGSVVAEV--FAVDSDTGMNAELKYTIVSGNNKGL 724          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 234.187 bits (596), Expect = 2.369e-62
Identity = 190/722 (26.32%), Postives = 326/722 (45.15%), Query Frame = 3
Query:  582 ITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCF--EVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLK-ENP----NFSLDMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVN 2720
            + +P+ ++   R+ ++D NDN P FP S + I+V EN  +G    +P A D D+   G+ +Y L +     + F  +V ++       L+    +DRE    ++L + A+D G P +     + + V D NDN P FE  +    V EN   G  + ++K  DSD+G N ++ Y++        +  ++ +   GI + ++  LD E  N   F ++A+D+G     S   VT+ VT+ ND  P +     G +     I   + E+ P    + L+ V+DKD   + ++  V      F LR   +     K+K F LQ     D E    YR+ I   DS   + L+ +  +++++ DVNDN P+FS +     I E D  +++    E ++ V  TDAD G N+ + Y++    +S     F ++    ++K + P+D E  ++++F + A D G P    +  + I V D NDN P+     Y+FSVLE  P  + +G +   D D  + N  V    +  DG K        F+++N TG I + +  D EK+   +F ++  +  E           SS V +T+ ++D NDN P +    +    Q     S    + +  ++              D D G NA++V ++   NP      S   G   +  +      G   + V   DR  G   R A  L++I++  +  N
Sbjct:  185 LQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTT-GI-IYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYF-LQTTTPLDYERVKEYRVEIVAVDSGNPA-LSSTNSLKVQVTDVNDNSPVFSPT-----IFEVDFAEEN-QPGETILDVTATDADSGTNAELFYNI--VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGE-NAHVHLS-VEPDGGK--------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPP--------RSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAE--------------DLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDR--GKPPRHATALVHIYVNETISN 859          

HSP 2 Score: 121.324 bits (303), Expect = 2.556e-27
Identity = 123/544 (22.61%), Postives = 226/544 (41.54%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGI----TSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH--------ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVK---NEPKDN--RLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFK-LFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDN----RPEIGNKFYT 2033
            G + V GPLDRE+I               +S   ++        P     ++ + + D+NDN P      I +  H        E++ +G  + L +  D D     +    +  D      F+++   +   DN  +  L   T +D E    + + ++A+D G P+ + + S+ ++V D+NDN P F  +   +   E  + G  I  +  TD+D G N+++ YNI         Y K LF+I      ++ ++ LD E+K  +EFR+ A D+G+P    TATV ++V + ND  P+ +          +    ++ EN P    + ++ V D D        E +H   V    E +    + +     + + I FDRE  S Y   +   D     + +  V + + + D NDN P+ +   +      + +   D H+   V++  D D G N+ + + +         Q F ++    +I   + +  +     +  +   D GKP   A+  + I V++   N       +G+  YT
Sbjct:  378 GIIYVKGPLDREEI---------------NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP----FQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNI-----VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFML---------SGYSFSVLENMPPLSPVGMVTVLDMDKG------ENAH---VHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR-SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVD--VVEAEDLDSGPNADLVFSIA---GGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYT 873          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 232.261 bits (591), Expect = 2.438e-62
Identity = 198/757 (26.16%), Postives = 342/757 (45.18%), Query Frame = 3
Query:  492 PLDREKI--CSPQTDQNLIQ-KCC--ESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCF--EVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQV--TDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSL-----DMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVN 2720
            P+DRE +  C     ++L++ K C  E    +   + +P+ ++   R+ ++D NDN P FP S + I+V EN  +G    +P A D D+   G+ +Y L +     + F  +V ++       L+    +DRE    ++L + A+D G P +     + + V D NDN P FE  +    V EN   G  + ++K  DSD+G N ++ Y++        +  ++ +   GI + ++  LD E  N   F ++A+D+G     S   VT+ VT+ ND  P +     G +     I   + E+ P    + L+ V+DKD   + ++  V      F LR   +     K+K F LQ     D E    YR+ I   DS   + L+ +  +++++ DVNDN P+FS +     I E D  +++    E ++ V  TDAD G N+ + Y++    +S     F ++    ++K + P+D E  ++++F + A D G P    +  + I V D NDN P+     Y+FSVLE  P  + +G +   D D  + N  V    +  DG K        F+++N TG I + +  D EK+   +F ++  +  E           SS V +T+ ++D NDN P       ++ + + S      P+    S +             D D G NA++V ++     + L       G   +  +      G   + V   DR  G   R A  L++I++  +  N
Sbjct:   78 PIDRETLRDC-----RSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTT-GI-IYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYF-LQTTTPLDYERVKEYRVEIVAVDSGNPA-LSSTNSLKVQVTDVNDNSPVFSPT-----IFEVDFAEEN-QPGETILDVTATDADSGTNAELFYNI--VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGE-NAHVHLS-VEPDGGK--------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGE--------PPRSSYVGVTINVLDENDNDP-------VVTKPSNSSFRQLSPVASPDSHVDVVEAE-------DLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDR--GKPPRHATALVHIYVNETISN 782          

HSP 2 Score: 119.783 bits (299), Expect = 6.470e-27
Identity = 123/544 (22.61%), Postives = 226/544 (41.54%), Query Frame = 3
Query:  471 GKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGI----TSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH--------ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVK---NEPKDN--RLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFK-LFQIKDGIS-LQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDN----RPEIGNKFYT 2033
            G + V GPLDRE+I               +S   ++        P     ++ + + D+NDN P      I +  H        E++ +G  + L +  D D     +    +  D      F+++   +   DN  +  L   T +D E    + + ++A+D G P+ + + S+ ++V D+NDN P F  +   +   E  + G  I  +  TD+D G N+++ YNI         Y K LF+I      ++ ++ LD E+K  +EFR+ A D+G+P    TATV ++V + ND  P+ +          +    ++ EN P    + ++ V D D        E +H   V    E +    + +     + + I FDRE  S Y   +   D     + +  V + + + D NDN P+ +   +      + +   D H+   V++  D D G N+ + + +         Q F ++    +I   + +  +     +  +   D GKP   A+  + I V++   N       +G+  YT
Sbjct:  301 GIIYVKGPLDREEI---------------NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP----FQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNI-----VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFML---------SGYSFSVLENMPPLSPVGMVTVLDMDK------GENAH---VHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR-SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVD--VVEAEDLDSGPNADLVFSIA---GGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYT 796          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000033582.1 (SMESG000033582.1)

HSP 1 Score: 2139.38 bits (5542), Expect = 0.000e+0
Identity = 1068/1074 (99.44%), Postives = 1073/1074 (99.91%), Query Frame = 3
Query:  237 MIFPNSVVLTVIIYLRFPIAYPCDYISVITVTENIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSEPQEKMIDTKTXXXXXXXXXXXXXXXXXXMIVVFKSKLCLPGPISPPARRRGKPNEKQINSNTSKMYSTINAVANCENKRLCDDYMSGGLNNYRTVTPNYSNNVFITRTNSPNDDVRIVKFPISPENRFATITRSCDELFNEQDEIINNNAVNSPNSDIKYEQLHGIAPHLNQSNNTITWDKTAAHQYNYLLEPRDSGSLPSKGKNFTSKPEPTPISTNFHQKSINDVYLQTSFV 3458
            MIFPNSVVLTVIIYLRFPIAYPCDYISVITVTENIPYPSSSLID+GHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHT+VLPKAEDLDTPSYGID+YKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTV+VIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSEPQEKMIDTKTIVIFIVLIAVIIIFCLLLMIVVFKSKLCLPGPISPPARRRGKPNEKQINSNTSKMYSTINAVANCENKRLCDDYMSGGLNNYRTVTPNYSNNVFITRTNSPNDDVRIVKFPISPENRFATITRSCDELFNEQ+EIINNNAVNSPNSDIKYEQLHGIAPHLNQSNNTITWDK AAHQYNYLLEPRDSGSLPSKGKNFTSKPEPTPISTNFHQKSINDVYLQTSFV
Sbjct:    1 MIFPNSVVLTVIIYLRFPIAYPCDYISVITVTENIPYPSSSLIDIGHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQNLIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTLVLPKAEDLDTPSYGIDSYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVNVIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSEPQEKMIDTKTIVIFIVLIAVIIIFCLLLMIVVFKSKLCLPGPISPPARRRGKPNEKQINSNTSKMYSTINAVANCENKRLCDDYMSGGLNNYRTVTPNYSNNVFITRTNSPNDDVRIVKFPISPENRFATITRSCDELFNEQNEIINNNAVNSPNSDIKYEQLHGIAPHLNQSNNTITWDKAAAHQYNYLLEPRDSGSLPSKGKNFTSKPEPTPISTNFHQKSINDVYLQTSFV 1074          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000033582.1 (SMESG000033582.1)

HSP 1 Score: 1910.19 bits (4947), Expect = 0.000e+0
Identity = 958/963 (99.48%), Postives = 962/963 (99.90%), Query Frame = 3
Query:  570 MFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSEPQEKMIDTKTXXXXXXXXXXXXXXXXXXMIVVFKSKLCLPGPISPPARRRGKPNEKQINSNTSKMYSTINAVANCENKRLCDDYMSGGLNNYRTVTPNYSNNVFITRTNSPNDDVRIVKFPISPENRFATITRSCDELFNEQDEIINNNAVNSPNSDIKYEQLHGIAPHLNQSNNTITWDKTAAHQYNYLLEPRDSGSLPSKGKNFTSKPEPTPISTNFHQKSINDVYLQTSFV 3458
            MFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHT+VLPKAEDLDTPSYGID+YKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTV+VIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSEPQEKMIDTKTIVIFIVLIAVIIIFCLLLMIVVFKSKLCLPGPISPPARRRGKPNEKQINSNTSKMYSTINAVANCENKRLCDDYMSGGLNNYRTVTPNYSNNVFITRTNSPNDDVRIVKFPISPENRFATITRSCDELFNEQ+EIINNNAVNSPNSDIKYEQLHGIAPHLNQSNNTITWDK AAHQYNYLLEPRDSGSLPSKGKNFTSKPEPTPISTNFHQKSINDVYLQTSFV
Sbjct:    1 MFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTLVLPKAEDLDTPSYGIDSYKLISDKSCGSCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVNVIGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSEPQEKMIDTKTIVIFIVLIAVIIIFCLLLMIVVFKSKLCLPGPISPPARRRGKPNEKQINSNTSKMYSTINAVANCENKRLCDDYMSGGLNNYRTVTPNYSNNVFITRTNSPNDDVRIVKFPISPENRFATITRSCDELFNEQNEIINNNAVNSPNSDIKYEQLHGIAPHLNQSNNTITWDKAAAHQYNYLLEPRDSGSLPSKGKNFTSKPEPTPISTNFHQKSINDVYLQTSFV 963          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000042783.1 (SMESG000042783.1)

HSP 1 Score: 419.083 bits (1076), Expect = 5.346e-128
Identity = 276/830 (33.25%), Postives = 451/830 (54.34%), Query Frame = 3
Query:  255 VVLTVIIYLRFPIAYPCDYISVITVTENIPYPSSSLIDVGHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQN--LIQKCCESSCCMFIGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLIS-DKSCGSCFEVKNEP-KDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQ-AQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSL---DGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSS--VAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINIHLK 2705
            ++L +I + +      CD I  + +TE        L DV   +  S L S    D+ Y ++  +S  F L +G++ +  P+DRE+ CS        +  +CC   CC+FIGI S +   K  YI++ + D NDN P FP+      + EN +I   I LP A D D   +G+++Y++   +++    F++  E   DN+  +L+ K +IDRE        ++A+D GKP + G   IIL+V D ND  P F +    + ++E+  +G E+  ++V D D G N ++S N    T+Q  Q  F+L Q   G++L+L S LDYE  N + F ++AKD G P   STA V V VTN+ND PP I+FY     +     ++ + E   K   I L+ VTD D++   I CE+   ++ FYL   +   ++E +K +E+++ I+FDRET +++ ++I CSD+  I++L Q+ ++++ I D+NDN P FSS  ++G I++ +  ++ V + +  I  TD D G N  ++Y++ + ++     YFS++     +K    +DYEK K     + A D G P  ++S ++ ++V D NDN+PE+   FY+F + E +PIGT +G++  +D DTD  N+ +I ++ +L         Q  + +F I+N +G I T+VVLD E    + F +   N N     KD    +  +  +++TV I+D NDNSP + LK+   V+     +S  K    T  +I    C  FPY F+D DEG N++V VT+K N  FSL   + ++C        G +   ++ +D +  N SR+ E LINIH+K
Sbjct:    4 ILLILIFFCQLSELDACDSIKQVEITETT-VSLFELADVSDHIGRSGLKS----DSFYLSEDTDS--FQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTKKKVYIKIKVVDINDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREIIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPAFSSPRYYG-IVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDM-KNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDINNKRIIMKIKNLLPGPTLATSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIK--TSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIVAEDGD-FNNSRKQEFLINIHIK 821          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000048159.1 (SMESG000048159.1)

HSP 1 Score: 339.732 bits (870), Expect = 9.490e-99
Identity = 247/755 (32.72%), Postives = 397/755 (52.58%), Query Frame = 3
Query:  453 PFSLSHGKLIV-TGPLDREKICSPQTDQNLIQKCCESSCCMFIG---ITSPNRKINYIRVNIEDENDNEPIFPQSYIK---IAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLIS----DKSCGSCFEVKNE-PKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYFKLFQI-KDGISLQLQSTLDYE-NKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETT--SIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADE-GLNAE-VVVTLKENPN---FSLDMGH-NLICLKNLHLSPGYFTVSVIGQDR 2651
            PF L   +LI     ++RE +C     + + + C    CC  IG   +T  +    +I + I D+ND  P F  S IK     + ENVE+G  I LP A D D+  Y +  Y L      D++      V N+ P   +L++  K   ++    VF L     D      + S +I +E+ED+NDN P F + T + +++EN R  + IK   V+D D G N  ++ NI D T +  + FK+F+I ++   L+L ++LDYE + ++FEF ++A DQGTP L S+A V + + NLND  P+I F   G  V  NS+ +   E  P H  ++ + VTD D+  + I C++    D+FYL      N +   K F L+ + + DRE+   S  RITI+C+DS    ++T +  + ++I+DVNDN P+FS   + G + E  + +  V+  + +I VTD D G+N + +++L+D  N +DS  F ++    +I  +  +DYE   +F+F ++A+D G   LT+S+ ITI+V D NDN P      Y F+V E   +G KIG + A+D DTD+ N+D+ + +      + +   +  F I+  TG ++TR  LD E  + +S  V  +N N+Y  +   +    S V + +K++D+NDN+PK   + ++           QK   I    +  N C+E PYT  D D+ G+N +    T+ EN     FSL     + ICL+        +TV++I +DR
Sbjct:   70 PFKLQLNQLIQPNNGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQF--SSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIK-FTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSII--EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGNVDENQV-NVVVNFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQATDDDTDRKNKDIFYSI------EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKY--SSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNM----------KQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDR 798          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 312.768 bits (800), Expect = 1.399e-89
Identity = 256/867 (29.53%), Postives = 436/867 (50.29%), Query Frame = 3
Query:  291 IAY-PCDYISVITVTENIPYPSSSLIDVGHLLLTSSLI--SQAEKDNIYFTDRKNSQPFSL-SHGKLIVTGPLDREKICSPQTDQNLIQKCCES--SCCMFIG--ITSPNRKI--NYIRVNIEDENDNEPIFPQSYIK-IAVHENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCG--SCFEVKNEPKDNRLVLVFKTKIDRETNSVFNLLVLAIDRGKPSK-TGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQA-QRYFKLFQIKDGIS-LQLQ----STLDYEN-KNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRI------TITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKP-ALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDI-ASNLCSEFPYTFLDADE--GLNAEVVVTLKENPNFSLDMG---HNLICLKNLHLSPGYFTVSVIGQDRNGGNGSRRAECLINI------HLKSSTVNKPINNPKLRPSEPQEKM 2771
            IAY  C +I    +TEN      ++ ++  LL++ S I  S+A+   I+ +   N+  F L S   L V+  +DRE++C PQ    L  K C S  +CC  +   I+  N ++  N+IRV ++DENDN P+FP        + EN  +G+ I LPKA+DLD  ++ + +YKL      G  S FE+    KD    L+  + +DRE  S++   ++AID  + ++ TG   I +++ DINDN P FE      +++EN      I +I VTD D   N ++   + +   +   + F L  +   I  +Q Q    + LDYE   + FEF+I+A+D G   L STAT+ +++ N+ND  PEI F   G  +       ++ E    ++ +  + V+D DS ++ + C +  P+++  + E+   + +   K F L+     DRE    + I      T+ C D +    L  +  I + I+DVNDNPP F+ + ++G+I E ++ + +V M    I   D D+ +N ++ YH++D  NS+++ YF ++S+  +I N +  D+EK   + F +VA D G P  L++S+ I + + D NDN P+     + F V E   IG  IGQI A+D D+   ++D+ F + S      + R + L  ++  TG I+TR  +D EK   ++F V  +N +             + + ITV+  D+ND+ P   LK+            S+  +II+   +    +C   P+   DAD+   +N   VV LK N N  L +     N+IC+  +        V++I  D++ GN S   E    I      ++ + + N+P ++   +P + ++++
Sbjct:   13 IAYTKCQFIHEFHITENSKI-YKTIFNLKTLLISKSKIDSSKAKDCKIFMSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQL-NKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGG---FSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQI-EENINNHEVFMN-AAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKS----DSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDL----IQEAMIVITVR--DLNDSPPTFRLKD-----------PSKSQLIISLETLQQGQICESIPFEVEDADDNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKH-GNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEI 849          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH93.958e-6428.37protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.002e-6328.37protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.237e-6328.37protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.399e-6328.37protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11X4.354e-6128.96protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh-15.839e-4524.38CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
fmi-14.332e-4427.60FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-16.352e-4427.60FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-41.563e-2623.70Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-31.536e-2526.19Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds3.515e-5428.35gene:FBgn0284247 transcript:FBtr0078045[more]
ds3.515e-5428.35gene:FBgn0284247 transcript:FBtr0343249[more]
stan5.067e-4827.01gene:FBgn0024836 transcript:FBtr0339463[more]
stan5.846e-4827.01gene:FBgn0024836 transcript:FBtr0304899[more]
stan5.846e-4827.01gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh95.890e-6629.15protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh96.606e-6629.15protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh96.606e-6629.15protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.19.001e-6629.15pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh1a7.134e-6226.82protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa3.288e-6227.72VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000047798.13.922e-6029.11protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.14.469e-6029.11protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.15.660e-6029.11protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh176.319e-6025.41protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh91.337e-6228.09protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh96.880e-6227.96protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh97.502e-6227.96protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh98.178e-6227.96protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh98.178e-6227.96protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN6.718e-6328.37Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q71M42|PC11X_PANTR4.677e-6129.06Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA6.645e-6129.06Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6X862|PC11X_GORGO1.207e-6029.20Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WXV7|PC11X_PONPY1.452e-6029.20Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EKL91.607e-9429.53Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QU552.161e-9429.53Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158R7454.253e-9429.04Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A158QIS07.741e-9430.02Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A3R7JVJ37.266e-8628.21Protocadherin-9 (Fragment) OS=Clonorchis sinensis ... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.326e-6527.71protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.857e-6527.48protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b1.174e-6428.44protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh92.772e-6228.77protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.372e-6228.77protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh118.967e-5428.10protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.11.512e-4725.04pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.19.695e-4524.90pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
si:ch211-199f5.13.118e-4025.45protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000006996.18.536e-3925.99pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461891.234e-5927.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.392e-5828.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.068e-4926.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333596.120e-4725.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303642.057e-4225.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh92.614e-6328.39protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh97.395e-6328.39protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh97.713e-6328.39protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1a2.369e-6226.32protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.438e-6226.16protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033582.10.000e+099.44SMESG000033582.1[more]
SMESG000033582.10.000e+099.48SMESG000033582.1[more]
SMESG000042783.15.346e-12833.25SMESG000042783.1[more]
SMESG000048159.19.490e-9932.72SMESG000048159.1[more]
SMESG000053174.11.399e-8929.53SMESG000053174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030055 ID=SMED30030055|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3538bp
AAAATTTTTATTTACCAGACAAATATTGATGCTATCTAGATTTGTTTACT
CGTCGAACGAGTCAGCTGAAAAGAAGGTATCAAAGATTTTAATAACGAAC
TATTAGACTGATAAATTCACTTGATTTCATTGGTCATCCAATCAGAGTTG
AGATTTGTCAAATAGGATTCAAACGTAGCGTTATTCCTTGTTCCAACTGT
TTTTTATTTTTATATTTATTTCAACTGTAGTTTATTATGATTTTTCCAAA
TTCTGTTGTCTTAACGGTGATTATATACCTACGATTTCCTATTGCATACC
CATGTGATTACATATCTGTTATCACAGTTACAGAAAATATACCTTATCCT
TCATCATCACTTATAGACGTTGGTCATTTACTGTTAACATCTAGTTTAAT
ATCACAAGCTGAAAAGGATAACATCTATTTTACTGATCGTAAAAATAGTC
AACCGTTTTCATTATCACATGGCAAGTTAATTGTTACAGGTCCATTAGAC
CGCGAAAAGATTTGCAGTCCACAAACTGACCAGAATCTTATTCAAAAATG
TTGTGAGTCCTCTTGCTGCATGTTCATCGGAATCACATCACCGAATCGAA
AAATAAACTATATAAGAGTAAATATTGAGGATGAAAATGACAATGAACCA
ATATTTCCTCAATCTTATATTAAAATCGCAGTCCATGAAAATGTTGAAAT
CGGACATACTATAGTGCTACCGAAAGCAGAAGATTTAGATACTCCAAGTT
ACGGAATTGACAATTACAAGTTAATCTCCGACAAATCTTGTGGCTCCTGT
TTCGAAGTCAAAAATGAACCGAAAGATAATCGGCTGGTTCTTGTGTTTAA
AACGAAAATTGATCGTGAAACTAATTCAGTTTTTAATTTACTAGTTTTAG
CAATAGATCGCGGCAAGCCGAGTAAAACCGGATCTTTAAGTATAATATTG
GAAGTAGAAGACATAAATGACAATCGTCCACATTTTGAAGAGTCGACTAT
CTCATTATCAGTGGAGGAAAATGGTAGATCTGGAAGAGAAATTAAACGAA
TTAAAGTAACAGATTCAGACATTGGGGCTAACAGTCAAATGTCATACAAC
ATTGAAGATTATACATCACAAGCACAAAGATATTTTAAACTTTTTCAAAT
TAAAGACGGGATAAGCTTACAATTGCAGTCAACTCTAGATTATGAGAATA
AAAACATTTTTGAATTTCGAATAATCGCAAAAGATCAAGGAACTCCATAT
CTGATGTCGACAGCTACTGTAACTGTTAGGGTGACAAACCTCAATGACGA
ACCACCGGAAATATTGTTTTATAATCGTGGATCAATTGTTGATCCGAATT
CCATTCAGTTAACTCTACCAGAGAACGGTCCTAAACATCAGACAATAATT
CTCATTCATGTTACAGATAAAGATTCAAAATTATCTGACATCCTCTGTGA
AGTCTCTCATCCAAAAGACGTTTTCTATTTGCGGGAAACCGAAAATGTCA
ACATCATTGAAAAAAAGAAAATATTCGAGTTGCAGAATCTAATAGAATTT
GATAGAGAGACCACAAGCATTTATAGAATAACCATAACATGTTCAGATTC
AAATACAATATCAAAATTGACACAATCTGTAGAGATCCAAATGAAAATTG
ACGACGTAAATGACAACCCACCAATATTCAGTTCGTCTTTTCATTTTGGA
AAAATAATGGAGACAGATTTGACTGATCAAGACGTCCACATGACGGAAGG
AGTGATACAGGTAACCGATGCCGATATTGGTATGAATAGCAGAATCAAAT
ATCATCTTAAAGATGCATTAAATTCGACTGATTCTCAATACTTTTCCGTC
AACTCAGAATATCCCCAAATCAAAAATAAAGAGCCAATAGATTACGAAAA
GTCAAAACAGTTTAAATTCTTTCTAGTCGCTGTAGATGGAGGCAAACCGG
CACTGACTGCGTCAACGCAGATTACTATTAGCGTTTCAGATGCAAATGAT
AACCGGCCGGAAATCGGAAATAAGTTCTATACTTTTTCGGTTTTGGAAGA
ACAGCCGATTGGGACTAAAATCGGACAAATTGTAGCTAGCGACGCAGACA
CCGACCAACTAAATCGAGATGTCATTTTTGAAATGCTTAGTCTTGATGGA
ACCAAAAGGAGACAACGTCAAAATGATTTATTTATAATAGAAAACAATAC
AGGATTTATTAAAACTCGAGTCGTTCTAGATCATGAGAAAGATCAACATG
TCAGCTTTTTGGTTCGTGTTCGAAATACCAACGAATACGTAGGAACTAAA
GACAAATTAGACTTTTATAGCAGTTCTGTTGCAATTACTGTTAAAATCAT
TGATATCAATGATAATTCTCCGAAATTAGCTTTGAAAGAATCTTTAATAG
TTGAACAAGCTGGATCATGTTTGAGTTCACAAAAACCCATTATTATAACG
ACTTCAGATATCGCTTCGAATCTCTGTTCTGAATTTCCGTACACATTTCT
AGACGCAGATGAAGGACTGAATGCAGAGGTTGTTGTGACATTAAAAGAAA
ATCCAAATTTTTCTTTAGATATGGGTCATAATTTAATTTGTTTGAAAAAT
CTTCATCTATCTCCAGGATATTTTACTGTAAGTGTAATTGGACAAGACAG
AAACGGTGGGAATGGTAGCAGGAGAGCCGAGTGCTTGATTAATATCCATT
TGAAAAGTTCAACTGTAAATAAACCCATTAACAATCCTAAACTTCGACCC
TCCGAACCACAAGAAAAAATGATTGACACGAAAACTATTGTTATTTTCAT
TGTACTCATAGCAGTTATTATCATATTCTGCCTATTACTAATGATTGTGG
TTTTCAAAAGCAAATTATGCCTTCCTGGACCCATTAGTCCGCCAGCTCGA
AGACGAGGAAAACCTAATGAAAAACAAATTAATTCTAATACATCGAAAAT
GTATAGCACAATAAATGCAGTAGCTAATTGTGAAAACAAGAGATTGTGCG
ATGATTATATGTCAGGGGGTCTCAACAATTATCGAACCGTGACTCCAAAT
TATTCCAACAATGTATTTATCACCAGAACGAACAGCCCAAATGATGACGT
ACGAATAGTGAAATTTCCAATTTCACCAGAAAACAGATTCGCCACAATTA
CCAGATCGTGTGACGAATTATTCAATGAACAAGATGAAATTATCAACAAC
AATGCCGTGAACTCCCCAAATTCAGATATCAAATACGAACAGCTGCATGG
AATAGCACCTCATCTAAATCAGTCCAATAATACAATTACTTGGGATAAAA
CAGCAGCCCATCAATACAATTATCTCTTAGAACCAAGAGATTCTGGATCA
TTGCCCAGTAAAGGAAAGAATTTTACTAGCAAGCCAGAACCTACTCCAAT
TTCCACAAATTTCCACCAGAAATCTATCAACGATGTTTACTTACAAACAA
GTTTTGTATGATCTCATAATCTTTTTACATATATTTACTTTTTCAAAAAA
TCTGTAAATATTATATAATATTTATTATTTTTAGTTAC
back to top

protein sequence of SMED30030055-orf-1

>SMED30030055-orf-1 ID=SMED30030055-orf-1|Name=SMED30030055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1075bp
MIFPNSVVLTVIIYLRFPIAYPCDYISVITVTENIPYPSSSLIDVGHLLL
TSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQN
LIQKCCESSCCMFIGITSPNRKINYIRVNIEDENDNEPIFPQSYIKIAVH
ENVEIGHTIVLPKAEDLDTPSYGIDNYKLISDKSCGSCFEVKNEPKDNRL
VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHF
EESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQAQRYF
KLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVT
NLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLS
DILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITI
TCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDV
HMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEP
IDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTF
SVLEEQPIGTKIGQIVASDADTDQLNRDVIFEMLSLDGTKRRQRQNDLFI
IENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSSVAI
TVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEF
PYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVSV
IGQDRNGGNGSRRAECLINIHLKSSTVNKPINNPKLRPSEPQEKMIDTKT
IVIFIVLIAVIIIFCLLLMIVVFKSKLCLPGPISPPARRRGKPNEKQINS
NTSKMYSTINAVANCENKRLCDDYMSGGLNNYRTVTPNYSNNVFITRTNS
PNDDVRIVKFPISPENRFATITRSCDELFNEQDEIINNNAVNSPNSDIKY
EQLHGIAPHLNQSNNTITWDKTAAHQYNYLLEPRDSGSLPSKGKNFTSKP
EPTPISTNFHQKSINDVYLQTSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006588Peptide_N_glycanase_PAW_dom
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006516glycoprotein catabolic process
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 250..279
score: 25.97
coord: 591..604
score: 31.92
coord: 572..591
score: 41.63
coord: 324..336
score: 30.32
coord: 654..680
score: 25.56
coord: 70..89
score: 27.46
coord: 696..713
score: 38.48
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 272..357
e-value: 1.9E-19
score: 80.6
coord: 752..830
e-value: 1.1
score: 3.3
coord: 615..712
e-value: 2.4E-13
score: 60.3
coord: 507..591
e-value: 9.3E-21
score: 85.0
coord: 162..248
e-value: 1.6E-13
score: 60.9
coord: 390..479
e-value: 1.4E-5
score: 34.5
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 147..240
e-value: 4.7E-9
score: 36.6
coord: 505..583
e-value: 6.9E-12
score: 45.6
coord: 598..681
e-value: 6.7E-9
score: 36.1
coord: 256..350
e-value: 4.7E-15
score: 55.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 356..476
e-value: 1.3E-13
score: 53.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 44..138
e-value: 1.4E-5
score: 27.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 477..588
e-value: 2.3E-24
score: 88.0
coord: 139..245
e-value: 1.1E-20
score: 76.2
coord: 589..714
e-value: 1.1E-20
score: 76.2
coord: 246..355
e-value: 5.7E-26
score: 93.2
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 506..954
coord: 61..561
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 482..593
score: 20.612
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 141..250
score: 20.042
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 251..359
score: 22.125
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 594..714
score: 20.722
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 369..481
score: 16.644
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 53..140
score: 10.55
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 254..354
e-value: 4.60019E-19
score: 81.2057
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 147..246
e-value: 1.54741E-16
score: 73.8869
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 505..589
e-value: 1.78234E-21
score: 88.1393
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 372..477
e-value: 8.75005E-9
score: 51.9306
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 598..710
e-value: 7.7034E-19
score: 80.4353
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.482
NoneNo IPR availableTMHMMTMhelixcoord: 851..873
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 238..248
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 581..591
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 702..712
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 370..486
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 581..721
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 239..361
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 474..585
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 134..250