RNA 3'-terminal phosphate cyclase-like protein

Overview
NameRNA 3'-terminal phosphate cyclase-like protein
Smed IDSMED30030050
Length (bp)1248
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA 3'-terminal phosphate cyclase-like protein (SMED30030050) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA 3'-terminal phosphate cyclase-like protein (SMED30030050) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA 3'-terminal phosphate cyclase-like protein (SMED30030050) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA 3'-terminal phosphate cyclase-like protein (SMED30030050) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030050

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030050h1SMcG0014690 SmedASXL_009162SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30030050h1SMcG0014690 dd_Smed_v4_3243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Human
Match: RCL1 (RNA terminal phosphate cyclase like 1 [Source:HGNC Symbol;Acc:HGNC:17687])

HSP 1 Score: 187.963 bits (476), Expect = 3.752e-55
Identity = 131/371 (35.31%), Postives = 204/371 (54.99%), Query Frame = 3
Query:   45 SLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            SL Y   + L   + LS ++ +PV+I  I   ++  GL   + S + L DKI NG   +IN+TG  L   PG L GG +EH+C     +GYY   LL L+PF K P++  L GVTN     S + L       +K   GID  SFE+ + +RG  P GGG  +F     + LKP++    GKI+++RG A+S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  +K F  + + IE    G+E        ++L TC+G G  NL+++++
Sbjct:    7 SLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQF-GIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Human
Match: RCL1 (RNA terminal phosphate cyclase like 1 [Source:HGNC Symbol;Acc:HGNC:17687])

HSP 1 Score: 138.658 bits (348), Expect = 3.926e-38
Identity = 73/216 (33.80%), Postives = 123/216 (56.94%), Query Frame = 3
Query:  495 PNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            P GGG  +F     + LKP++    GKI+++RG A+S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  +K F  + + IE    G+E        ++L TC+G G  NL+++++
Sbjct:    3 PGGGGEVVFSCPVRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 215          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Human
Match: RCL1 (RNA terminal phosphate cyclase like 1 [Source:HGNC Symbol;Acc:HGNC:17687])

HSP 1 Score: 111.694 bits (278), Expect = 2.292e-28
Identity = 60/184 (32.61%), Postives = 103/184 (55.98%), Query Frame = 3
Query:  591 GTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            G  +S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  +K F  + + IE    G+E        ++L TC+G G  NL+++++
Sbjct:    7 GCRYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 187          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Human
Match: RCL1 (RNA terminal phosphate cyclase like 1 [Source:HGNC Symbol;Acc:HGNC:17687])

HSP 1 Score: 111.694 bits (278), Expect = 2.292e-28
Identity = 60/184 (32.61%), Postives = 103/184 (55.98%), Query Frame = 3
Query:  591 GTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            G  +S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  +K F  + + IE    G+E        ++L TC+G G  NL+++++
Sbjct:    7 GCRYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 187          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Human
Match: RCL1 (RNA terminal phosphate cyclase like 1 [Source:HGNC Symbol;Acc:HGNC:17687])

HSP 1 Score: 111.694 bits (278), Expect = 2.292e-28
Identity = 60/184 (32.61%), Postives = 103/184 (55.98%), Query Frame = 3
Query:  591 GTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            G  +S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  +K F  + + IE    G+E        ++L TC+G G  NL+++++
Sbjct:    7 GCRYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 187          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Celegans
Match: ZK1127.5 (Probable RNA 3'-terminal phosphate cyclase-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q23400])

HSP 1 Score: 187.193 bits (474), Expect = 3.599e-55
Identity = 117/365 (32.05%), Postives = 202/365 (55.34%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXX--XXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIE----PLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
              + +  S+++ +P+ I +I  +++  G+   +  L+ L +K+ NG   +I+ TG ++   PG + GG +  +C     + Y+   LLLLSPFCK P+   L GVTN    IS + +  +        V  D   +I ++ RG  P GGG  +F +   ++L+P+++ ++GK+ K+RG A+ T++ P+L  R ID  KK M+ ++SDVY+  D +KG+  G SPGYG+ +TA TTEG+ Y +E +S  +    V  +PED+G EAG+ L QQ+  GG +    + L  T + +  K+VS  + G     +  AL  +K F  +++ +E     L++ +   +     + + T +G G  NLN++I
Sbjct:   14 FRIRLAYSILSGRPIRIINIRKNDDRPGIRDFESKLIGLLEKVTNGTKVEISRTGTQVIFRPGMITGGVVNLDCGTERCISYFLEPLLLLSPFCKVPMVIKLKGVTNAPGEISVDGMKASWLKVYNKFVLNDEKLDIKIQARGLKPEGGGVVVFTAPIVKTLRPVKRQQVGKVCKIRGQAYVTKVTPSLAYRMIDAAKKAMHGYISDVYITVDQRKGDAGGASPGYGLFLTAETTEGVIYQAEAISRPKGESGVPILPEDIGIEAGHALLQQIYMGGALDSSAQILASTFMTLCPKDVSHFLYGPLPMYSVHALRHLKQFFEIEFKMEDFKKTLKEEEADLKTGSADKAMVTAVGVGYSNLNKTI 378          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Fly
Match: Rtc1 (gene:FBgn0020909 transcript:FBtr0073820)

HSP 1 Score: 200.675 bits (509), Expect = 4.485e-60
Identity = 121/365 (33.15%), Postives = 200/365 (54.79%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE---GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXX---XXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCN--QQLLFTCIGAGLVNLNRSI 1136
            L+  + L+ ++ +PV+I+ I   +E   GL   +ISL+ L DKI NG   ++N  G  +   PG L GG++ H+C     +GYY   L+ L PFCK P++  L GVTN  +S S + +  A    +K  + +D   E+ V +RG  P GGG  IF+    +SL+ ++    G ++++RGT ++ +++P +  R ++  K  M KFL DVY+  D  KG+ SGNSPG+GI + A TT+G+ + +              SIPE+LG+E    L  ++ RGG +   ++ L    +A+G+K+VSK + G  S  T   L  ++ F  + + +E  +   E   +N    Q++L  C+G G  N+N+ +
Sbjct:   19 LKQRLILACLSGKPVKISQIRSEDETAPGLREYEISLIRLLDKITNGTKIELNPAGTSVMFSPGLLHGGQLNHDCCVQRGIGYYLDALIALGPFCKSPLQCTLRGVTNSKDSPSVDHIKGAALSLLKRFLLVDEGLELKVVRRGVAPLGGGEIIFRCPVRKSLRAIQFQSQGMVKRIRGTVYACKVSPAMANRTVEAAKGCMLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCFAADCCSNTREESEDTPSIPENLGKEVALRLLDEIYRGGCVDSSYQWLAALYIALGQKHVSKFLTGALSNYTVHFLQHLRDFFSITFKLENPEAEDEDEAENVRGAQKVLMACVGIGYTNINKRV 383          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Fly
Match: Rtca (gene:FBgn0025630 transcript:FBtr0070330)

HSP 1 Score: 51.2174 bits (121), Expect = 1.005e-6
Identity = 84/361 (23.27%), Postives = 143/361 (39.61%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAW-STRLNPTLG-KRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEF--EPLLLTM-LAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKY--SIEPLQQGQEGYRDNCNQQLLFTCIGAGLVN 1121
            L   + LS I  +PV +  I  S    GL+   +  L L   I N            +   P T++      E   +A++       L +  F  +P    + G TN   +   E++   +   + +L     SF++ V++ G +P G G      +P   L   + +  G+I+ V G A+ + RL   +    Q    +++   + S    I   K         G GI++T  TT  +   +  +   +         LG EA   L   M R  V V+++  + L++ M LAVG+   S +  G  +  T  A+   +  TGVK+  ++EP              Q+L +C G G VN
Sbjct:   21 LRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNYLLSSTVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVL---LPNLKHFGVSFDLKVQRYGFYPRGQGRCQLDVQPVTKLNSGKLVAFGRIKSVSGVAYCAGRLPVNIAIDMQQTAQREIHRLWPSQQCSIEPIKHSRQKAFHNGAGILMTVNTTSDVVLGASALGKKRIDGHV----LGSEASCQLGDYM-RKQVCVDDYMQDQLIIYMALAVGR---STMRTGKLTNHTRTAINVAEQMTGVKFDVAMEP------------GGQMLVSCKGLGHVN 358          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Fly
Match: Rtca (gene:FBgn0025630 transcript:FBtr0344156)

HSP 1 Score: 51.2174 bits (121), Expect = 1.005e-6
Identity = 84/361 (23.27%), Postives = 143/361 (39.61%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAW-STRLNPTLG-KRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEF--EPLLLTM-LAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKY--SIEPLQQGQEGYRDNCNQQLLFTCIGAGLVN 1121
            L   + LS I  +PV +  I  S    GL+   +  L L   I N            +   P T++      E   +A++       L +  F  +P    + G TN   +   E++   +   + +L     SF++ V++ G +P G G      +P   L   + +  G+I+ V G A+ + RL   +    Q    +++   + S    I   K         G GI++T  TT  +   +  +   +         LG EA   L   M R  V V+++  + L++ M LAVG+   S +  G  +  T  A+   +  TGVK+  ++EP              Q+L +C G G VN
Sbjct:   21 LRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNYLLSSTVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVL---LPNLKHFGVSFDLKVQRYGFYPRGQGRCQLDVQPVTKLNSGKLVAFGRIKSVSGVAYCAGRLPVNIAIDMQQTAQREIHRLWPSQQCSIEPIKHSRQKAFHNGAGILMTVNTTSDVVLGASALGKKRIDGHV----LGSEASCQLGDYM-RKQVCVDDYMQDQLIIYMALAVGR---STMRTGKLTNHTRTAINVAEQMTGVKFDVAMEP------------GGQMLVSCKGLGHVN 358          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Zebrafish
Match: rcl1 (RNA terminal phosphate cyclase-like 1 [Source:NCBI gene;Acc:445388])

HSP 1 Score: 212.616 bits (540), Expect = 8.763e-65
Identity = 128/359 (35.65%), Postives = 203/359 (56.55%), Query Frame = 3
Query:   78 VCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXX-XXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCN--QQLLFTCIGAGLVNLNRSIR 1139
            + LS ++ +PV+I +I   ++  GL   + S + + DK+ NG   +IN+TG  L   PG L GG +EHEC+   ++GYY   LL+L+PF K PI+A L G+TN     S + L       +K         EI V KRG  P GGG   F    ++S+KP++  + GKI+++RGTA+S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+++ A T  G+      V +        +PEDLG     LL +++ RGG +    + L L  + +G+++VSK +LG  S  T   L  I+ F  + + IE     Q+   D C   +++L TC+GAG  N+++SI+
Sbjct:   13 LVLSTLSGKPVKIRNIRSKDDNPGLRDFEASFIRMLDKLTNGTRIEINQTGTVLFYQPGLLYGGSVEHECNVQRSVGYYLEALLMLAPFMKTPIKAVLKGITNHPTDPSVDLLKVTAVPLMKRFGINGDGLEIKVVKRGMAPGGGGEVHFSCPVSRSMKPVQLTEAGKIKRIRGTAFSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGPNSGKSPGFGLVLVAETLNGVFLGAEVVSTPQGQGETQLPEDLGRNCAKLLLEEIYRGGCVDSTNQSLALLYMTLGQQDVSKTLLGPLSPYTMDFLRHIRDFFQIMFKIET----QKPSEDECKGGEKVLMTCVGAGYNNISKSIK 367          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Zebrafish
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc:ZDB-GENE-030131-9687])

HSP 1 Score: 82.0333 bits (201), Expect = 1.058e-16
Identity = 84/355 (23.66%), Postives = 146/355 (41.13%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEI--SEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNP-TLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVN 1121
            L ++  LS I    ++IN I    S  GL    +S LEL   +CNG           + + PG + GG    +   + ++       L  + F + P E  L G TN    ++P+ + Y +  F   +      F+  ++ RG +P GGG  + K  P + L P+   + G I K+ G A+   + P  L K       + + K + D+Y+     + +D     G GII+ A ++ G          S G      + +G EA  +L + +   G + E  +  L+  +A+     S++  G  +  T  A+   +  T  K++I   +       +N N   +  C G G  N
Sbjct:   20 LRVSAALSCIQGASIKINKIRAGRSTPGLRPQHLSGLELLRDMCNGNLEGATVGSSEITLTPGKIKGGNHIADTHTAGSVTLLMQVSLPCALFAQGPSELCLKGGTNAE--MAPQ-IDYTVKVFKPIVERFGVQFDCDLRMRGYYPKGGGEVVLKVNPAKELSPINMTERGNITKIYGRAFVAGVLPFKLAKDMSTAAIRTIRKEIKDLYINIQSLQEKDKACGNGNGIIIIAESSTGC----IFAGSSLGKKGVYADKVGIEAAEMLLRNIRHNGCVDEFLQDQLIIFMALA-NGTSRMRTGPITLHTQTAIHVAEQLTNAKFAISKAED------ENANDTYIIECQGVGATN 360          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Xenopus
Match: supt6h (SPT6 homolog, histone chaperone [Source:Xenbase;Acc:XB-GENE-990369])

HSP 1 Score: 183.341 bits (464), Expect = 1.494e-53
Identity = 121/358 (33.80%), Postives = 192/358 (53.63%), Query Frame = 3
Query:   78 VCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            + LS ++ +PV+I  I + +E  G+   + S + L DKI NG   +INETG  L  +PG L GG +EH+C+   ++GYY   LL L+PF K PI+  L GVTN     S + L       +K   GID   FE+ + KRG  P GGG  IF     + L+P++    GKI+++RG A+S R++P +G R +D  + ++N+FL D+Y+  DH KG +SG SPG+G+ + A TTEG         +        +PEDLG     LL +++ R G    +F   +L M   G +  SK ++     +  + L  ++ F  + + +E     +        +++L TC+G G  NL++ ++
Sbjct:   20 IVLSTLSGRPVKIQGIRVKDESPGIRDFEASFIRLMDKITNGTRIEINETGTSLYYLPGLLSGGTLEHDCNIQRSIGYYLESLLCLAPFMKHPIKITLRGVTNDQADPSVDTLKATAIPLMKKF-GIDGEHFELKIVKRGMPPGGGGEVIFSCPVRKLLRPVQLTDPGKIKRIRGVAYSVRVSPQIGNRIVDAARSVLNRFLPDIYIYTDHMKGANSGKSPGFGLSLVAETTEGCFLSTELASNPQGQGSTVLPEDLGRNCAVLLLEEIYRVG----DFRCPILQM---GNQENSKFLI-----QLIEFLRHLRSFFQIMFKME----SKTFEERKGAEKVLLTCVGVGYSNLSKPVK 360          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Xenopus
Match: supt6h (SPT6 homolog, histone chaperone [Source:Xenbase;Acc:XB-GENE-990369])

HSP 1 Score: 181.415 bits (459), Expect = 8.570e-53
Identity = 120/358 (33.52%), Postives = 189/358 (52.79%), Query Frame = 3
Query:   78 VCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            + LS ++ +PV+I  I + +E  G+   + S + L DKI NG   +INETG  L  +PG L GG +EH+C+   ++GYY   LL L+PF K PI+  L GVTN     S + L       +K   GID   FE+ V KRG  P GGG  IF     + L+P++    GKI+++RG A+S R++P +G R +D  + ++N+FL D+Y+  DH KG +SG SPG+G+ + A TTEG         +        +PEDLG     LL +++ R    ++    LL + L+   K +  I          + L  ++ F  + + +E     +        +++L TC+G G  NL++ ++
Sbjct:   20 IVLSTLSGRPVKIQGIRVKDESPGIRDFEASFIRLMDKITNGTRIEINETGTSLYYLPGLLSGGTLEHDCNIQRSIGYYLESLLCLAPFMKHPIKITLRGVTNDQADPSVDTLKATAIPLMKKF-GIDGEHFELKVVKRGMPPGGGGEVIFSCPVRKLLRPVQLTDPGKIKRIRGVAYSVRVSPQIGNRIVDAARSVLNRFLPDIYIYTDHMKGANSGKSPGFGLSLVAETTEGCFLSTELASNPQGQGSTVLPEDLGRNCAVLLLEEIYRVDTTLKSLATLLCS-LSYKMKMMYWI----------EFLRHLRSFFQIMFKME----SKTFEERKGAEKVLLTCVGVGYSNLSKPVK 361          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Xenopus
Match: supt6h (SPT6 homolog, histone chaperone [Source:Xenbase;Acc:XB-GENE-990369])

HSP 1 Score: 179.489 bits (454), Expect = 5.712e-52
Identity = 119/362 (32.87%), Postives = 193/362 (53.31%), Query Frame = 3
Query:   78 VCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGK--KNVSKIVLGVPST--ETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            + LS ++ +PV+I  I + +E  G+   + S + L DKI NG   +INETG  L  +PG L GG +EH+C+   ++GYY   LL L+PF K PI+  L GVTN     S + L       +K   GID   FE+ + KRG  P GGG  IF     + L+P++    GKI+++RG A+S R++P +G R +D  + ++N+FL D+Y+  DH KG +SG SPG+G+ + A TTEG         +        +PEDLG     LL +++ R G    +F   L+    V    +++ + V+    +  +  + L  ++ F  + + +E     +        +++L TC+G G  NL++ ++
Sbjct:   20 IVLSTLSGRPVKIQGIRVKDESPGIRDFEASFIRLMDKITNGTRIEINETGTSLYYLPGLLSGGTLEHDCNIQRSIGYYLESLLCLAPFMKHPIKITLRGVTNDQADPSVDTLKATAIPLMKKF-GIDGEHFELKIVKRGMPPGGGGEVIFSCPVRKLLRPVQLTDPGKIKRIRGVAYSVRVSPQIGNRIVDAARSVLNRFLPDIYIYTDHMKGANSGKSPGFGLSLVAETTEGCFLSTELASNPQGQGSTVLPEDLGRNCAVLLLEEIYRVG----DFSLSLMGYFPVTNLTRSLCQKVMCFSYSIIDRIEFLRHLRSFFQIMFKME----SKTFEERKGAEKVLLTCVGVGYSNLSKPVK 372          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Xenopus
Match: supt6h (SPT6 homolog, histone chaperone [Source:Xenbase;Acc:XB-GENE-990369])

HSP 1 Score: 176.022 bits (445), Expect = 8.397e-51
Identity = 116/358 (32.40%), Postives = 186/358 (51.96%), Query Frame = 3
Query:   78 VCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            + LS ++ +PV+I  I + +E  G+   + S + L DKI NG   +INETG  L  +PG L GG +EH+C+   ++GYY   LL L+PF K PI+  L GVTN     S + L       +K   GID   FE+ + KRG  P GGG  IF     + L+P++    GKI+++RG A+S R++P +G R +D  + ++N+FL D+Y+  DH KG +SG SPG+G+ + A TTEG         +        +PEDLG     LL +++ R G    +    L + +++                  + L  ++ F  + + +E     +        +++L TC+G G  NL++ ++
Sbjct:   20 IVLSTLSGRPVKIQGIRVKDESPGIRDFEASFIRLMDKITNGTRIEINETGTSLYYLPGLLSGGTLEHDCNIQRSIGYYLESLLCLAPFMKHPIKITLRGVTNDQADPSVDTLKATAIPLMKKF-GIDGEHFELKIVKRGMPPGGGGEVIFSCPVRKLLRPVQLTDPGKIKRIRGVAYSVRVSPQIGNRIVDAARSVLNRFLPDIYIYTDHMKGANSGKSPGFGLSLVAETTEGCFLSTELASNPQGQGSTVLPEDLGRNCAVLLLEEIYRVGDFRFQSTYDLFSKVSM-----------------IEFLRHLRSFFQIMFKME----SKTFEERKGAEKVLLTCVGVGYSNLSKPVK 355          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Xenopus
Match: supt6h (SPT6 homolog, histone chaperone [Source:Xenbase;Acc:XB-GENE-990369])

HSP 1 Score: 132.88 bits (333), Expect = 1.134e-34
Identity = 94/292 (32.19%), Postives = 153/292 (52.40%), Query Frame = 3
Query:  273 HECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVK-KRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            H+C+   ++GYY   LL L+PF K PI+  L GVTN     S + L       +K   GID   FE+ V  KRG  P GGG  IF     + L+P++    GKI+++RG A+S R++P +G R +D  + ++N+FL D+Y+  DH KG +SG SPG+G+ + A TTEG         +        +PEDLG     LL +++ R   +V     +LL ++ V +   SK ++     +  + L  ++ F  + + +E     +        +++L TC+G G  NL++ ++
Sbjct:   68 HDCNIQRSIGYYLESLLCLAPFMKHPIKITLRGVTNDQADPSVDTLKATAIPLMKKF-GIDGEHFELKVGLKRGMPPGGGGEVIFSCPVRKLLRPVQLTDPGKIKRIRGVAYSVRVSPQIGNRIVDAARSVLNRFLPDIYIYTDHMKGANSGKSPGFGLSLVAETTEGCFLSTELASNPQGQGSTVLPEDLGRNCAVLLLEEIYR---VVN--NKMLLVLMCVCRTENSKFLI-----QLIEFLRHLRSFFQIMFKME----SKTFEERKGAEKVLLTCVGVGYSNLSKPVK 344          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Mouse
Match: Rcl1 (RNA terminal phosphate cyclase-like 1 [Source:MGI Symbol;Acc:MGI:1913275])

HSP 1 Score: 187.578 bits (475), Expect = 3.849e-55
Identity = 131/371 (35.31%), Postives = 204/371 (54.99%), Query Frame = 3
Query:   45 SLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            SL Y   + L   + LS ++ +PV+I  I   ++  GL   + S + L DKI NG   +IN+TG  L   PG L GG +EH+C     +GYY   LL L+PF K P++  L GVTN     S + L       +K   GID  SFE+ + +RG  P GGG  +F     + LKP++    GKI+++RG A+S R++P +  R +D  + ++NKF+ D+Y+  DH KG  SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L+L ++ +G+++VSK++LG  S  T + L  +K F  V + +E    G+E        ++L TC+G G  NL+++++
Sbjct:    7 SLSYAGCNFLRQRLVLSTLSGRPVKIRRIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLEALLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQF-GIDGESFELKILRRGMPPGGGGEVLFSCPVRKVLKPVQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVSSGKSPGFGLSLVAETTNGTFLSAELASNPQGQGAAVLPEDLGRNCAKLLLEEIYRGGCVDSTNQSLVLLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQVMFKVETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Mouse
Match: Rcl1 (RNA terminal phosphate cyclase-like 1 [Source:MGI Symbol;Acc:MGI:1913275])

HSP 1 Score: 169.088 bits (427), Expect = 2.065e-48
Identity = 121/331 (36.56%), Postives = 183/331 (55.29%), Query Frame = 3
Query:   45 SLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTG 1019
            SL Y   + L   + LS ++ +PV+I  I   ++  GL   + S + L DKI NG   +IN+TG  L   PG L GG +EH+C     +GYY   LL L+PF K P++  L GVTN     S + L       +K   GID  SFE+ + +RG  P GGG  +F     + LKP++    GKI+++RG A+S R++P +  R +D  + ++NKF+ D+Y+  DH KG  SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L+L ++ +G+++VSK++LG  S  T  A  + +LF G
Sbjct:    7 SLSYAGCNFLRQRLVLSTLSGRPVKIRRIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLEALLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQF-GIDGESFELKILRRGMPPGGGGEVLFSCPVRKVLKPVQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVSSGKSPGFGLSLVAETTNGTFLSAELASNPQGQGAAVLPEDLGRNCAKLLLEEIYRGGCVDSTNQSLVLLLMTLGQQDVSKVLLGPLSPYTIFAASE-ELFPG 335          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Mouse
Match: Rtca (RNA 3'-terminal phosphate cyclase [Source:MGI Symbol;Acc:MGI:1913618])

HSP 1 Score: 72.7886 bits (177), Expect = 1.174e-13
Identity = 77/357 (21.57%), Postives = 145/357 (40.62%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEI--SEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLY-YAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNP-TLGKRQIDGIKKLMNKFLSDVYL-IHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVN 1121
            L ++  LS +   P+ +  I    S  GL    +S LE+   +C G           +   P  + GG    +   + ++       +    F   P E  L G TN    ++P+  Y   +   I +  G   +F   +K RG +P GGG  I +  P + L P+     G + K+ G A+   + P  + K       + + K + D+Y+ I   ++  D     G GII+ A T+ G  +    +     +     + +G EA  +L   +  GG + E  +  L+  +A+    +S+I  G  +  T  A+   +     K++++  ++ ++  +D      +  C G G+ N
Sbjct:   20 LRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMVRDLCGGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVCLLMQVSMPCVLFAASPSELRLKGGTNAE--MAPQIDYTMMVFKPIAEKFGF--TFNCDIKTRGYYPKGGGEVIVRVSPVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIRKEIRDLYVSIQPVQEARDQAFGNGSGIIIVAETSTGCLFAGSSLGKRGVNA----DKVGIEAAEMLLANLRHGGTVDEYLQDQLIIFMALA-NGISRIKTGSVTLHTQTAIHFAEQLAKAKFTVKKSEEEEDATKDT----YVIECEGIGMAN 363          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Mouse
Match: Rtca (RNA 3'-terminal phosphate cyclase [Source:MGI Symbol;Acc:MGI:1913618])

HSP 1 Score: 46.9802 bits (110), Expect = 4.632e-6
Identity = 38/141 (26.95%), Postives = 62/141 (43.97%), Query Frame = 3
Query:  336 FCKKPIEANLYGVTNKSNSISPEFLY-YAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNP-TLGKRQIDGIKKLMNKFLSDVYL-IHDHKKGEDSGNSPGYGIIV 749
            F   P E  L G TN    ++P+  Y   +   I +  G   +F   +K RG +P GGG  I +  P + L P+     G + K+ G A+   + P  + K       + + K + D+Y+ I   ++  D     G GII+
Sbjct:    6 FAASPSELRLKGGTNAE--MAPQIDYTMMVFKPIAEKFGF--TFNCDIKTRGYYPKGGGEVIVRVSPVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIRKEIRDLYVSIQPVQEARDQAFGNGSGIII 142          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. UniProt/SwissProt
Match: sp|P56175|RCL1_DROME (Probable RNA 3'-terminal phosphate cyclase-like protein OS=Drosophila melanogaster OX=7227 GN=Rtc1 PE=2 SV=3)

HSP 1 Score: 200.675 bits (509), Expect = 4.496e-59
Identity = 121/365 (33.15%), Postives = 200/365 (54.79%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE---GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXX---XXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCN--QQLLFTCIGAGLVNLNRSI 1136
            L+  + L+ ++ +PV+I+ I   +E   GL   +ISL+ L DKI NG   ++N  G  +   PG L GG++ H+C     +GYY   L+ L PFCK P++  L GVTN  +S S + +  A    +K  + +D   E+ V +RG  P GGG  IF+    +SL+ ++    G ++++RGT ++ +++P +  R ++  K  M KFL DVY+  D  KG+ SGNSPG+GI + A TT+G+ + +              SIPE+LG+E    L  ++ RGG +   ++ L    +A+G+K+VSK + G  S  T   L  ++ F  + + +E  +   E   +N    Q++L  C+G G  N+N+ +
Sbjct:   19 LKQRLILACLSGKPVKISQIRSEDETAPGLREYEISLIRLLDKITNGTKIELNPAGTSVMFSPGLLHGGQLNHDCCVQRGIGYYLDALIALGPFCKSPLQCTLRGVTNSKDSPSVDHIKGAALSLLKRFLLVDEGLELKVVRRGVAPLGGGEIIFRCPVRKSLRAIQFQSQGMVKRIRGTVYACKVSPAMANRTVEAAKGCMLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCFAADCCSNTREESEDTPSIPENLGKEVALRLLDEIYRGGCVDSSYQWLAALYIALGQKHVSKFLTGALSNYTVHFLQHLRDFFSITFKLENPEAEDEDEAENVRGAQKVLMACVGIGYTNINKRV 383          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. UniProt/SwissProt
Match: sp|Q2KHX8|RCL1_BOVIN (RNA 3'-terminal phosphate cyclase-like protein OS=Bos taurus OX=9913 GN=RCL1 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.764e-54
Identity = 132/371 (35.58%), Postives = 203/371 (54.72%), Query Frame = 3
Query:   45 SLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            SL Y   + L   + LS ++ +PV+I  I   ++  GL   + S + L DK+ NG   +IN+TG  L   PG L GG +EH+C     +GYY   LL L+PF K P+   L GVTN     S + L       +K   GID  SFE+ V +RG  P GGG   F     + LKP++ I  GKI+++RG A+S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  +K F  + + IE    G+E        ++L TC+G G  NL+++++
Sbjct:    7 SLSYSGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKVTNGSRIEINQTGTTLYYQPGLLYGGSMEHDCSVLRGIGYYLESLLCLAPFMKHPLRIVLRGVTNDQVDPSVDVLKATALPLLKQF-GIDGESFELKVVRRGMPPGGGGEVFFSCPVRKVLKPIQLIDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGINSGKSPGFGLSLVAETTNGTFLSAELASNPQGQGAAMLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. UniProt/SwissProt
Match: sp|Q9Y2P8|RCL1_HUMAN (RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens OX=9606 GN=RCL1 PE=1 SV=3)

HSP 1 Score: 187.963 bits (476), Expect = 1.802e-54
Identity = 131/371 (35.31%), Postives = 204/371 (54.99%), Query Frame = 3
Query:   45 SLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            SL Y   + L   + LS ++ +PV+I  I   ++  GL   + S + L DKI NG   +IN+TG  L   PG L GG +EH+C     +GYY   LL L+PF K P++  L GVTN     S + L       +K   GID  SFE+ + +RG  P GGG  +F     + LKP++    GKI+++RG A+S R++P +  R +D  + ++NKF+ D+Y+  DH KG +SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  +K F  + + IE    G+E        ++L TC+G G  NL+++++
Sbjct:    7 SLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQF-GIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. UniProt/SwissProt
Match: sp|Q9JJT0|RCL1_MOUSE (RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus OX=10090 GN=Rcl1 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.693e-54
Identity = 131/371 (35.31%), Postives = 204/371 (54.99%), Query Frame = 3
Query:   45 SLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGID-SSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            SL Y   + L   + LS ++ +PV+I  I   ++  GL   + S + L DKI NG   +IN+TG  L   PG L GG +EH+C     +GYY   LL L+PF K P++  L GVTN     S + L       +K   GID  SFE+ + +RG  P GGG  +F     + LKP++    GKI+++RG A+S R++P +  R +D  + ++NKF+ D+Y+  DH KG  SG SPG+G+ + A TT G         +      A +PEDLG     LL +++ RGG +    + L+L ++ +G+++VSK++LG  S  T + L  +K F  V + +E    G+E        ++L TC+G G  NL+++++
Sbjct:    7 SLSYAGCNFLRQRLVLSTLSGRPVKIRRIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLEALLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQF-GIDGESFELKILRRGMPPGGGGEVLFSCPVRKVLKPVQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVSSGKSPGFGLSLVAETTNGTFLSAELASNPQGQGAAVLPEDLGRNCAKLLLEEIYRGGCVDSTNQSLVLLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQVMFKVETKPCGEE---LKGGDKVLMTCVGIGFSNLSKTLK 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. UniProt/SwissProt
Match: sp|Q23400|RCL1_CAEEL (Probable RNA 3'-terminal phosphate cyclase-like protein OS=Caenorhabditis elegans OX=6239 GN=ZK1127.5 PE=3 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 4.578e-54
Identity = 117/365 (32.05%), Postives = 202/365 (55.34%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXX--XXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIE----PLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
              + +  S+++ +P+ I +I  +++  G+   +  L+ L +K+ NG   +I+ TG ++   PG + GG +  +C     + Y+   LLLLSPFCK P+   L GVTN    IS + +  +        V  D   +I ++ RG  P GGG  +F +   ++L+P+++ ++GK+ K+RG A+ T++ P+L  R ID  KK M+ ++SDVY+  D +KG+  G SPGYG+ +TA TTEG+ Y +E +S  +    V  +PED+G EAG+ L QQ+  GG +    + L  T + +  K+VS  + G     +  AL  +K F  +++ +E     L++ +   +     + + T +G G  NLN++I
Sbjct:   14 FRIRLAYSILSGRPIRIINIRKNDDRPGIRDFESKLIGLLEKVTNGTKVEISRTGTQVIFRPGMITGGVVNLDCGTERCISYFLEPLLLLSPFCKVPMVIKLKGVTNAPGEISVDGMKASWLKVYNKFVLNDEKLDIKIQARGLKPEGGGVVVFTAPIVKTLRPVKRQQVGKVCKIRGQAYVTKVTPSLAYRMIDAAKKAMHGYISDVYITVDQRKGDAGGASPGYGLFLTAETTEGVIYQAEAISRPKGESGVPILPEDIGIEAGHALLQQIYMGGALDSSAQILASTFMTLCPKDVSHFLYGPLPMYSVHALRHLKQFFEIEFKMEDFKKTLKEEEADLKTGSADKAMVTAVGVGYSNLNKTI 378          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. TrEMBL
Match: A0A2G8KUR8 (RNA 3'-terminal phosphate cyclase-like protein OS=Stichopus japonicus OX=307972 GN=BSL78_11378 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.408e-67
Identity = 136/357 (38.10%), Postives = 213/357 (59.66%), Query Frame = 3
Query:   84 LSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEF-LYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNC---NQQLLFTCIGAGLVNLNRSI 1136
            L+ ++ + V+IN I   +   GL   + S + L DK+ NG   ++NE G  +   PG  +GG I+H+C+    +GYY   L+ L+PFCKKPI+A L GVT  SN I P   +  A+   +    GID   E+ V KRG+ P GGG  IFK    ++L+P++ +K GK++++RG A+STR++P    R ++G + ++N FL+D+Y+  DH KG  SG SPG+G+ + A TTEG    +E +S   G   ++PEDLG+ A  LL +++ RGG +    + L L  +A+G+ +VSK+  G  S  T Q L  +K F  + + IE  QQ Q+G  ++    + ++L TC+G G  NL+++I
Sbjct:   20 LATLSGRSVKINRIRSKDHDPGLREFEASFIRLLDKVTNGSRIEVNEAGTGVLYQPGLPLGGNIDHDCNIQRGIGYYLEGLICLAPFCKKPIKAILRGVT--SNQIDPSVDVIKAVSIQVLKKFGIDEGLELTVTKRGSPPLGGGEVIFKCPIRRNLRPLQLLKAGKVKRIRGVAFSTRVSPAFVNRMVEGARSVLNNFLTDIYIHTDHMKGPKSGKSPGFGVSLVAETTEGTFLSAEAMSNPVGKEITVPEDLGKRAAKLLMEEIYRGGCVDSRHQGLALLFMALGQNDVSKLQTGPLSPYTIQFLRHMKDFLQIMFKIEA-QQEQDGDSEDSRTGHDKILLTCVGVGFSNLSKTI 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. TrEMBL
Match: A0A0N5CBI2 (Uncharacterized protein OS=Strongyloides papillosus OX=174720 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 9.011e-66
Identity = 134/373 (35.92%), Postives = 210/373 (56.30%), Query Frame = 3
Query:   36 MRISLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXX--IPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
            M   LQY   +     +  SL++ + V+I DI    E  G+   + SLL+L D+I NG+   IN+TG  +   PG LIGG +  +C  S  + Y+   L++L+PFCK+PI A L GVTNK + +S + +        K  +  D + EI V KRG +P GGG   FKS  T++L+P+   K+GK+ K+RG A++ R+N +   R +D  K+ +  F++DVY+  D +KGE  G S GYGI +TA TT+G+ Y  E +S       +  +PEDLG+ A   L  ++ RGG        L+ T +A+  +N SK + G  +  +   L  +K F G+ +++   ++  E  +D C ++L+ +CIG G  NLNR++
Sbjct:    1 MSEELQYSGVNFFRQRLVYSLLSGRSVKIIDIRYKNESPGVKDFETSLLKLLDQITNGIKVTINQTGTVVHFQPGVLIGGNVSFDCGTSRCISYFLEVLVVLAPFCKRPINAKLNGVTNKHDELSCDAIRATWLPIFKKFILNDENLEIKVLKRGFYPLGGGFVTFKSPVTKNLRPITIEKVGKVCKIRGLAYTCRVNSSFANRMVDAAKEHLRNFIADVYITIDQRKGEAGGKSNGYGIFLTAETTDGVFYHGEAMSREAIDGETPLVPEDLGKAAAEKLLDEIYRGGASDCTASFLVSTFMALTDRNASKFMYGSLTQYSVYGLRHLKDFFGITFNLSQRKKENEETQDGCKEKLIGSCIGVGYTNLNRAV 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. TrEMBL
Match: A0A0K0EU78 (Uncharacterized protein OS=Strongyloides venezuelensis OX=75913 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.967e-65
Identity = 132/373 (35.39%), Postives = 211/373 (56.57%), Query Frame = 3
Query:   36 MRISLQYK--HNLELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXX--IPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
            M   LQY   +     +  SL++ + V+I DI   +E  G+   + +LL+L D+I NG+   IN+TG  +   PG LIGG +  +C  S  + Y+   L++L+PFCK+PI A L G+TNK + +S + +        K  +  D + EI V KRG +P GGG   FKS  T++L+P+   K+GK+ K+RG A++ R+N +   R +D  K+ +  F++DVY+  D +KGE  G S GYGI +TA TT+G+ Y  E +S       +  +PEDLG+ A   L  ++ RGG        L+ T +A+  +N SK + G  +  +   L  +K F G+ +++   ++  E  +D C ++L+ +CIG G  NLNR++
Sbjct:    1 MSEELQYSGVNFFRQRLVYSLLSGRSVKIIDIRYKDESPGVKDFETNLLKLLDQITNGIKVTINQTGTVIHFQPGVLIGGNVSFDCGTSRCISYFLEVLVVLAPFCKRPINAKLNGITNKHDELSCDAIRATWLPIFKKFILNDENLEIKVLKRGFYPLGGGFVTFKSPVTKNLRPITIEKVGKVCKIRGLAYTCRVNSSFANRMVDAAKEHLRNFIADVYITIDQRKGEAGGKSNGYGIFLTAETTDGVFYHGEAMSREAIDGETPLVPEDLGKAAAEKLLDEIYRGGASDCTASFLVSTFMALTDRNASKFMYGSLTQYSVYGLRHLKDFFGITFNLSQRKKENEEIQDGCKEKLIGSCIGVGYTNLNRAV 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. TrEMBL
Match: A0A4Y7NL67 (EOG090X05X4 OS=Moina brachiata OX=675436 GN=EOG090X05X4 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.310e-64
Identity = 128/357 (35.85%), Postives = 209/357 (58.54%), Query Frame = 3
Query:   78 VCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG--IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
            + L+ ++ +PV I +I   ++  GL   + S + L DKI NG   ++NETG  +   PG + GG IEH+C    ++ YY   LL ++PFCKKP+   L GVTN     S + L  +    +K  + +D   ++ + KRGA P GGG  +F     + LKP++ I  GK++K+RG A++ R +PT+  R I+  K ++ K+L DV+++ DH+KG  SG SPG+GI +TA TT G  +S  S      +  + S+ E+LGE++  LL +++ RGG +    + L+L ++A+G K+VS++ LG  S  T Q L  I+ F G+ + I+      E      ++++L TC+GAG  NL++++
Sbjct:   21 IILATLSCRPVSITNIRSKDDDPGLREFEASFIRLIDKITNGSRIEVNETGTSVHYDPGLIYGGTIEHDCSTQRSISYYLEPLLAVAPFCKKPLNLVLKGVTNHQLDPSIDILRCSALPVLKRFLLVDEGLQLKIVKRGAAPKGGGEVLFTCPIRKQLKPLQYIDPGKVKKIRGVAYALRTSPTMTNRMIESAKGILLKYLPDVFILSDHRKGPASGLSPGFGITLTAETTNGTFLSAESISNPQGEKQLPSVAEELGEKSALLLLEEIYRGGCVDSSNQHLVLLLMAIGPKDVSRVKLGPLSPYTIQFLRHIRDFFGIMFKIDVEDNQDESSLRMGSEKVLLTCVGAGYSNLSKTM 377          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. TrEMBL
Match: T1K5A3 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107360893 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.750e-64
Identity = 136/367 (37.06%), Postives = 216/367 (58.86%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGI--DSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXX--XIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRD----NCNQQLLFTCIGAGLVNLNRSI 1136
              + + LS+++ +P+ I+ I + EE  GL  S++S L+L  K  NG TF I+ETG ++   PG L GG IEH+C    ++ Y+   L++L+PFCK PIEA L G+TN    +S + L  +    +  L+ +   +  E+ V  RG  PNGGG   FK     ++KP+  +K GKI+++RG A +TR+ P +  R ID  K L+ KF+ DVY+  DH KG++SGNSPG+G+ + A TTEGI Y  E  S   GS    S+PED+ +EA   L +++ RGG +    + ++   +A+G+ +VSK+  G  S  T Q L  ++    + + +E   +G+E  RD      +++++ TC+G G  NL+++I
Sbjct:   17 FRIRIMLSILSGKPIMIHKIRVREEEPGLHESEVSFLKLIVKSTNGSTFIIDETGTQITFKPGLLHGGPIEHDCGLQRSISYFLQPLIILAPFCKVPIEATLTGITNDQLDVSIDALRQSTIPLVSKLISVWEKTDIELTVVSRGMPPNGGGKVFFKCPIRNTIKPINLLKPGKIKRIRGIALATRVAPNIANRMIDKAKGLLLKFIPDVYIHSDHLKGKNSGNSPGFGLSLVAETTEGIHYTGEAYSNPSGSDKGPSLPEDVAQEAVFCLFEEIYRGGCVSSVNQSIVCLYMALGQPDVSKVEFGPLSPFTVQLLKHMRQILQITFKLEVKDKGEEDERDEDLKKGSEKIMATCVGIGFSNLSKTI 383          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Cavefish
Match: rcl1 (RNA terminal phosphate cyclase like 1 [Source:NCBI gene;Acc:103037504])

HSP 1 Score: 198.749 bits (504), Expect = 1.469e-59
Identity = 129/356 (36.24%), Postives = 201/356 (56.46%), Query Frame = 3
Query:   84 LSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSS-FEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXX-XXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            LS ++ + V+I +I   E+  GL   + S + L DK+ NG   +IN+TG  L   PG L GG +EHEC+   ++GYY   LL+L+PF K  ++A L GVTN     S + L       +K   GID    EI V KRG  P+GGG   F     ++LKP+     GKI+++RGTA+S R++P +  R +D  + ++NK + D+Y+  DH KG  SG SPG+G+++ A T  G    +E+ S  Q      +PE+LG+    LL +++ RGG +    + L L  + +G+++VSK +LG  S  T + L  I+ F  + + IE   Q  +  +     ++L TC+GAG  N+++SI+
Sbjct:   18 LSTLSGKRVKIREIRSREDEPGLRDFEASFIRLLDKVTNGTRIEINQTGTVLFYQPGLLYGGSVEHECNLQRSIGYYLEGLLMLAPFMKNSLKAVLKGVTNDPTDPSVDLLKATAIPLMKKF-GIDGEGLEIKVVKRGIAPHGGGEVHFSCPVRRTLKPVLLTDPGKIKRIRGTAYSVRVSPQMANRIVDSARSILNKLIPDIYIYTDHMKGASSGKSPGFGLVLVAETLNGTCLSAELSSTPQGRGDQMLPEELGKNCAKLLLEEIYRGGCVDSTNQSLALLYMTLGQQDVSKTLLGPLSPYTIEFLRHIRDFFQIMFKIE--TQTADEDQQKGGDKVLMTCVGAGYTNISKSIK 370          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Cavefish
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:103035915])

HSP 1 Score: 72.7886 bits (177), Expect = 9.979e-14
Identity = 84/358 (23.46%), Postives = 145/358 (40.50%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEI--SEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLY-YAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNP-TLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLN 1127
            L ++  LS I    ++IN I    S  GL    +S LEL   +C+G           + + PG +  G    +   + ++G      L  + F   P E  L G TN    ++P+  Y   +   I +  G+   F+  ++ RG +P GGG  + K  P + L P+   + G I K+ G A+   + P  L K       + + K + D+Y+     + +D     G GII+ A ++ G          + G      + +G EA  +L + +   G + E  +  L+  +A+  K  S++  G  +  T  A+   +  T  K++I              N   +  C G G  N N
Sbjct:   20 LRVSAALSCIQGASLKINKIRAGRSTPGLRPQHLSGLELLRDMCDGNLEGAMVGSTEITLTPGKMKCGNYIADTQTAGSVGLLLQISLPCALFTGGPSELCLKGGTNAE--MAPQIDYTLKVFKPIAERFGVQ--FDCDLRMRGYYPKGGGEVVVKVNPVKELSPINMTERGNITKIYGRAFVAGVLPFKLAKDMSTAAVRTIRKEIKDLYINIQSLQEKDKACGNGNGIIIIAESSTGC----IFAGSALGKKGVYADKVGIEAAEMLLKNIRHNGCVDEFLQDQLIIFMALA-KGTSRMRTGPITLHTQTAIHVAEQLTKAKFAIHKADDEHAN-----NDTYIIECQGTGATNAN 363          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005993.1 (pep scaffold:Pmarinus_7.0:GL482452:11889:17793:-1 gene:ENSPMAG00000005419.1 transcript:ENSPMAT00000005993.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 2.105e-30
Identity = 61/181 (33.70%), Postives = 107/181 (59.12%), Query Frame = 3
Query:  597 AWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
            ++ TR++P +  R ++  + ++N+FL D+Y+  DH+KG  +G SPG+GI + A TTEG         +       SIPEDLG +   LL +++ RGG +    + L L  +A+G+++VSK++LG  S  T   L  ++ +  V + +EP +  +EG +   ++ LL TC+G G  NL++++
Sbjct:    9 SFGTRVSPQVSNRLVEAARGVLNRFLPDIYIHTDHRKGAQAGRSPGFGISLVAETTEGCFLSAESTSTPGGEGPPSIPEDLGRDCARLLLEEIYRGGCVDSTNQSLALLFMALGQQDVSKLLLGPLSPHTVGFLRHLRDYFSVTFKLEP-RTAEEGDKKGGDKVLL-TCVGIGFSNLSKTV 187          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Sea Lamprey
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc:ZDB-GENE-030131-9687])

HSP 1 Score: 72.7886 bits (177), Expect = 2.321e-14
Identity = 76/330 (23.03%), Postives = 136/330 (41.21%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEIS--EEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQ--IDGIKKLMNKFLS---DVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSI 1034
            L ++  LS I  +P+ +  I     + GL    +  L     +C G         C + + PG + GG    +   + ++       L    F  +P    L G TN S++   ++       F +   GI   F+  V+ RG  P GGG  +  + P ++L+P+   + G I K+ G A+   + P    +      ++KL  +F     ++  + + ++G   GN  G GIIV A T+ G  +  + +     +    PE LG  A  +L   +  GG + E  +  LL  + +   +      G  S  T  AL+ I  F   ++++
Sbjct:   21 LRVSSALSCILGKPIHLTKIRAGRPKPGLRPQHLMGLSTLRDLCGGRLVGAEINSCEVTLYPGQIQGGSHRADTQTAGSVCLMVQSTLPCILFAARPSALTLRGGTNVSHAPQIDYTTTVFKPFAEKF-GI--KFDCDVRIRGYEPKGGGELVLSTAPVRNLEPITVTERGDITKIYGRAYVAGVLPIKMAKDAAATALRKLKQEFRDINVNISAVQEPRQGA-FGN--GNGIIVFAETSTGCIFAGDALGRRGVT----PEQLGTNAAEMLLSNIRHGGCVDEHLQDQLLGFVLIKSSSKKAGQFGRVSQNTLTALLLIFHFAEARFTV 340          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Sea Lamprey
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc:ZDB-GENE-030131-9687])

HSP 1 Score: 72.7886 bits (177), Expect = 2.372e-14
Identity = 76/331 (22.96%), Postives = 136/331 (41.09%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEIS--EEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQ--IDGIKKLMNKFLS---DVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIE 1037
            L ++  LS I  +P+ +  I     + GL    +  L     +C G         C + + PG + GG    +   + ++       L    F  +P    L G TN S++   ++       F +   GI   F+  V+ RG  P GGG  +  + P ++L+P+   + G I K+ G A+   + P    +      ++KL  +F     ++  + + ++G   GN  G GIIV A T+ G  +  + +     +    PE LG  A  +L   +  GG + E  +  LL  + +   +      G  S  T  AL+ I  F   ++++ 
Sbjct:   20 LRVSSALSCILGKPIHLTKIRAGRPKPGLRPQHLMGLSTLRDLCGGRLVGAEINSCEVTLYPGQIQGGSHRADTQTAGSVCLMVQSTLPCILFAARPSALTLRGGTNVSHAPQIDYTTTVFKPFAEKF-GIK--FDCDVRIRGYEPKGGGELVLSTAPVRNLEPITVTERGDITKIYGRAYVAGVLPIKMAKDAAATALRKLKQEFRDINVNISAVQEPRQGA-FGN--GNGIIVFAETSTGCIFAGDALGRRGVT----PEQLGTNAAEMLLSNIRHGGCVDEHLQDQLLGFVLIKSSSKKAGQFGRVSQNTLTALLLIFHFAEARFTVS 340          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Yeast
Match: RCL1 (Endonuclease that cleaves pre-rRNA at site A2 for 18S rRNA biogenesis; subunit of U3-containing 90S preribosome processome complex involved in small ribosomal subunit assembly; stimulates Bms1p GTPase and U3 binding activity; similar to RNA cyclase-like proteins but no cyclase activity detected [Source:SGD;Acc:S000005370])

HSP 1 Score: 124.405 bits (311), Expect = 1.524e-32
Identity = 97/370 (26.22%), Postives = 178/370 (48.11%), Query Frame = 3
Query:   45 SLQYKHNLELTVCLSLITAQPVEINDIEISE--EGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGG--HAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALM--DIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
            + Q   N  L + L+ ++ +P++I  I   +   GL   ++S L L + + NG   +I+ TG  +   PG ++GG   H C +S  +GY+   +L L+PF KK       G+T   N    E + + +   ++     + +   +  KRG+ P GGG  H +  S   Q +  M +I    I  + G A+STR++P+L  R IDG KK++     +V +  D  +GE+SG SPG+GI + A + +         +   G   SIPE+LGE+    L +++ +   +     PL +  + +GK+++ ++ +     +    ++  DIK     +  ++P+ +         N+ ++ T  G G  N ++ I
Sbjct:   10 TFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGITASHNDAGIEAIKWGLMPVMEKFGVRECALHTL--KRGSPPLGGGEVHLVVDSLIAQPIT-MHEIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWGITLVAQSKQ---KGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEAD-------NEDMIATIKGIGFTNTSKKI 366          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Nematostella
Match: EDO31302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYA4])

HSP 1 Score: 194.512 bits (493), Expect = 3.147e-58
Identity = 113/357 (31.65%), Postives = 203/357 (56.86%), Query Frame = 3
Query:   78 VCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEG-IXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSI-EPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSI 1136
            + L+ ++ + V I +I I E+  GL   + + + L DK+ NG   ++NETG  L   PG L GG ++H+C    ++G+Y   L+ L+PFCKKP+   + G+TN S+  S + +       +K  +  D  F + + KRG+ P GGG   F     + L+P++ I  GKI+++RG A++TR++P +  R +D  + ++N+F+SD+Y+  DH +G  +G S G+G+ + A TT G +  V    + S     ++ EDLG+E    L Q++ +GG +    + L L  +A+G+++VS+++ G  +  T Q L  +K F G+ + I    +Q  +  +   + ++L +C+G G  N+N+ +
Sbjct:   17 LVLATLSGKSVRIRNIRIQEDDPGLKDFEANFIRLLDKVTNGSRIEVNETGTSLLYKPGLLSGGVVDHDCGLQRSIGFYLEALVYLAPFCKKPLRVTMRGITNDSDDPSVDIIKTVTIPLMKRFIIDDEDFYLKITKRGSPPEGGGQITFSCPVRKVLRPIQLIDPGKIKRIRGLAYATRVSPAMVNRVVDATRGVLNQFISDIYIYTDHCQGIQAGKSSGFGLSLVAETTNGTLLGVQRASTPSGKGSPTVAEDLGKETAKKLLQEVYKGGCVDSRHQSLALLYMAMGQQDVSRVLTGPLTPYTIQFLRHMKDFLGIMFKIQAQQKQDDDDSKSGGDTKVLLSCVGLGFTNVNKGM 373          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Nematostella
Match: EDO40575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R8])

HSP 1 Score: 55.0694 bits (131), Expect = 2.243e-8
Identity = 51/223 (22.87%), Postives = 94/223 (42.15%), Query Frame = 3
Query:  462 FEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNP-TLGKRQIDGIKKLMNKFLSDVYL-IHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIP-EDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVN 1121
            F   + +RG FP GGG  +      +SLKP++ ++ G + +  G AW   + P  + +       KL+ +   D  + I   ++     +  G GI V A TT G       ++ S      +P E +  +A + L + +  GG + E  +  L+ ++A+     S++  G  +  T  A+   +  T  ++ +           D  +   +  C G GLVN
Sbjct:  136 FHCTIIRRGYFPKGGGEVLVNVDVVKSLKPVQLVEFGSLLRFTGKAWVAGVIPYKVAQTMAREATKLIKRRYPDTPINIDAVQESRHKAHGNGTGIQVMAETTTGC-----RIAASALGRKGVPSEQVASDAVSDLTRNLDSGGCVDEHLQDQLIILMALANGK-SRVKTGPLTMHTKTAIYVAERITKARFKVTSCS-------DEGHDASIIECDGIGLVN 345          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Nematostella
Match: EDO36080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJP5])

HSP 1 Score: 54.6842 bits (130), Expect = 4.098e-8
Identity = 72/348 (20.69%), Postives = 147/348 (42.24%), Query Frame = 3
Query:   36 MRISLQYKHNLELTVCLSLITAQPVEINDIE--ISEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEA-----NLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWST-------RLNPTLGKRQIDGIKKLMNKFLS-DVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSI 1034
            M +  Q    L   + L+ I   PV +N+I    +  GL    + +L L  ++C+G T   ++    +  +PG L  G    E  +S ++   A   L       +P+ +     NL G+T+ +N +  +F +  +   I +  G    F I +K+R  FP   G  + +S P  +LK ++    G++ K+  T W++       R+   + K     +K   ++F   D+Y +   ++ +   +  G  +++   T+ G+      +     S     E++ ++A N+  Q       +    +  LL  +A+ K   S I   + +  T  A+  ++  + VK+ +
Sbjct:  157 MELCFQTSSFLGAGIPLNTILGLPVRLNNIHGPKASYGLQPHDVRMLHLLRQMCSG-TLVASKGSSTVTFLPGDLQAGIFSSEGGHSGSVSLLAESALPCLALAPEPVYSRNNILNLKGITHLANGLHMDF-FDKVYRPIVEKFGFH--FSIEIKRRSYFPQSSGKVVIRSFPVTNLKAVDLTTPGRLVKI--TGWTSVAGAKPIRIAQVMSKLTRSALK---DRFPGVDIY-VESLRERDSRVDGTGQAVMILGETSSGMMLSGTALWRRGMSN----EEVVQKAVNMFTQNSSHSICVDSLVQDKLLPYMALAKGQ-SSIRTSLITPHTKAAIAGLEAMSKVKFQV 489          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Medaka
Match: rcl1 (RNA terminal phosphate cyclase like 1 [Source:NCBI gene;Acc:101160824])

HSP 1 Score: 202.601 bits (514), Expect = 5.245e-61
Identity = 129/362 (35.64%), Postives = 209/362 (57.73%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEISEE--GLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSS-FEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXI-PEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            L   + LS ++ + V I +I   E+  GL   + S + L DK+ NG   +IN+TG  L   PG L GG IEH+C+   ++GYY   LL+L+PF K  ++A L GVTN  N  + + L       +K   GID   F++ V KRG  P GGG  +      ++LKP++  +  KI+++RG A+S R++P +  R ++  + ++N+F+ D+Y+  DH KG +SG SPG+G+ + A T  G    +E+ S  QG    I PEDLG     LL +++ RGG +    + L L ++ +G+++VSK++LG  S  T + L  ++ F  V + IE +Q+  E  R + + ++L TC+G G  N+N++I+
Sbjct:   14 LRQRLVLSTLSGKRVRIKNIRSKEDDPGLRDFEASFIRLLDKVTNGSRIEINQTGTVLSYQPGLLYGGSIEHDCNPQRSIGYYLEALLMLAPFMKMALKATLRGVTNDPNDPTIDLLKTTAVPLMKRF-GIDGEGFDLRVVKRGMAPGGGGEVVLSCPIRRTLKPVQLTEQAKIKRIRGVAYSVRVSPQMANRIVESTRAVLNQFIPDIYIYTDHMKGANSGKSPGFGLTLVAETQNGCFLGAEMSSTPQGQGDPILPEDLGRNCAKLLLEEIYRGGCVDSSNQSLALLLMTLGQQDVSKVLLGPLSAYTIEFLRHVRDFFQVMFKIE-VQKPLEDERKSGD-KVLMTCVGVGYSNINKTIK 372          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Medaka
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:101167358])

HSP 1 Score: 66.6254 bits (161), Expect = 1.206e-11
Identity = 81/362 (22.38%), Postives = 151/362 (41.71%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEI--SEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLY-YAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWST-----RLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLN 1127
            L ++  LS IT   ++I  I    S  GL    +S L+L   +C+G     +     + + PG +  G    +   + ++       L  + F     +  L G TN    ++P+  Y   +   I +  GI+  F+  VK RG +P GGG       P + L+P+   + G I K+ G A+       +L   +    +  I+K + +   ++  + + +K   +GN    GII+ A ++ G          + G      + +G EA  +L + +   G + E  +  L+  +A+  K  S+I  G  +  T  A+   +  T  K++I   +        + +   +  C G+G+VN N
Sbjct:   20 LRVSAALSCITGTAIKITKIRAGRSTPGLRPQHLSGLQLVSDLCSGSLQGASIGSTDVSLTPGKIRSGSHVADPQTAGSVCLLLQVALPCAVFADAASQLCLKGGTNAE--MAPQIDYTLKVFKPIVERFGIN--FDCDVKMRGYYPKGGGEVNVTVNPVKELRPVTLTERGNITKIHGRAFVAGVLPFKLAKDMSTAAVRTIRKEIKELYINIQALQEKEKACGNGN----GIIIIAESSTGC----LFAGSALGKKGVYADKVGIEAAEMLLRNIRHNGCVDEFLQDQLIIFMALA-KGTSRIRTGAVTLHTQTAIHIAEQLTQAKFTISKCED-----EMSSSVTYIIECHGSGVVNPN 363          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Medaka
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:101167358])

HSP 1 Score: 60.4622 bits (145), Expect = 8.805e-10
Identity = 74/328 (22.56%), Postives = 137/328 (41.77%), Query Frame = 3
Query:   66 LELTVCLSLITAQPVEINDIEI--SEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLY-YAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWST-----RLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVK 1025
            L ++  LS IT   ++I  I    S  GL    +S L+L   +C+G     +     + + PG +  G    +   + ++       L  + F     +  L G TN    ++P+  Y   +   I +  GI+  F+  VK RG +P GGG       P + L+P+   + G I K+ G A+       +L   +    +  I+K + +   ++  + + +K   +GN    GII+ A ++ G          + G      + +G EA  +L + +   G + E  +  L+  +A+  K  S+I  G  +  T  A+   +  T V+
Sbjct:   20 LRVSAALSCITGTAIKITKIRAGRSTPGLRPQHLSGLQLVSDLCSGSLQGASIGSTDVSLTPGKIRSGSHVADPQTAGSVCLLLQVALPCAVFADAASQLCLKGGTNAE--MAPQIDYTLKVFKPIVERFGIN--FDCDVKMRGYYPKGGGEVNVTVNPVKELRPVTLTERGNITKIHGRAFVAGVLPFKLAKDMSTAAVRTIRKEIKELYINIQALQEKEKACGNGN----GIIIIAESSTGC----LFAGSALGKKGVYADKVGIEAAEMLLRNIRHNGCVDEFLQDQLIIFMALA-KGTSRIRTGAVTLHTQTAIHIAEQLTQVR 334          
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Planmine SMEST
Match: SMESG000009463.1 (SMESG000009463.1)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 367/368 (99.73%), Postives = 368/368 (100.00%), Query Frame = 3
Query:   36 MRISLQYKHNLELTVCLSLITAQPVEINDIEISEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSXXXXXXXXXXXXXSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGIXXXXXXXXXXXXXXXXIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 1139
            MRISLQYKHNLELTVCLSLITAQPVEINDIEISEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSAALGYYAMYLLLLSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGISYVSEVVSVSQGSVASIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQAL+DIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR
Sbjct:    1 MRISLQYKHNLELTVCLSLITAQPVEINDIEISEEGLTSSQISLLELFDKICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSAALGYYAMYLLLLSPFCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKRGAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKRQIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGISYVSEVVSVSQGSVASIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVGKKNVSKIVLGVPSTETAQALLDIKLFTGVKYSIEPLQQGQEGYRDNCNQQLLFTCIGAGLVNLNRSIR 368          
The following BLAST results are available for this feature:
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RCL13.752e-5535.31RNA terminal phosphate cyclase like 1 [Source:HGNC... [more]
RCL13.926e-3833.80RNA terminal phosphate cyclase like 1 [Source:HGNC... [more]
RCL12.292e-2832.61RNA terminal phosphate cyclase like 1 [Source:HGNC... [more]
RCL12.292e-2832.61RNA terminal phosphate cyclase like 1 [Source:HGNC... [more]
RCL12.292e-2832.61RNA terminal phosphate cyclase like 1 [Source:HGNC... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZK1127.53.599e-5532.05Probable RNA 3'-terminal phosphate cyclase-like pr... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rtc14.485e-6033.15gene:FBgn0020909 transcript:FBtr0073820[more]
Rtca1.005e-623.27gene:FBgn0025630 transcript:FBtr0070330[more]
Rtca1.005e-623.27gene:FBgn0025630 transcript:FBtr0344156[more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rcl18.763e-6535.65RNA terminal phosphate cyclase-like 1 [Source:NCBI... [more]
rtca1.058e-1623.66RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
supt6h1.494e-5333.80SPT6 homolog, histone chaperone [Source:Xenbase;Ac... [more]
supt6h8.570e-5333.52SPT6 homolog, histone chaperone [Source:Xenbase;Ac... [more]
supt6h5.712e-5232.87SPT6 homolog, histone chaperone [Source:Xenbase;Ac... [more]
supt6h8.397e-5132.40SPT6 homolog, histone chaperone [Source:Xenbase;Ac... [more]
supt6h1.134e-3432.19SPT6 homolog, histone chaperone [Source:Xenbase;Ac... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rcl13.849e-5535.31RNA terminal phosphate cyclase-like 1 [Source:MGI ... [more]
Rcl12.065e-4836.56RNA terminal phosphate cyclase-like 1 [Source:MGI ... [more]
Rtca1.174e-1321.57RNA 3'-terminal phosphate cyclase [Source:MGI Symb... [more]
Rtca4.632e-626.95RNA 3'-terminal phosphate cyclase [Source:MGI Symb... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56175|RCL1_DROME4.496e-5933.15Probable RNA 3'-terminal phosphate cyclase-like pr... [more]
sp|Q2KHX8|RCL1_BOVIN1.764e-5435.58RNA 3'-terminal phosphate cyclase-like protein OS=... [more]
sp|Q9Y2P8|RCL1_HUMAN1.802e-5435.31RNA 3'-terminal phosphate cyclase-like protein OS=... [more]
sp|Q9JJT0|RCL1_MOUSE2.693e-5435.31RNA 3'-terminal phosphate cyclase-like protein OS=... [more]
sp|Q23400|RCL1_CAEEL4.578e-5432.05Probable RNA 3'-terminal phosphate cyclase-like pr... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8KUR84.408e-6738.10RNA 3'-terminal phosphate cyclase-like protein OS=... [more]
A0A0N5CBI29.011e-6635.92Uncharacterized protein OS=Strongyloides papillosu... [more]
A0A0K0EU781.967e-6535.39Uncharacterized protein OS=Strongyloides venezuele... [more]
A0A4Y7NL671.310e-6435.85EOG090X05X4 OS=Moina brachiata OX=675436 GN=EOG090... [more]
T1K5A32.750e-6437.06Uncharacterized protein OS=Tetranychus urticae OX=... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rcl11.469e-5936.24RNA terminal phosphate cyclase like 1 [Source:NCBI... [more]
rtca9.979e-1423.46RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005993.12.105e-3033.70pep scaffold:Pmarinus_7.0:GL482452:11889:17793:-1 ... [more]
rtca2.321e-1423.03RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc... [more]
rtca2.372e-1422.96RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RCL11.524e-3226.22Endonuclease that cleaves pre-rRNA at site A2 for ... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO313023.147e-5831.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405752.243e-822.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360804.098e-820.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rcl15.245e-6135.64RNA terminal phosphate cyclase like 1 [Source:NCBI... [more]
rtca1.206e-1122.38RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
rtca8.805e-1022.56RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009463.10.000e+099.73SMESG000009463.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030050 ID=SMED30030050|Name=RNA 3'-terminal phosphate cyclase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1248bp
GTTTAAATAATCAACGAAAAATACCCTTATTTTAAATGCGCATTTCTTTA
CAATATAAACACAATTTAGAATTAACTGTGTGCTTGTCATTAATCACTGC
ACAACCCGTCGAGATTAATGACATTGAAATTTCTGAAGAAGGTTTGACAT
CATCTCAAATTTCTTTACTTGAATTATTTGATAAAATTTGTAATGGTGTA
ACGTTTGATATAAATGAAACTGGTTGCAGACTGAGAGTTATTCCAGGAAC
TTTAATCGGTGGGGAAATTGAACACGAATGTGACAACAGCGCTGCTTTGG
GCTATTACGCAATGTATTTGTTGCTTTTGTCACCGTTTTGTAAGAAACCT
ATTGAAGCAAATTTGTATGGAGTAACAAATAAAAGCAATAGTATTTCTCC
AGAGTTTCTCTACTACGCAATTGGGCATTTTATTAAAGATCTTGTAGGCA
TCGATTCATCATTTGAAATAGTTGTTAAAAAACGTGGTGCATTTCCAAAC
GGAGGTGGACATGCAATTTTCAAATCAAAACCAACTCAATCTCTGAAACC
TATGGAAAAAATTAAAATAGGAAAAATCCAAAAGGTTAGAGGCACCGCAT
GGAGCACCAGGCTCAATCCGACCCTTGGAAAACGTCAAATTGACGGGATA
AAAAAGTTGATGAATAAATTTTTATCCGATGTTTATCTTATCCATGACCA
TAAAAAAGGCGAAGATTCCGGCAACAGTCCTGGATACGGAATTATTGTGA
CTGCTACGACAACCGAGGGGATCTCCTACGTCTCTGAAGTGGTCAGTGTC
AGCCAGGGCAGTGTTGCATCAATTCCAGAAGATCTCGGCGAGGAAGCAGG
AAATCTACTGAACCAACAAATGATTCGAGGTGGAGTAATTGTCGAGGAGT
TTGAGCCGTTGCTATTAACCATGCTGGCCGTTGGTAAGAAGAACGTCAGC
AAAATTGTGTTAGGAGTGCCATCAACTGAAACGGCCCAAGCGTTGATGGA
CATCAAGCTGTTTACTGGGGTGAAATATTCAATCGAGCCGCTACAGCAAG
GACAAGAGGGCTACCGGGACAATTGCAACCAACAGCTGCTGTTCACCTGC
ATCGGAGCCGGCCTTGTCAACTTGAATAGGAGCATTCGATAAATATATTT
CTCAGATTTTCTCTTTTCATTGATTTGATATGATTTTTGCCAATTACTTT
ATTAGCCTGTTAAATAAGCAATTCTTGTTTTCCCGTCCGGAATGAATA
back to top

protein sequence of SMED30030050-orf-1

>SMED30030050-orf-1 ID=SMED30030050-orf-1|Name=SMED30030050-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MRISLQYKHNLELTVCLSLITAQPVEINDIEISEEGLTSSQISLLELFDK
ICNGVTFDINETGCRLRVIPGTLIGGEIEHECDNSAALGYYAMYLLLLSP
FCKKPIEANLYGVTNKSNSISPEFLYYAIGHFIKDLVGIDSSFEIVVKKR
GAFPNGGGHAIFKSKPTQSLKPMEKIKIGKIQKVRGTAWSTRLNPTLGKR
QIDGIKKLMNKFLSDVYLIHDHKKGEDSGNSPGYGIIVTATTTEGISYVS
EVVSVSQGSVASIPEDLGEEAGNLLNQQMIRGGVIVEEFEPLLLTMLAVG
KKNVSKIVLGVPSTETAQALMDIKLFTGVKYSIEPLQQGQEGYRDNCNQQ
LLFTCIGAGLVNLNRSIR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036553RPTC_insert
IPR037136RNA3'_phos_cyclase_dom_sf
IPR016443RNA3'_term_phos_cyc_type_2
IPR000228RNA3'_term_phos_cyc
IPR023797RNA3'_phos_cyclase_dom
IPR013791RNA3'-term_phos_cycl_insert
IPR013792RNA3'P_cycl/enolpyr_Trfase_a/b
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0003963RNA-3'-phosphate cyclase activity
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0042254ribosome biogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023797RNA 3'-terminal phosphate cyclase domainPFAMPF01137RTCcoord: 11..333
e-value: 6.1E-30
score: 104.4
IPR036553RNA 3'-terminal phosphate cyclase, insert domain superfamilyGENE3DG3DSA:3.30.360.20coord: 177..276
e-value: 3.6E-85
score: 287.6
IPR037136RNA 3'-terminal phosphate cyclase domain superfamilyGENE3DG3DSA:3.65.10.20coord: 9..331
e-value: 3.6E-85
score: 287.6
IPR013791RNA 3'-terminal phosphate cyclase, insert domainPFAMPF05189RTC_insertcoord: 178..278
e-value: 2.8E-24
score: 85.6
IPR016443RNA 3'-terminal phosphate cyclase type 2TIGRFAMTIGR03400TIGR03400coord: 7..367
e-value: 7.8E-92
score: 305.8
IPR016443RNA 3'-terminal phosphate cyclase type 2PANTHERPTHR11096:SF1RNA 3'-TERMINAL PHOSPHATE CYCLASE-LIKE PROTEINcoord: 7..367
IPR000228RNA 3'-terminal phosphate cyclasePANTHERPTHR11096RNA 3' TERMINAL PHOSPHATE CYCLASEcoord: 7..367
NoneNo IPR availablePRODOMPD397608coord: 186..246
e-value: 2.0E-11
score: 169.0
IPR013792RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/betaSUPERFAMILYSSF55205EPT/RTPC-likecoord: 10..227