ATP-dependent RNA helicase

Overview
NameATP-dependent RNA helicase
Smed IDSMED30030038
Length (bp)4761
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase (SMED30030038) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase (SMED30030038) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase (SMED30030038) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase (SMED30030038) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030038SMESG000011907.1 dd_Smed_v4_596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030038SMESG000011907.1 Contig50034newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030038SMESG000011907.1 Contig50034uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030038SMESG000011907.1 Contig40165newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030038SMESG000011907.1 Contig40165uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030038SMESG000011907.1 Contig11071newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030038SMESG000011907.1 Contig11071uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30030038SMESG000011907.1 dd_Smed_v6_596_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30030038SMESG000011907.1 dd_Smed_v6_596_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase vs. Ensembl Human
Match: DDX43 (DEAD-box helicase 43 [Source:HGNC Symbol;Acc:HGNC:18677])

HSP 1 Score: 384.03 bits (985), Expect = 1.355e-116
Identity = 214/488 (43.85%), Postives = 313/488 (64.14%), Query Frame = 1
Query:  841 NIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFD-KDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL---MKDHQDYR 2292
             +K + TK ++  P+ +NFY+E  + S M+  E + +  +                  NF  T  D KD E+        + IPNP   F+++F  +P+++  I+K  FQ+P+PIQ  AWPI++ G DLIG+AQTGTGKTL +L+P FIH+  QP  + +R  P +L+L+PTRELA+Q++ E  KY+Y  + SV  YGG ++ +QI +LK+  +I++ TPGR+ DL+ S  +NLK+++YLVLDEAD+MLDMGFE Q++ ++  VR  RQTVMTSATWP  V R+A +++K P+ V VGTLDL A  +VKQ++      +K   +   L  +   DK+I+FV+RKA    L+ +L L          G +    +HGD +Q++RE AL+  ++G   I+IATD+ASRGLD+ D+T V N+DFP+NIEEYVHR+GRTGRAGRTG + T + +ND   A+ELI IL+ A+Q +P+ L  +    K HQ  R
Sbjct:  180 GLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWRKE------------------NFNITWDDLKDGEK--------RPIPNPTCTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLIL----------GNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKR 631          

HSP 2 Score: 160.229 bits (404), Expect = 2.630e-59
Identity = 85/228 (37.28%), Postives = 127/228 (55.70%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI +NFY+E      +S  E +S+  RK N  I                  DD  + +   +P       P  +F++ F  +PE+++ IK   F+ PTPIQ   WP++L G D IG+AQTGTGKTL +++P  IH+  Q   +  R  P +L+L+PTRELA+Q+E E  K  Y  ++SVC YGG  +  QI  L+   +I++ TPGR+NDL +   +NLK++   + D
Sbjct:  193 PIKKNFYKESTATSAMSKVEADSW--RKENFNITW----------------DDLKDGEKRPIP------NPTCTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLD 396          

HSP 3 Score: 91.6633 bits (226), Expect = 2.630e-59
Identity = 42/79 (53.16%), Postives = 58/79 (73.42%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            ++YLVLDEAD+MLDMGFEPQ++ I+ D R  RQ++MTSATWP  V ++A  Y+  P+ V VG+LDL+    SS+  N +
Sbjct:  390 ITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVA--VSSVKQNII 466          
BLAST of ATP-dependent RNA helicase vs. Ensembl Human
Match: DDX53 (DEAD-box helicase 53 [Source:HGNC Symbol;Acc:HGNC:20083])

HSP 1 Score: 339.732 bits (870), Expect = 5.482e-101
Identity = 175/407 (43.00%), Postives = 272/407 (66.83%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRIN 2298
            ++IP P   F+++F  +PD+L  I +    +P+PIQ  AWPI++ G DLI +AQTGTGKTL++L+P FIH++ QP  RE+R GP +L+L+PTRELA+ ++ E  KY+Y  + S+  YGG ++  QI  + +  +I++ TPGR+ DL+ +  +NL+ ++YLV+DEAD+MLDM FE Q+  ++  VR  RQTVMTSATWP  V+++AL+++K+P+ V VG L+L A +TVKQ++      +K     E + ++ P DK+I+FV++K    DL+ +  ++           + A  +HG+ +Q ++E A++  +SG   I+I TD+ SRGLD+ D+T V NYDFP+NI+ YVHRVG  GR G+TG + T + + D   A ELI+IL  A+Q VP+ L  +    + Y++N
Sbjct:  214 RLIPKPTCRFKDAFQQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYVGNLNLVAVNTVKQNIIVTTEKEKRALTQEFVENMSPNDKVIMFVSQKHIADDLSSDFNIQ----------GISAESLHGNSEQSDQERAVEDFKSGNIKILITTDIVSRGLDLNDVTHVYNYDFPRNIDVYVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVMA---EQYKLN 607          

HSP 2 Score: 151.754 bits (382), Expect = 2.493e-56
Identity = 82/228 (35.96%), Postives = 125/228 (54.82%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            P+ +NFY E      +S  E++    RK N  I             CD    D    +  ++P      KP   F++ F ++P++L  I  +    PTPIQ   WP+IL G D I +AQTGTGKTL++++P  IH++ Q   R+ R GP +L+L+PTRELA+ +E+E  K  Y  +KS+C YGG  +  QI  +    +I++ TPGR+NDL +   +NL+ +   + D
Sbjct:  173 PVKKNFYIESKATSCMS--EMQVINWRKENFNIT------------CD----DLKSGEKRLIP------KPTCRFKDAFQQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVID 376          

HSP 3 Score: 90.1225 bits (222), Expect = 2.493e-56
Identity = 39/68 (57.35%), Postives = 55/68 (80.88%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIV 3678
            ++YLV+DEAD+MLDM FEPQ+  I+ D R  RQ++MTSATWP+ VRQ+AL Y+ +P+ V VG+L+L+ 
Sbjct:  370 ITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYVGNLNLVA 437          
BLAST of ATP-dependent RNA helicase vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 309.686 bits (792), Expect = 1.398e-90
Identity = 184/466 (39.48%), Postives = 274/466 (58.80%), Query Frame = 1
Query:  889 RNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYH-DIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKD 2277
            +NFY+EHP +++ T  E E                            T+ +  E  +     PK    PV NF E+ F   +++  I +Q F EP+ IQ   WP+ ++G D++G+AQTG+GKTL++LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q    +Y     + S   YGGA K  QI  L+   EI + TPGR+ D  + G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K+ + +N+G L+L+A H + Q V+     +K ++L+ ++  I  + E+K I+FV  K +C +L  ++   R  G         A  IHGD  QQER+  L   + G   I+IATDVASRGLD+ D+  VINYD+P + E+Y+HR+GRT R+ +TG A+TF   N++   ++LI +L++A+Q +   L QL++D
Sbjct:   56 KNFYQEHPDLARRTAQEVE----------------------------TYRRSKEITVRGHNCPK----PVLNFYEANFP-ANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPF-LERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKM---RRDGW-------PAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVED 477          

HSP 2 Score: 132.494 bits (332), Expect = 2.921e-49
Identity = 83/229 (36.24%), Postives = 118/229 (51.53%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
              +NFY+EHPD+   + +EVE++  R   I ++               HN                  KP+ +F E  +    ++D+I   NF  PT IQ  GWPV L G D +G+AQTG+GKTL+++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++    +  +   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+     + D
Sbjct:   54 FEKNFYQEHPDLARRTAQEVETYR-RSKEITVR--------------GHN----------------CPKPVLNFYEANFP-ANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQ--PFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLD 248          

HSP 3 Score: 85.8853 bits (211), Expect = 2.921e-49
Identity = 40/80 (50.00%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ + + +N+G+L+L      S  HN L
Sbjct:  241 RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALEL------SANHNIL 314          
BLAST of ATP-dependent RNA helicase vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 309.301 bits (791), Expect = 1.849e-90
Identity = 184/466 (39.48%), Postives = 274/466 (58.80%), Query Frame = 1
Query:  889 RNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYH-DIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKD 2277
            +NFY+EHP +++ T  E E                            T+ +  E  +     PK    PV NF E+ F   +++  I +Q F EP+ IQ   WP+ ++G D++G+AQTG+GKTL++LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q    +Y     + S   YGGA K  QI  L+   EI + TPGR+ D  + G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K+ + +N+G L+L+A H + Q V+     +K ++L+ ++  I  + E+K I+FV  K +C +L  ++   R  G         A  IHGD  QQER+  L   + G   I+IATDVASRGLD+ D+  VINYD+P + E+Y+HR+GRT R+ +TG A+TF   N++   ++LI +L++A+Q +   L QL++D
Sbjct:   56 KNFYQEHPDLARRTAQEVE----------------------------TYRRSKEITVRGHNCPK----PVLNFYEANFP-ANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPF-LERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKM---RRDGW-------PAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVED 477          

HSP 2 Score: 132.494 bits (332), Expect = 3.683e-49
Identity = 83/229 (36.24%), Postives = 118/229 (51.53%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
              +NFY+EHPD+   + +EVE++  R   I ++               HN                  KP+ +F E  +    ++D+I   NF  PT IQ  GWPV L G D +G+AQTG+GKTL+++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++    +  +   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+     + D
Sbjct:   54 FEKNFYQEHPDLARRTAQEVETYR-RSKEITVR--------------GHN----------------CPKPVLNFYEANFP-ANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQ--PFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLD 248          

HSP 3 Score: 85.5001 bits (210), Expect = 3.683e-49
Identity = 40/80 (50.00%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ + + +N+G+L+L      S  HN L
Sbjct:  241 RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALEL------SANHNIL 314          
BLAST of ATP-dependent RNA helicase vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 311.997 bits (798), Expect = 2.954e-90
Identity = 181/404 (44.80%), Postives = 252/404 (62.38%), Query Frame = 1
Query: 1081 VIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYT-YHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            V P PV  F  + F    ++  +  Q F EP+PIQC  +P+ ++GRD++GIAQTG+GKTLA+LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q     Y     + S   YGGA K  QI  L+   EI + TPGR+ D  +SG  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +++  Q+NVG L+L+A H + Q V+     +K  +L++++  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD  Q ER+  L   RSG   I+IATDVASRGLD+ D+  VINYD+P + E+YVHR+GRT R+   G A+TF    ++  A ELI++L++A+Q +   L QL+ DH+
Sbjct:  165 VCPKPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLV-DHR 555          

HSP 2 Score: 130.183 bits (326), Expect = 1.124e-48
Identity = 82/221 (37.10%), Postives = 114/221 (51.58%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY EHP++  L+  EV+  L RK  I ++     P                             KP+ +F    +    ++D++   +F  PTPIQC G+P+ L GRD +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:  130 FEKNFYVEHPEVARLTPYEVDE-LRRKKEITVRGGDVCP-----------------------------KPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLR 317          

HSP 3 Score: 86.2705 bits (212), Expect = 1.124e-48
Identity = 42/80 (52.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ +  Q+NVG+L+L      S  HN L
Sbjct:  318 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLEL------SANHNIL 391          
BLAST of ATP-dependent RNA helicase vs. Ensembl Celegans
Match: Y54G11A.3 (pep chromosome:WBcel235:II:14276621:14283973:1 gene:WBGene00013214.1 transcript:Y54G11A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54G11A.3)

HSP 1 Score: 363.999 bits (933), Expect = 1.329e-111
Identity = 194/413 (46.97%), Postives = 274/413 (66.34%), Query Frame = 1
Query: 1084 IPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREK-----RQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPED----KIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRI 2295
            IP PV +FE++F  +  I+ EIRK  F++PSPIQ   WP+L++G+D IG++QTG+GKTLAFLLPA +HI+ Q    EK     +  P VL+LSPTRELA QI+ EV+KY+Y+   SV  YGG  + +Q+   +   EIV+ TPGR+ DL + GV++L  V+Y+VLDEADRMLDMGFE+ +  +++ +R  R   +TSATWP GV+++   + K  V    G+LDL +C +V Q  E+V +  +  R+ EI+  +        K+IIFV  K     L+ +  +K           + +  +HG   Q +REM+L M+RSG   I++ATD+ASRG+D+PD+T V+NYDFP +IEEYVHRVGRTGRAGR GEA +F+  ND SN   LI+IL+ ++QEVPD   QL +D + YR+
Sbjct:   78 IPPPVNSFEQAFGSNASIMGEIRKNGFEKPSPIQSQMWPLLLSGQDCIGVSQTGSGKTLAFLLPALLHIDAQLAQYEKNDEEQKPSPFVLVLSPTRELAQQIEGEVKKYSYNGYKSVCLYGGGSRPEQVEACRGGVEIVIATPGRLTDLSNDGVISLASVTYVVLDEADRMLDMGFEVAIRRILFEIRPDRLVALTSATWPEGVRKLTDKYTKEAVMAVNGSLDLTSCKSVTQFFEFVPHDSRFLRVCEIVNFLTAAHGQNYKMIIFVKSKVMADHLSSDFCMK----------GINSQGLHGGRSQSDREMSLNMLRSGEVQILVATDLASRGIDVPDITHVLNYDFPMDIEEYVHRVGRTGRAGRKGEAMSFLWWNDRSNFEGLIQILEKSEQEVPD---QLRRDAEKYRL 477          

HSP 2 Score: 152.91 bits (385), Expect = 9.783e-39
Identity = 89/233 (38.20%), Postives = 131/233 (56.22%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKP-----RQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI R+ Y+   + +NLS E+++  L     +M    K +P +            +E  V++ P       P+ SFE+ F  +  I+  I+   FE P+PIQ   WP++L G+D IG++QTG+GKTL F+LPAL+HI+ Q+        + +  P VL+LSPTRELA QIE E+ K  Y+  KSVC YGG  +  Q+ + R   EIV+ TPGR+ DL   G ++L  V   + D
Sbjct:   35 PIVRDLYKIPNEQKNLSPEQLQE-LYTNGGVM----KVYPFR------------EESTVKIPP-------PVNSFEQAFGSNASIMGEIRKNGFEKPSPIQSQMWPLLLSGQDCIGVSQTGSGKTLAFLLPALLHIDAQLAQYEKNDEEQKPSPFVLVLSPTRELAQQIEGEVKKYSYNGYKSVCLYGGGSRPEQVEACRGGVEIVIATPGRLTDLSNDGVISLASVTYVVLD 243          

HSP 3 Score: 70.0922 bits (170), Expect = 8.415e-12
Identity = 35/72 (48.61%), Postives = 46/72 (63.89%), Query Frame = 1
Query: 3457 LLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++ +  V+Y+VLDEADRMLDMGFE  +  I+ + R  R   +TSATWPE VR++   Y    V    GSLDL
Sbjct:  231 VISLASVTYVVLDEADRMLDMGFEVAIRRILFEIRPDRLVALTSATWPEGVRKLTDKYTKEAVMAVNGSLDL 302          
BLAST of ATP-dependent RNA helicase vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 310.457 bits (794), Expect = 5.996e-92
Identity = 191/466 (40.99%), Postives = 273/466 (58.58%), Query Frame = 1
Query:  871 NFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFL 2259
            N  P+ ++FY E+ +VS+     +E++ +D+     +      G                           +P PV  F E+    P  + E+   KFQ+P+ IQ I+WPI M+GRD+I IA+TG+GKTLAF+LPA +HI  Q   R++ +GP VL+L PTRELA Q+Q     + +     + C +GGA K  Q   L+   +IVV TPGR+ D  D+G  N+K  SYLVLDEADRMLDMGFE Q+  +I  +R  RQT+M SATWP  V+ +A    K+   +NVG+L+L A H + Q V+ ++ H K  +L+E+L HI  + E K IIFV  K +  +L     ++R        G    C IHGD +Q ER+  L+  ++G   IM+ATDVA+RGLD+ D+  VINYD+P N E+YVHR+GRTGR+ + G A+TF    + S A +L+++L +A Q VP  L
Sbjct:   86 NLTPIEKDFYHENAAVSR-----REQYEIDQWVSANQVTLEGRG---------------------------VPRPVFEFNEAPL--PGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRA--MRRD-------GWPTLC-IHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQAL 506          

HSP 2 Score: 118.242 bits (295), Expect = 7.372e-45
Identity = 66/155 (42.58%), Postives = 89/155 (57.42%), Query Frame = 2
Query: 2960 GIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYH-NIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            G+ +P+  F E     P  +  +    F+ PT IQ I WP+ + GRD I IA+TG+GKTL F+LPAL+HI  Q   RQ   GP VL+L PTRELA Q++   +   +   +K  C +GGA K  Q   L    +IVV TPGR+ D +  G  N+K
Sbjct:  124 GVPRPVFEFNEA--PLPGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMK 275          

HSP 3 Score: 84.3445 bits (207), Expect = 7.372e-45
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            K SYLVLDEADRMLDMGFEPQ+  II   R  RQ++M SATWP+ VR +A  +  +   +NVGSL+L  +
Sbjct:  276 KCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAAN 345          
BLAST of ATP-dependent RNA helicase vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 310.457 bits (794), Expect = 5.996e-92
Identity = 191/466 (40.99%), Postives = 273/466 (58.58%), Query Frame = 1
Query:  871 NFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFL 2259
            N  P+ ++FY E+ +VS+     +E++ +D+     +      G                           +P PV  F E+    P  + E+   KFQ+P+ IQ I+WPI M+GRD+I IA+TG+GKTLAF+LPA +HI  Q   R++ +GP VL+L PTRELA Q+Q     + +     + C +GGA K  Q   L+   +IVV TPGR+ D  D+G  N+K  SYLVLDEADRMLDMGFE Q+  +I  +R  RQT+M SATWP  V+ +A    K+   +NVG+L+L A H + Q V+ ++ H K  +L+E+L HI  + E K IIFV  K +  +L     ++R        G    C IHGD +Q ER+  L+  ++G   IM+ATDVA+RGLD+ D+  VINYD+P N E+YVHR+GRTGR+ + G A+TF    + S A +L+++L +A Q VP  L
Sbjct:   86 NLTPIEKDFYHENAAVSR-----REQYEIDQWVSANQVTLEGRG---------------------------VPRPVFEFNEAPL--PGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRA--MRRD-------GWPTLC-IHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQAL 506          

HSP 2 Score: 118.242 bits (295), Expect = 7.372e-45
Identity = 66/155 (42.58%), Postives = 89/155 (57.42%), Query Frame = 2
Query: 2960 GIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYH-NIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            G+ +P+  F E     P  +  +    F+ PT IQ I WP+ + GRD I IA+TG+GKTL F+LPAL+HI  Q   RQ   GP VL+L PTRELA Q++   +   +   +K  C +GGA K  Q   L    +IVV TPGR+ D +  G  N+K
Sbjct:  124 GVPRPVFEFNEA--PLPGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMK 275          

HSP 3 Score: 84.3445 bits (207), Expect = 7.372e-45
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            K SYLVLDEADRMLDMGFEPQ+  II   R  RQ++M SATWP+ VR +A  +  +   +NVGSL+L  +
Sbjct:  276 KCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAAN 345          
BLAST of ATP-dependent RNA helicase vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 310.457 bits (794), Expect = 5.996e-92
Identity = 191/466 (40.99%), Postives = 273/466 (58.58%), Query Frame = 1
Query:  871 NFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFL 2259
            N  P+ ++FY E+ +VS+     +E++ +D+     +      G                           +P PV  F E+    P  + E+   KFQ+P+ IQ I+WPI M+GRD+I IA+TG+GKTLAF+LPA +HI  Q   R++ +GP VL+L PTRELA Q+Q     + +     + C +GGA K  Q   L+   +IVV TPGR+ D  D+G  N+K  SYLVLDEADRMLDMGFE Q+  +I  +R  RQT+M SATWP  V+ +A    K+   +NVG+L+L A H + Q V+ ++ H K  +L+E+L HI  + E K IIFV  K +  +L     ++R        G    C IHGD +Q ER+  L+  ++G   IM+ATDVA+RGLD+ D+  VINYD+P N E+YVHR+GRTGR+ + G A+TF    + S A +L+++L +A Q VP  L
Sbjct:   86 NLTPIEKDFYHENAAVSR-----REQYEIDQWVSANQVTLEGRG---------------------------VPRPVFEFNEAPL--PGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRA--MRRD-------GWPTLC-IHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQAL 506          

HSP 2 Score: 118.242 bits (295), Expect = 7.372e-45
Identity = 66/155 (42.58%), Postives = 89/155 (57.42%), Query Frame = 2
Query: 2960 GIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYH-NIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            G+ +P+  F E     P  +  +    F+ PT IQ I WP+ + GRD I IA+TG+GKTL F+LPAL+HI  Q   RQ   GP VL+L PTRELA Q++   +   +   +K  C +GGA K  Q   L    +IVV TPGR+ D +  G  N+K
Sbjct:  124 GVPRPVFEFNEA--PLPGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMK 275          

HSP 3 Score: 84.3445 bits (207), Expect = 7.372e-45
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            K SYLVLDEADRMLDMGFEPQ+  II   R  RQ++M SATWP+ VR +A  +  +   +NVGSL+L  +
Sbjct:  276 KCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAAN 345          
BLAST of ATP-dependent RNA helicase vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 310.457 bits (794), Expect = 5.996e-92
Identity = 191/466 (40.99%), Postives = 273/466 (58.58%), Query Frame = 1
Query:  871 NFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFL 2259
            N  P+ ++FY E+ +VS+     +E++ +D+     +      G                           +P PV  F E+    P  + E+   KFQ+P+ IQ I+WPI M+GRD+I IA+TG+GKTLAF+LPA +HI  Q   R++ +GP VL+L PTRELA Q+Q     + +     + C +GGA K  Q   L+   +IVV TPGR+ D  D+G  N+K  SYLVLDEADRMLDMGFE Q+  +I  +R  RQT+M SATWP  V+ +A    K+   +NVG+L+L A H + Q V+ ++ H K  +L+E+L HI  + E K IIFV  K +  +L     ++R        G    C IHGD +Q ER+  L+  ++G   IM+ATDVA+RGLD+ D+  VINYD+P N E+YVHR+GRTGR+ + G A+TF    + S A +L+++L +A Q VP  L
Sbjct:   86 NLTPIEKDFYHENAAVSR-----REQYEIDQWVSANQVTLEGRG---------------------------VPRPVFEFNEAPL--PGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRA--MRRD-------GWPTLC-IHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQAL 506          

HSP 2 Score: 118.242 bits (295), Expect = 7.372e-45
Identity = 66/155 (42.58%), Postives = 89/155 (57.42%), Query Frame = 2
Query: 2960 GIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYH-NIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            G+ +P+  F E     P  +  +    F+ PT IQ I WP+ + GRD I IA+TG+GKTL F+LPAL+HI  Q   RQ   GP VL+L PTRELA Q++   +   +   +K  C +GGA K  Q   L    +IVV TPGR+ D +  G  N+K
Sbjct:  124 GVPRPVFEFNEA--PLPGQIHELLYGKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAH-RQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMK 275          

HSP 3 Score: 84.3445 bits (207), Expect = 7.372e-45
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            K SYLVLDEADRMLDMGFEPQ+  II   R  RQ++M SATWP+ VR +A  +  +   +NVGSL+L  +
Sbjct:  276 KCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAAN 345          
BLAST of ATP-dependent RNA helicase vs. Ensembl Fly
Match: CG7878 (gene:FBgn0037549 transcript:FBtr0113205)

HSP 1 Score: 414.846 bits (1065), Expect = 2.071e-127
Identity = 231/480 (48.12%), Postives = 311/480 (64.79%), Query Frame = 1
Query:  838 ANIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYV-DYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMK 2274
            A+I     + S   P+ +NFY+E P V+ +T  E E+   +                  N  + ++  +P+E     PIP    NPV  FE+ F ++PD+L EI K  F +PSPIQ  AWPIL+ G D+IGIAQTGTGKTLAFLLP  IH E Q  PR  R G  VL+L+PTRELA+QI+ EV+KY++  + +V  YGG ++  QI  L+   EI++ TPGR+ DL  + V+++  ++YLVLDEADRMLDMGFE Q+  ++  +R  RQT+MTSATWP GV+R+A ++MKNP+QV VG+LDL A H+VKQ ++ + D  DK   +   + ++   DKIIIF  RK +  DL+ EL L          G +  C IHG+ DQ +RE A+  ++SG   I++ATDVASRGLDI D+T VINYDFP NIEEYVHRVGRTGRAGR G + +F  + D + A ELI ILQ+A+QEVPD L  + +
Sbjct:  216 ASIAATAARWSKCPPLTKNFYKEAPEVANLTKSEIERIREEN-----------------NKITVSYVFEPKEGETSPPIP----NPVWTFEQCFAEYPDMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQSTPRGTRGGANVLVLAPTRELALQIEMEVKKYSFRGMKAVCVYGGGNRNMQISDLERGAEIIICTPGRLNDLIMANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDRQTIMTSATWPPGVRRLAQSYMKNPIQVCVGSLDLAATHSVKQIIKLMEDDMDKFNTITSFVKNMSSTDKIIIFCGRKVRADDLSSELTL---------DGFMTQC-IHGNRDQMDREQAIADIKSGVVRILVATDVASRGLDIEDITHVINYDFPHNIEEYVHRVGRTGRAGRQGTSISFFTREDWAMAKELIEILQEAEQEVPDELHNMAR 664          

HSP 2 Score: 181.415 bits (459), Expect = 9.559e-47
Identity = 89/228 (39.04%), Postives = 133/228 (58.33%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            P+ +NFY+E P++ NL+  E+E      N I +  +                 F+  + E  P  P    P+ +FE+ F ++P++L+ I  + F  P+PIQ   WP++L G D IGIAQTGTGKTL F+LP +IH E Q  PR  R G  VL+L+PTRELA+QIE E+ K  +  +K+VC YGG  +  QI+ L    EI++ TPGR+NDL++   +++  +   + D
Sbjct:  230 PLTKNFYKEAPEVANLTKSEIERIREENNKITVSYV-----------------FEPKEGETSPPIP---NPVWTFEQCFAEYPDMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQSTPRGTRGGANVLVLAPTRELALQIEMEVKKYSFRGMKAVCVYGGGNRNMQISDLERGAEIIICTPGRLNDLIMANVIDVSTITYLVLD 437          

HSP 3 Score: 100.138 bits (248), Expect = 7.042e-21
Identity = 45/77 (58.44%), Postives = 59/77 (76.62%), Query Frame = 1
Query: 3451 VDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
             +++ +  ++YLVLDEADRMLDMGFEPQ+  ++ D R  RQ+IMTSATWP  VR++A  YM NP+QV VGSLDL  +
Sbjct:  423 ANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDRQTIMTSATWPPGVRRLAQSYMKNPIQVCVGSLDLAAT 499          
BLAST of ATP-dependent RNA helicase vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0302597)

HSP 1 Score: 324.324 bits (830), Expect = 1.867e-96
Identity = 189/487 (38.81%), Postives = 285/487 (58.52%), Query Frame = 1
Query:  841 NIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI----KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            ++ M+    SN  P  +NFY+EHP+V+  +  E +++                                EE   EI +   +PNP+++F E     PD ++ EIR+Q ++ P+ IQ   WPI M+G + +GIA+TG+GKTL ++LPA +HI  Q +P ++  GP  L+L+PTRELA QIQ    ++         C +GGA K  Q+  L+   EIV+ TPGR+ D   +G  NLK  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   + N +Q+N+G+L+L+A H ++Q V+  D   K ++L  +L+ I    +   KIIIFV  K +  +L   +   RS G       V+   IHGD  Q ER+  L+  RSG  NI++ATDVA+RGLD+  +  VIN+D+P+N E+Y+HR+GRTGR+   G +F F  KN+   A  L+ +L++A+QE+   L  L ++ +
Sbjct:   87 DLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYR-------------------------------EE--QEITVRGQVPNPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNL---VRFIRSFG-------VRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLARNSR 527          

HSP 2 Score: 134.806 bits (338), Expect = 5.831e-51
Identity = 79/226 (34.96%), Postives = 121/226 (53.54%), Query Frame = 2
Query: 2756 IYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIE---SEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            + P  +NFY+EHP++ N S  EV+ +                              +E ++ V    P    PI+ F E+    P+ ++  I+   ++ PT IQ  GWP+ + G +F+GIA+TG+GKTL ++LPA++HI  Q +P Q   GP  L+L+PTRELA QI+   +E     Y  +++ C +GGA K  Q+  L+   EIV+ TPGR+ D +  G  NLK
Sbjct:   98 LAPFKKNFYQEHPNVANRSPYEVQRYR-----------------------------EEQEITVRGQVP---NPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSY--VRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLK 286          

HSP 3 Score: 88.1965 bits (217), Expect = 5.831e-51
Identity = 38/67 (56.72%), Postives = 54/67 (80.60%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ V+Q+A  ++ N +Q+N+GSL+L
Sbjct:  287 RCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLEL 353          
BLAST of ATP-dependent RNA helicase vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078653)

HSP 1 Score: 324.324 bits (830), Expect = 1.867e-96
Identity = 189/487 (38.81%), Postives = 285/487 (58.52%), Query Frame = 1
Query:  841 NIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI----KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            ++ M+    SN  P  +NFY+EHP+V+  +  E +++                                EE   EI +   +PNP+++F E     PD ++ EIR+Q ++ P+ IQ   WPI M+G + +GIA+TG+GKTL ++LPA +HI  Q +P ++  GP  L+L+PTRELA QIQ    ++         C +GGA K  Q+  L+   EIV+ TPGR+ D   +G  NLK  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   + N +Q+N+G+L+L+A H ++Q V+  D   K ++L  +L+ I    +   KIIIFV  K +  +L   +   RS G       V+   IHGD  Q ER+  L+  RSG  NI++ATDVA+RGLD+  +  VIN+D+P+N E+Y+HR+GRTGR+   G +F F  KN+   A  L+ +L++A+QE+   L  L ++ +
Sbjct:   87 DLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYR-------------------------------EE--QEITVRGQVPNPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNL---VRFIRSFG-------VRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLARNSR 527          

HSP 2 Score: 134.806 bits (338), Expect = 5.831e-51
Identity = 79/226 (34.96%), Postives = 121/226 (53.54%), Query Frame = 2
Query: 2756 IYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIE---SEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            + P  +NFY+EHP++ N S  EV+ +                              +E ++ V    P    PI+ F E+    P+ ++  I+   ++ PT IQ  GWP+ + G +F+GIA+TG+GKTL ++LPA++HI  Q +P Q   GP  L+L+PTRELA QI+   +E     Y  +++ C +GGA K  Q+  L+   EIV+ TPGR+ D +  G  NLK
Sbjct:   98 LAPFKKNFYQEHPNVANRSPYEVQRYR-----------------------------EEQEITVRGQVP---NPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSY--VRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLK 286          

HSP 3 Score: 88.1965 bits (217), Expect = 5.831e-51
Identity = 38/67 (56.72%), Postives = 54/67 (80.60%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ V+Q+A  ++ N +Q+N+GSL+L
Sbjct:  287 RCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLEL 353          
BLAST of ATP-dependent RNA helicase vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0301947)

HSP 1 Score: 323.939 bits (829), Expect = 2.008e-96
Identity = 189/487 (38.81%), Postives = 285/487 (58.52%), Query Frame = 1
Query:  841 NIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI----KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            ++ M+    SN  P  +NFY+EHP+V+  +  E +++                                EE   EI +   +PNP+++F E     PD ++ EIR+Q ++ P+ IQ   WPI M+G + +GIA+TG+GKTL ++LPA +HI  Q +P ++  GP  L+L+PTRELA QIQ    ++         C +GGA K  Q+  L+   EIV+ TPGR+ D   +G  NLK  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   + N +Q+N+G+L+L+A H ++Q V+  D   K ++L  +L+ I    +   KIIIFV  K +  +L   +   RS G       V+   IHGD  Q ER+  L+  RSG  NI++ATDVA+RGLD+  +  VIN+D+P+N E+Y+HR+GRTGR+   G +F F  KN+   A  L+ +L++A+QE+   L  L ++ +
Sbjct:   84 DLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYR-------------------------------EE--QEITVRGQVPNPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNL---VRFIRSFG-------VRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLARNSR 524          

HSP 2 Score: 135.191 bits (339), Expect = 5.458e-51
Identity = 79/226 (34.96%), Postives = 121/226 (53.54%), Query Frame = 2
Query: 2756 IYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIE---SEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            + P  +NFY+EHP++ N S  EV+ +                              +E ++ V    P    PI+ F E+    P+ ++  I+   ++ PT IQ  GWP+ + G +F+GIA+TG+GKTL ++LPA++HI  Q +P Q   GP  L+L+PTRELA QI+   +E     Y  +++ C +GGA K  Q+  L+   EIV+ TPGR+ D +  G  NLK
Sbjct:   95 LAPFKKNFYQEHPNVANRSPYEVQRYR-----------------------------EEQEITVRGQVP---NPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSY--VRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLK 283          

HSP 3 Score: 88.1965 bits (217), Expect = 5.458e-51
Identity = 38/67 (56.72%), Postives = 54/67 (80.60%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ V+Q+A  ++ N +Q+N+GSL+L
Sbjct:  284 RCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLEL 350          
BLAST of ATP-dependent RNA helicase vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078650)

HSP 1 Score: 323.939 bits (829), Expect = 2.008e-96
Identity = 189/487 (38.81%), Postives = 285/487 (58.52%), Query Frame = 1
Query:  841 NIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI----KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            ++ M+    SN  P  +NFY+EHP+V+  +  E +++                                EE   EI +   +PNP+++F E     PD ++ EIR+Q ++ P+ IQ   WPI M+G + +GIA+TG+GKTL ++LPA +HI  Q +P ++  GP  L+L+PTRELA QIQ    ++         C +GGA K  Q+  L+   EIV+ TPGR+ D   +G  NLK  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   + N +Q+N+G+L+L+A H ++Q V+  D   K ++L  +L+ I    +   KIIIFV  K +  +L   +   RS G       V+   IHGD  Q ER+  L+  RSG  NI++ATDVA+RGLD+  +  VIN+D+P+N E+Y+HR+GRTGR+   G +F F  KN+   A  L+ +L++A+QE+   L  L ++ +
Sbjct:   84 DLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYR-------------------------------EE--QEITVRGQVPNPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNL---VRFIRSFG-------VRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLARNSR 524          

HSP 2 Score: 135.191 bits (339), Expect = 5.458e-51
Identity = 79/226 (34.96%), Postives = 121/226 (53.54%), Query Frame = 2
Query: 2756 IYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIE---SEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            + P  +NFY+EHP++ N S  EV+ +                              +E ++ V    P    PI+ F E+    P+ ++  I+   ++ PT IQ  GWP+ + G +F+GIA+TG+GKTL ++LPA++HI  Q +P Q   GP  L+L+PTRELA QI+   +E     Y  +++ C +GGA K  Q+  L+   EIV+ TPGR+ D +  G  NLK
Sbjct:   95 LAPFKKNFYQEHPNVANRSPYEVQRYR-----------------------------EEQEITVRGQVP---NPIQDFSEVHL--PDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ-QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSY--VRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLK 283          

HSP 3 Score: 88.1965 bits (217), Expect = 5.458e-51
Identity = 38/67 (56.72%), Postives = 54/67 (80.60%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ V+Q+A  ++ N +Q+N+GSL+L
Sbjct:  284 RCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLEL 350          
BLAST of ATP-dependent RNA helicase vs. Ensembl Zebrafish
Match: ddx43 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:ZFIN;Acc:ZDB-GENE-080204-77])

HSP 1 Score: 398.282 bits (1022), Expect = 4.220e-121
Identity = 202/405 (49.88%), Postives = 289/405 (71.36%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYR 2292
            + IPNPV  FEE+F  +P I+  I +  F++P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++GQP PR+KR GP +L+L+PTRELA+QI+ E  KY+Y    S+  YGG D+  QI  +    +IV+ TPGR+ DL+ + ++NL+ ++YLVLDEADRMLDMGFE Q++ +I  +R  RQTVMTSATWP GV+R+A +++K+P+ V VGTLDL A +TV+Q V +V   +K   + + +  ++P DK++IFV +K +  DL+ +L L+           +    +HGD +Q +RE AL+  + G   I++ATD+ASRGLD+ D+T V NYDFP+N+EEYVHRVGRTGRAGR+GE+ T + + D   AAELI IL+ + Q+VP+ L  + + ++ +R
Sbjct:  270 RTIPNPVCTFEEAFAHYPGIMENIVRVGFKKPTPIQSQAWPVVLNGIDLIGIAQTGTGKTLAYLLPGFIHMDGQPMPRDKRNGPGMLVLTPTRELALQIEAECNKYSYKGFKSICIYGGGDRNAQIKVVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPPGVRRLAKSYLKDPMMVYVGTLDLAAVNTVQQTVLFVQEDEKKDYVFDFIHRMEPLDKVLIFVGKKLKADDLSSDLCLQ----------GIAVQSLHGDREQCDREEALQDFKDGRVRILVATDLASRGLDVHDITHVFNYDFPRNVEEYVHRVGRTGRAGRSGESVTLVTREDWRVAAELITILERSGQDVPEELVLMAERYEKHR 664          

HSP 2 Score: 177.178 bits (448), Expect = 3.634e-45
Identity = 93/227 (40.97%), Postives = 130/227 (57.27%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            + +NFY E   +   S EEV+ +    NNI + +LK        D D+                  I  P+ +FEE F  +P I++ I  + F+ PTPIQ   WPV+L G D IGIAQTGTGKTL ++LP  IH++GQ  PR  R GP +L+L+PTRELA+QIE+E  K  Y   KS+C YGG ++  QI  +    +IV+ TPGR+NDL +   +NL+ +   + D
Sbjct:  230 LKKNFYIEAKSVAARSAEEVKIWRKENNNIFVDDLK--------DGDKRT----------------IPNPVCTFEEAFAHYPGIMENIVRVGFKKPTPIQSQAWPVVLNGIDLIGIAQTGTGKTLAYLLPGFIHMDGQPMPRDKRNGPGMLVLTPTRELALQIEAECNKYSYKGFKSICIYGGGDRNAQIKVVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLD 432          

HSP 3 Score: 95.1301 bits (235), Expect = 3.425e-19
Identity = 43/73 (58.90%), Postives = 58/73 (79.45%), Query Frame = 1
Query: 3454 DLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            +L+ +  ++YLVLDEADRMLDMGFEPQ++ II D R  RQ++MTSATWP  VR++A  Y+ +P+ V VG+LDL
Sbjct:  419 ELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPPGVRRLAKSYLKDPMMVYVGTLDL 491          
BLAST of ATP-dependent RNA helicase vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 310.842 bits (795), Expect = 1.065e-92
Identity = 177/401 (44.14%), Postives = 252/401 (62.84%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDH 2280
            P P+  F E+ F    ++  I KQ + +P+PIQ   WP+ ++G+D++GIAQTG+GKTL++LLPA +HI  QP   E   GP  L+L+PTRELA Q+Q    +Y     I S   YGGA K  QI  L+   EI + TPGR+ D  ++G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K  +Q+NVG L L+A H + Q V+  +  +K  +L+ +L  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD +QQER+  L   + G   I+IATDVASRGLD+ D+  VIN+D+P N E+Y+HR+GRT R+ +TG A+TF   N+M  A +L+ +L++A+Q +   L Q+ +D 
Sbjct:   92 PKPIVKFHEANFPK-YVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPF-LEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMAEDR 480          

HSP 2 Score: 138.658 bits (348), Expect = 1.556e-51
Identity = 87/221 (39.37%), Postives = 118/221 (53.39%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEM-FWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY+E+PD+   S +EVE +  R   I +K                             G  G  KPI  F E  F K+  ++D+I   N+  PTPIQ  GWPV L G+D +GIAQTG+GKTL+++LPA++HI  Q    ++  GP  L+L+PTRELA Q++    +  K   IKS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   56 FEKNFYQENPDVARRSAQEVEHYR-RSKEITVK-----------------------------GRDG-PKPIVKFHEANFPKY--VMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQ-PFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLR 242          

HSP 3 Score: 87.0409 bits (214), Expect = 1.556e-51
Identity = 42/80 (52.50%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++   +Q+NVG+L L      S  HN L
Sbjct:  243 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQL------SANHNIL 316          
BLAST of ATP-dependent RNA helicase vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 308.916 bits (790), Expect = 1.497e-90
Identity = 176/397 (44.33%), Postives = 250/397 (62.97%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            P P+  F E+ F    ++  I KQ + +P+PIQ   WP+ ++G+D++GIAQTG+GKTL++LLPA +HI  QP   E   GP  L+L+PTRELA Q+Q    +Y     I S   YGGA K  QI  L+   EI + TPGR+ D  ++G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K  +Q+NVG L L+A H + Q V+  +  +K  +L+ +L  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD +QQER+  L   + G   I+IATDVASRGLD+ D+  VIN+D+P N E+Y+HR+GRT R+ +TG A+TF   N+M  A +L+ +L++A+Q +   L Q+
Sbjct:   92 PKPIVKFHEANFPK-YVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPF-LEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQM 476          

HSP 2 Score: 138.658 bits (348), Expect = 1.566e-51
Identity = 87/221 (39.37%), Postives = 118/221 (53.39%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEM-FWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY+E+PD+   S +EVE +  R   I +K                             G  G  KPI  F E  F K+  ++D+I   N+  PTPIQ  GWPV L G+D +GIAQTG+GKTL+++LPA++HI  Q    ++  GP  L+L+PTRELA Q++    +  K   IKS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   56 FEKNFYQENPDVARRSAQEVEHYR-RSKEITVK-----------------------------GRDG-PKPIVKFHEANFPKY--VMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQ-PFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLR 242          

HSP 3 Score: 87.0409 bits (214), Expect = 1.566e-51
Identity = 42/80 (52.50%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++   +Q+NVG+L L      S  HN L
Sbjct:  243 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQL------SANHNIL 316          
BLAST of ATP-dependent RNA helicase vs. Ensembl Zebrafish
Match: DDX17 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 304.294 bits (778), Expect = 2.636e-88
Identity = 175/398 (43.97%), Postives = 250/398 (62.81%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLM 2271
            P PV NF ++ F    ++  + +Q F+EP+ IQ   +P+ ++GRD++GIAQTG+GKTLA+LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q     Y     I S   YGGA K  QI  L+   EI + TPGR+ D  + G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +++ VQ+N+G L+L+A H + Q V+    ++K  +L++++  I  + E+K IIFV  K +C +L   +   R  G         A  IHGD  Q ER+  L   RSG   I+IATDVASRGLD+ D+  VINYD+P + E+YVHR+GRT R+   G A+TF    ++  A +L+R+L++A Q +   L QL+
Sbjct:   91 PKPVTNFHQAQFPQ-YVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRM---RRDGW-------PAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQLV 476          

HSP 2 Score: 131.339 bits (329), Expect = 6.389e-50
Identity = 80/221 (36.20%), Postives = 116/221 (52.49%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY E+P++ ++S  +VE +  RK  I ++                                G  KP+ +F +  +    ++D++   NF+ PT IQ  G+P+ L GRD +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   IKS C YGGA K  QI  L    EI + TPGR+ D + +G  NL+
Sbjct:   55 FEKNFYNENPEVHHMSQYDVEEYR-RKREITVR------------------------------GSGCPKPVTNFHQAQFPQ-YVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLR 241          

HSP 3 Score: 88.9669 bits (219), Expect = 6.389e-50
Identity = 44/88 (50.00%), Postives = 61/88 (69.32%), Query Frame = 1
Query: 3448 EVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            EV    + + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ + VQ+N+G+L+L      S  HN L
Sbjct:  234 EVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALEL------SANHNIL 315          
BLAST of ATP-dependent RNA helicase vs. Ensembl Zebrafish
Match: si:dkey-156n14.5 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 303.908 bits (777), Expect = 3.634e-88
Identity = 176/408 (43.14%), Postives = 252/408 (61.76%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPD----------ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLM 2271
            P PV NF ++ F H +          ++  + +Q F+EP+ IQ   +P+ ++GRD++GIAQTG+GKTLA+LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q     Y     I S   YGGA K  QI  L+   EI + TPGR+ D  + G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +++ VQ+N+G L+L+A H + Q V+    ++K  +L++++  I  + E+K IIFV  K +C +L   +   R  G         A  IHGD  Q ER+  L   RSG   I+IATDVASRGLD+ D+  VINYD+P + E+YVHR+GRT R+   G A+TF    ++  A +L+R+L++A Q +   L QL+
Sbjct:   91 PKPVTNFHQAQFPHLNNQFSHFILFYVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRM---RRDGW-------PAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQLV 487          

HSP 2 Score: 129.413 bits (324), Expect = 1.954e-49
Identity = 81/231 (35.06%), Postives = 117/231 (50.65%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE----------ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY E+P++ ++S  +VE +  RK  I ++                                G  KP+ +F +  + H            ++D++   NF+ PT IQ  G+P+ L GRD +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   IKS C YGGA K  QI  L    EI + TPGR+ D + +G  NL+
Sbjct:   55 FEKNFYNENPEVHHMSQYDVEEY-RRKREITVR------------------------------GSGCPKPVTNFHQAQFPHLNNQFSHFILFYVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLR 252          

HSP 3 Score: 88.9669 bits (219), Expect = 1.954e-49
Identity = 44/88 (50.00%), Postives = 61/88 (69.32%), Query Frame = 1
Query: 3448 EVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            EV    + + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ + VQ+N+G+L+L      S  HN L
Sbjct:  245 EVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALEL------SANHNIL 326          
BLAST of ATP-dependent RNA helicase vs. Ensembl Xenopus
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:779928])

HSP 1 Score: 404.445 bits (1038), Expect = 9.627e-124
Identity = 214/483 (44.31%), Postives = 316/483 (65.42%), Query Frame = 1
Query:  847 KMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRI 2295
            K +  K ++  P+ + FY+E P V+ M+ DE EK+              E     C+           +L +E    + IPNPV  FE++F   P++++ + K  F+ P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++ QP PRE++ GP +L+L+PTRELA+Q++ E  KY Y   +S+  YGG D+ +QI ++ +  +IV+ TPGR+ DL+ +  +NLK ++YLVLDEADRMLDMGFE Q++ ++  +R  R T+MTSATWP GV+R+A +++K+P+ V VGTLDL A +TV QHV  +   +K   ++  +  +KP+DK+I+FV +K    DL+ +  L+           +    +HG+ +Q +RE AL   + G   I++ATD+ASRGLD+ D+T V+N+DFP+NIEEYVHRVGRTGRAGRTGE+ T + + D   A ELI IL+ A+QEVP  L  + + +Q ++I
Sbjct:  201 KYEAMKWADMPPIAKAFYKESPEVASMSRDEVEKW------------RKENNNIICD-----------DLKEE---KRSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDLAAVNTVTQHVLVIPEEEKRAFVLHFIDSLKPQDKVIVFVGKKLVADDLSSDFSLQ----------GIPVQSLHGNREQCDREQALDDFKKGKVRILVATDLASRGLDVHDVTHVLNFDFPRNIEEYVHRVGRTGRAGRTGESITLVTRKDWKVAGELISILERANQEVPGDLFDMAERYQQFKI 647          

HSP 2 Score: 179.104 bits (453), Expect = 1.817e-65
Identity = 92/228 (40.35%), Postives = 134/228 (58.77%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI + FY+E P++ ++S +EVE +    NNI+                   DD  E++         I  P+  FE+ F   PE++  ++   FE PTPIQ   WPVIL G D IGIAQTGTGKTL ++LP  IH++ Q  PR+ + GP +L+L+PTRELA+Q+++E  K KY   +S+C YGG ++  QIN +    +IV+ TPGR+NDL +   +NLK +   + D
Sbjct:  212 PIAKAFYKESPEVASMSRDEVEKWRKENNNIIC------------------DDLKEEKR-------SIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLD 414          

HSP 3 Score: 93.5893 bits (231), Expect = 1.817e-65
Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++YLVLDEADRMLDMGFEPQ++ I+ D R  R +IMTSATWP+ VR++A  Y+ +P+ V VG+LDL
Sbjct:  408 ITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDL 473          
BLAST of ATP-dependent RNA helicase vs. Ensembl Xenopus
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:779928])

HSP 1 Score: 378.252 bits (970), Expect = 4.366e-117
Identity = 191/388 (49.23%), Postives = 276/388 (71.13%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQ 2241
            + IPNPV  FE++F   P++++ + K  F+ P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++ QP PRE++ GP +L+L+PTRELA+Q++ E  KY Y   +S+  YGG D+ +QI ++ +  +IV+ TPGR+ DL+ +  +NLK ++YLVLDEADRMLDMGFE Q++ ++  +R  R T+MTSATWP GV+R+A +++K+P+ V VGTLDL A +TV QHV  +   +K   ++  +  +KP+DK+I+FV +K    DL+ +  L+           +    +HG+ +Q +RE AL   + G   I++ATD+ASRGLD+ D+T V+N+DFP+NIEEYVHRVGRTGRAGRTGE+ T + + D   A ELI IL+ A+Q
Sbjct:   26 RSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDLAAVNTVTQHVLVIPEEEKRAFVLHFIDSLKPQDKVIVFVGKKLVADDLSSDFSLQ----------GIPVQSLHGNREQCDREQALDDFKKGKVRILVATDLASRGLDVHDVTHVLNFDFPRNIEEYVHRVGRTGRAGRTGESITLVTRKDWKVAGELISILERANQ 403          

HSP 2 Score: 162.155 bits (409), Expect = 8.920e-60
Identity = 87/213 (40.85%), Postives = 124/213 (58.22%), Query Frame = 2
Query: 2807 LSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            +S +EVE +    NNI+              CD    D  E++         I  P+  FE+ F   PE++  ++   FE PTPIQ   WPVIL G D IGIAQTGTGKTL ++LP  IH++ Q  PR+ + GP +L+L+PTRELA+Q+++E  K KY   +S+C YGG ++  QIN +    +IV+ TPGR+NDL +   +NLK +   + D
Sbjct:    1 MSRDEVEKWRKENNNII--------------CD----DLKEEK-------RSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLD 188          

HSP 3 Score: 91.6633 bits (226), Expect = 8.920e-60
Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++YLVLDEADRMLDMGFEPQ++ I+ D R  R +IMTSATWP+ VR++A  Y+ +P+ V VG+LDL
Sbjct:  182 ITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDL 247          
BLAST of ATP-dependent RNA helicase vs. Ensembl Xenopus
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:779928])

HSP 1 Score: 377.096 bits (967), Expect = 1.329e-116
Identity = 191/388 (49.23%), Postives = 276/388 (71.13%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQ 2241
            + IPNPV  FE++F   P++++ + K  F+ P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++ QP PRE++ GP +L+L+PTRELA+Q++ E  KY Y   +S+  YGG D+ +QI ++ +  +IV+ TPGR+ DL+ +  +NLK ++YLVLDEADRMLDMGFE Q++ ++  +R  R T+MTSATWP GV+R+A +++K+P+ V VGTLDL A +TV QHV  +   +K   ++  +  +KP+DK+I+FV +K    DL+ +  L+           +    +HG+ +Q +RE AL   + G   I++ATD+ASRGLD+ D+T V+N+DFP+NIEEYVHRVGRTGRAGRTGE+ T + + D   A ELI IL+ A+Q
Sbjct:   68 RSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDLAAVNTVTQHVLVIPEEEKRAFVLHFIDSLKPQDKVIVFVGKKLVADDLSSDFSLQ----------GIPVQSLHGNREQCDREQALDDFKKGKVRILVATDLASRGLDVHDVTHVLNFDFPRNIEEYVHRVGRTGRAGRTGESITLVTRKDWKVAGELISILERANQ 445          

HSP 2 Score: 162.54 bits (410), Expect = 7.130e-60
Identity = 82/191 (42.93%), Postives = 116/191 (60.73%), Query Frame = 2
Query: 2888 LDEDCDQHN-----DDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
             D  C + N     DD  E++         I  P+  FE+ F   PE++  ++   FE PTPIQ   WPVIL G D IGIAQTGTGKTL ++LP  IH++ Q  PR+ + GP +L+L+PTRELA+Q+++E  K KY   +S+C YGG ++  QIN +    +IV+ TPGR+NDL +   +NLK +   + D
Sbjct:   47 FDYSCRKENNNIICDDLKEEK-------RSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLD 230          

HSP 3 Score: 91.6633 bits (226), Expect = 7.130e-60
Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++YLVLDEADRMLDMGFEPQ++ I+ D R  R +IMTSATWP+ VR++A  Y+ +P+ V VG+LDL
Sbjct:  224 ITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDL 289          
BLAST of ATP-dependent RNA helicase vs. Ensembl Xenopus
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:779928])

HSP 1 Score: 377.481 bits (968), Expect = 1.407e-116
Identity = 191/388 (49.23%), Postives = 276/388 (71.13%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQ 2241
            + IPNPV  FE++F   P++++ + K  F+ P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++ QP PRE++ GP +L+L+PTRELA+Q++ E  KY Y   +S+  YGG D+ +QI ++ +  +IV+ TPGR+ DL+ +  +NLK ++YLVLDEADRMLDMGFE Q++ ++  +R  R T+MTSATWP GV+R+A +++K+P+ V VGTLDL A +TV QHV  +   +K   ++  +  +KP+DK+I+FV +K    DL+ +  L+           +    +HG+ +Q +RE AL   + G   I++ATD+ASRGLD+ D+T V+N+DFP+NIEEYVHRVGRTGRAGRTGE+ T + + D   A ELI IL+ A+Q
Sbjct:   82 RSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDLAAVNTVTQHVLVIPEEEKRAFVLHFIDSLKPQDKVIVFVGKKLVADDLSSDFSLQ----------GIPVQSLHGNREQCDREQALDDFKKGKVRILVATDLASRGLDVHDVTHVLNFDFPRNIEEYVHRVGRTGRAGRTGESITLVTRKDWKVAGELISILERANQ 459          

HSP 2 Score: 162.155 bits (409), Expect = 8.843e-60
Identity = 80/186 (43.01%), Postives = 116/186 (62.37%), Query Frame = 2
Query: 2888 LDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
             D  C + N++   D ++       I  P+  FE+ F   PE++  ++   FE PTPIQ   WPVIL G D IGIAQTGTGKTL ++LP  IH++ Q  PR+ + GP +L+L+PTRELA+Q+++E  K KY   +S+C YGG ++  QIN +    +IV+ TPGR+NDL +   +NLK +   + D
Sbjct:   61 FDYSCRKENNNIICDDLK--EEKRSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLD 244          

HSP 3 Score: 91.6633 bits (226), Expect = 8.843e-60
Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++YLVLDEADRMLDMGFEPQ++ I+ D R  R +IMTSATWP+ VR++A  Y+ +P+ V VG+LDL
Sbjct:  238 ITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDL 303          
BLAST of ATP-dependent RNA helicase vs. Ensembl Xenopus
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:779928])

HSP 1 Score: 376.711 bits (966), Expect = 3.576e-116
Identity = 191/388 (49.23%), Postives = 276/388 (71.13%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQ 2241
            + IPNPV  FE++F   P++++ + K  F+ P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++ QP PRE++ GP +L+L+PTRELA+Q++ E  KY Y   +S+  YGG D+ +QI ++ +  +IV+ TPGR+ DL+ +  +NLK ++YLVLDEADRMLDMGFE Q++ ++  +R  R T+MTSATWP GV+R+A +++K+P+ V VGTLDL A +TV QHV  +   +K   ++  +  +KP+DK+I+FV +K    DL+ +  L+           +    +HG+ +Q +RE AL   + G   I++ATD+ASRGLD+ D+T V+N+DFP+NIEEYVHRVGRTGRAGRTGE+ T + + D   A ELI IL+ A+Q
Sbjct:   94 RSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDLAAVNTVTQHVLVIPEEEKRAFVLHFIDSLKPQDKVIVFVGKKLVADDLSSDFSLQ----------GIPVQSLHGNREQCDREQALDDFKKGNFRILVATDLASRGLDVHDVTHVLNFDFPRNIEEYVHRVGRTGRAGRTGESITLVTRKDWKVAGELISILERANQ 471          

HSP 2 Score: 162.155 bits (409), Expect = 7.679e-60
Identity = 80/186 (43.01%), Postives = 116/186 (62.37%), Query Frame = 2
Query: 2888 LDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
             D  C + N++   D ++       I  P+  FE+ F   PE++  ++   FE PTPIQ   WPVIL G D IGIAQTGTGKTL ++LP  IH++ Q  PR+ + GP +L+L+PTRELA+Q+++E  K KY   +S+C YGG ++  QIN +    +IV+ TPGR+NDL +   +NLK +   + D
Sbjct:   73 FDYSCRKENNNIICDDLK--EEKRSIPNPVPRFEDAFHPFPEVMSALEKSGFERPTPIQSQAWPVILQGIDLIGIAQTGTGKTLAYLLPGFIHLDLQPIPREQQDGPGMLVLAPTRELALQVKAECSKYKYKGFESICIYGGGDRNNQINKVTKGVDIVIATPGRLNDLQMNNFVNLKSITYLVLD 256          

HSP 3 Score: 91.6633 bits (226), Expect = 7.679e-60
Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++YLVLDEADRMLDMGFEPQ++ I+ D R  R +IMTSATWP+ VR++A  Y+ +P+ V VG+LDL
Sbjct:  250 ITYLVLDEADRMLDMGFEPQIMKILIDIRPDRHTIMTSATWPDGVRRLAKSYLKDPMMVYVGTLDL 315          
BLAST of ATP-dependent RNA helicase vs. Ensembl Mouse
Match: Ddx43 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:MGI Symbol;Acc:MGI:3642857])

HSP 1 Score: 394.045 bits (1011), Expect = 2.580e-120
Identity = 212/473 (44.82%), Postives = 311/473 (65.75%), Query Frame = 1
Query:  844 IKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFD-KDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFL 2259
            +K +  K ++  P+ +NFY E  + S M+  + + +  +                  NF  T  D KD E+        + IPNP+  FE++F  +P+++  I++  FQ+P+PIQ  AWPI++ G DLIG+AQTGTGKTL++L+P FIH++ QP  RE+R GP +L+L+PTRELA+Q++ E  KY+Y D+ SV  YGG D+  QI  + +  +I++ TPGR+ DL+ +  +NLK V+YLVLDEAD+MLDMGFE Q++ ++  VR  RQT+MTSATWP+ V+R+A +++K P+ V VGTLDL A  TVKQ++      +K   +   L ++ P+DK+I+FV+RKA    L+ +L L+           +    +HG+ +Q +RE AL+  ++G   I+IATD+ASRGLD+ D+T V NYDFP+NIEEYVHRVGRTGRAGRTG + T + +ND   A ELI IL+ A+Q +P+ L
Sbjct:  179 LKWEKKKWADLPPIKKNFYIESATTSSMSQVQIDNWRKE------------------NFNITCDDLKDGEK--------RPIPNPICKFEDAFQSYPEVMENIKRAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLSYLMPGFIHLDSQPLAREQRNGPGMLVLTPTRELALQVEAECSKYSYGDLKSVCVYGGGDRDGQIQDVSKGVDIIIATPGRLNDLQMNNFVNLKSVTYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTIMTSATWPYAVRRLAQSYLKEPMIVYVGTLDLVAVSTVKQNIIITTEEEKRTHIQTFLENMSPKDKVIVFVSRKAVADHLSSDLILRH----------ISVESLHGNREQSDREKALENFKTGKVRILIATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRNDWRVATELINILERANQNIPEEL 615          

HSP 2 Score: 172.17 bits (435), Expect = 8.277e-63
Identity = 91/228 (39.91%), Postives = 133/228 (58.33%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI +NFY E     ++S  +++++  RK N  I             CD   D       E  P    I  PI  FE+ F  +PE+++ IK   F+ PTPIQ   WP++L G D IG+AQTGTGKTL++++P  IH++ Q   R+ R GP +L+L+PTRELA+Q+E+E  K  Y ++KSVC YGG ++  QI  +    +I++ TPGR+NDL +   +NLK V   + D
Sbjct:  191 PIKKNFYIESATTSSMSQVQIDNW--RKENFNIT------------CDDLKDG------EKRP----IPNPICKFEDAFQSYPEVMENIKRAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLSYLMPGFIHLDSQPLAREQRNGPGMLVLTPTRELALQVEAECSKYSYGDLKSVCVYGGGDRDGQIQDVSKGVDIIIATPGRLNDLQMNNFVNLKSVTYLVLD 394          

HSP 3 Score: 90.8929 bits (224), Expect = 8.277e-63
Identity = 42/68 (61.76%), Postives = 54/68 (79.41%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIV 3678
            V+YLVLDEAD+MLDMGFEPQ++ I+ D R  RQ+IMTSATWP  VR++A  Y+  P+ V VG+LDL+ 
Sbjct:  388 VTYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTIMTSATWPYAVRRLAQSYLKEPMIVYVGTLDLVA 455          
BLAST of ATP-dependent RNA helicase vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 311.997 bits (798), Expect = 3.501e-91
Identity = 181/404 (44.80%), Postives = 252/404 (62.38%), Query Frame = 1
Query: 1081 VIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYT-YHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            V P PV  F  + F    ++  +  Q F EP+PIQC  +P+ ++GRD++GIAQTG+GKTLA+LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q     Y     + S   YGGA K  QI  L+   EI + TPGR+ D  +SG  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +++  Q+NVG L+L+A H + Q V+     +K  +L++++  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD  Q ER+  L   RSG   I+IATDVASRGLD+ D+  VINYD+P + E+YVHR+GRT R+   G A+TF    ++  A ELI++L++A+Q +   L QL+ DH+
Sbjct:   86 VCPKPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLV-DHR 476          

HSP 2 Score: 130.183 bits (326), Expect = 8.371e-49
Identity = 85/228 (37.28%), Postives = 117/228 (51.32%), Query Frame = 2
Query: 2747 DLGIYP-IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            DL   P   +NFY EHP++  L+  EV+  L RK  I ++     P                             KP+ +F    +    ++D++   +F  PTPIQC G+P+ L GRD +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   44 DLSELPKFEKNFYVEHPEVARLTPYEVDE-LRRKKEITVRGGDVCP-----------------------------KPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLR 238          

HSP 3 Score: 86.2705 bits (212), Expect = 8.371e-49
Identity = 42/80 (52.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ +  Q+NVG+L+L      S  HN L
Sbjct:  239 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLEL------SANHNIL 312          
BLAST of ATP-dependent RNA helicase vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 311.997 bits (798), Expect = 3.681e-91
Identity = 181/404 (44.80%), Postives = 252/404 (62.38%), Query Frame = 1
Query: 1081 VIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYT-YHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            V P PV  F  + F    ++  +  Q F EP+PIQC  +P+ ++GRD++GIAQTG+GKTLA+LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q     Y     + S   YGGA K  QI  L+   EI + TPGR+ D  +SG  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +++  Q+NVG L+L+A H + Q V+     +K  +L++++  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD  Q ER+  L   RSG   I+IATDVASRGLD+ D+  VINYD+P + E+YVHR+GRT R+   G A+TF    ++  A ELI++L++A+Q +   L QL+ DH+
Sbjct:   86 VCPKPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLV-DHR 476          

HSP 2 Score: 130.183 bits (326), Expect = 8.371e-49
Identity = 85/228 (37.28%), Postives = 117/228 (51.32%), Query Frame = 2
Query: 2747 DLGIYP-IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            DL   P   +NFY EHP++  L+  EV+  L RK  I ++     P                             KP+ +F    +    ++D++   +F  PTPIQC G+P+ L GRD +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   44 DLSELPKFEKNFYVEHPEVARLTPYEVDE-LRRKKEITVRGGDVCP-----------------------------KPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLR 238          

HSP 3 Score: 86.2705 bits (212), Expect = 8.371e-49
Identity = 42/80 (52.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ +  Q+NVG+L+L      S  HN L
Sbjct:  239 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLEL------SANHNIL 312          
BLAST of ATP-dependent RNA helicase vs. Ensembl Mouse
Match: Ddx5 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:MGI Symbol;Acc:MGI:105037])

HSP 1 Score: 307.76 bits (787), Expect = 3.514e-90
Identity = 183/466 (39.27%), Postives = 274/466 (58.80%), Query Frame = 1
Query:  889 RNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYH-DIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKD 2277
            +NFY+EHP +++ T  E +                            T+ +  E  +     PK    PV NF E+ F   +++  I +Q F EP+ IQ   WP+ ++G D++G+AQTG+GKTL++LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q    +Y     + S   YGGA K  QI  L+   EI + TPGR+ D  + G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K+ + +N+G L+L+A H + Q V+     +K ++L+ ++  I  + E+K I+FV  K +C +L  ++   R  G         A  IHGD  QQER+  L   + G   I+IATDVASRGLD+ D+  VINYD+P + E+Y+HR+GRT R+ +TG A+TF   N++   ++LI +L++A+Q +   L QL++D
Sbjct:   56 KNFYQEHPDLARRTAQEVD----------------------------TYRRSKEITVRGHNCPK----PVLNFYEANFP-ANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPF-LERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKM---RRDGW-------PAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVED 477          

HSP 2 Score: 130.954 bits (328), Expect = 6.426e-49
Identity = 82/229 (35.81%), Postives = 118/229 (51.53%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
              +NFY+EHPD+   + +EV+++  R   I ++               HN                  KP+ +F E  +    ++D+I   NF  PT IQ  GWPV L G D +G+AQTG+GKTL+++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++    +  +   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+     + D
Sbjct:   54 FEKNFYQEHPDLARRTAQEVDTYR-RSKEITVR--------------GHN----------------CPKPVLNFYEANFP-ANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQ--PFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLD 248          

HSP 3 Score: 85.5001 bits (210), Expect = 6.426e-49
Identity = 40/80 (50.00%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ + + +N+G+L+L      S  HN L
Sbjct:  241 RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALEL------SANHNIL 314          
BLAST of ATP-dependent RNA helicase vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 263.462 bits (672), Expect = 4.342e-77
Identity = 161/399 (40.35%), Postives = 222/399 (55.64%), Query Frame = 1
Query:  889 RNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKY-TYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDL 2076
            +NFY EHP V+++T  E ++          K+  +  G   C                        P PV  F  + F    ++  +  Q F EP+PIQC  +P+ ++GRD++GIAQTG+GKTLA+LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q     Y     + S   YGGA K  QI  L+   EI + TPGR+ D  +SG  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +++  Q+NVG L+L+A H + Q V+     +K  +L++++  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD  Q ER+  L   RSG   I+IATDVASRGL  P L
Sbjct:   53 KNFYVEHPEVARLTPYEVDEL-------RRKKEITVRGGDVC------------------------PKPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLGSPAL 408          

HSP 2 Score: 129.028 bits (323), Expect = 1.526e-48
Identity = 85/228 (37.28%), Postives = 117/228 (51.32%), Query Frame = 2
Query: 2747 DLGIYP-IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            DL   P   +NFY EHP++  L+  EV+  L RK  I ++     P                             KP+ +F    +    ++D++   +F  PTPIQC G+P+ L GRD +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   44 DLSELPKFEKNFYVEHPEVARLTPYEVDE-LRRKKEITVRGGDVCP-----------------------------KPVFAFHHANFPQ-YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLR 238          

HSP 3 Score: 86.2705 bits (212), Expect = 1.526e-48
Identity = 42/80 (52.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ +  Q+NVG+L+L      S  HN L
Sbjct:  239 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLEL------SANHNIL 312          
BLAST of ATP-dependent RNA helicase vs. UniProt/SwissProt
Match: sp|Q9NXZ2|DDX43_HUMAN (Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens OX=9606 GN=DDX43 PE=1 SV=2)

HSP 1 Score: 384.03 bits (985), Expect = 6.506e-116
Identity = 214/488 (43.85%), Postives = 313/488 (64.14%), Query Frame = 1
Query:  841 NIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFD-KDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL---MKDHQDYR 2292
             +K + TK ++  P+ +NFY+E  + S M+  E + +  +                  NF  T  D KD E+        + IPNP   F+++F  +P+++  I+K  FQ+P+PIQ  AWPI++ G DLIG+AQTGTGKTL +L+P FIH+  QP  + +R  P +L+L+PTRELA+Q++ E  KY+Y  + SV  YGG ++ +QI +LK+  +I++ TPGR+ DL+ S  +NLK+++YLVLDEAD+MLDMGFE Q++ ++  VR  RQTVMTSATWP  V R+A +++K P+ V VGTLDL A  +VKQ++      +K   +   L  +   DK+I+FV+RKA    L+ +L L          G +    +HGD +Q++RE AL+  ++G   I+IATD+ASRGLD+ D+T V N+DFP+NIEEYVHR+GRTGRAGRTG + T + +ND   A+ELI IL+ A+Q +P+ L  +    K HQ  R
Sbjct:  180 GLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWRKE------------------NFNITWDDLKDGEK--------RPIPNPTCTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLIL----------GNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKR 631          

HSP 2 Score: 160.229 bits (404), Expect = 1.172e-58
Identity = 85/228 (37.28%), Postives = 127/228 (55.70%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI +NFY+E      +S  E +S+  RK N  I                  DD  + +   +P       P  +F++ F  +PE+++ IK   F+ PTPIQ   WP++L G D IG+AQTGTGKTL +++P  IH+  Q   +  R  P +L+L+PTRELA+Q+E E  K  Y  ++SVC YGG  +  QI  L+   +I++ TPGR+NDL +   +NLK++   + D
Sbjct:  193 PIKKNFYKESTATSAMSKVEADSW--RKENFNITW----------------DDLKDGEKRPIP------NPTCTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLD 396          

HSP 3 Score: 91.6633 bits (226), Expect = 1.172e-58
Identity = 42/79 (53.16%), Postives = 58/79 (73.42%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            ++YLVLDEAD+MLDMGFEPQ++ I+ D R  RQ++MTSATWP  V ++A  Y+  P+ V VG+LDL+    SS+  N +
Sbjct:  390 ITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVA--VSSVKQNII 466          
BLAST of ATP-dependent RNA helicase vs. UniProt/SwissProt
Match: sp|Q86TM3|DDX53_HUMAN (Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens OX=9606 GN=DDX53 PE=1 SV=3)

HSP 1 Score: 339.732 bits (870), Expect = 2.633e-100
Identity = 175/407 (43.00%), Postives = 272/407 (66.83%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRIN 2298
            ++IP P   F+++F  +PD+L  I +    +P+PIQ  AWPI++ G DLI +AQTGTGKTL++L+P FIH++ QP  RE+R GP +L+L+PTRELA+ ++ E  KY+Y  + S+  YGG ++  QI  + +  +I++ TPGR+ DL+ +  +NL+ ++YLV+DEAD+MLDM FE Q+  ++  VR  RQTVMTSATWP  V+++AL+++K+P+ V VG L+L A +TVKQ++      +K     E + ++ P DK+I+FV++K    DL+ +  ++           + A  +HG+ +Q ++E A++  +SG   I+I TD+ SRGLD+ D+T V NYDFP+NI+ YVHRVG  GR G+TG + T + + D   A ELI+IL  A+Q VP+ L  +    + Y++N
Sbjct:  214 RLIPKPTCRFKDAFQQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYVGNLNLVAVNTVKQNIIVTTEKEKRALTQEFVENMSPNDKVIMFVSQKHIADDLSSDFNIQ----------GISAESLHGNSEQSDQERAVEDFKSGNIKILITTDIVSRGLDLNDVTHVYNYDFPRNIDVYVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVMA---EQYKLN 607          

HSP 2 Score: 151.754 bits (382), Expect = 1.111e-55
Identity = 82/228 (35.96%), Postives = 125/228 (54.82%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            P+ +NFY E      +S  E++    RK N  I             CD    D    +  ++P      KP   F++ F ++P++L  I  +    PTPIQ   WP+IL G D I +AQTGTGKTL++++P  IH++ Q   R+ R GP +L+L+PTRELA+ +E+E  K  Y  +KS+C YGG  +  QI  +    +I++ TPGR+NDL +   +NL+ +   + D
Sbjct:  173 PVKKNFYIESKATSCMS--EMQVINWRKENFNIT------------CD----DLKSGEKRLIP------KPTCRFKDAFQQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVID 376          

HSP 3 Score: 90.1225 bits (222), Expect = 1.111e-55
Identity = 39/68 (57.35%), Postives = 55/68 (80.88%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIV 3678
            ++YLV+DEAD+MLDM FEPQ+  I+ D R  RQ++MTSATWP+ VRQ+AL Y+ +P+ V VG+L+L+ 
Sbjct:  370 ITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYVGNLNLVA 437          
BLAST of ATP-dependent RNA helicase vs. UniProt/SwissProt
Match: sp|Q755N4|DBP2_ASHGO (ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DBP2 PE=3 SV=2)

HSP 1 Score: 336.65 bits (862), Expect = 3.969e-100
Identity = 201/460 (43.70%), Postives = 279/460 (60.65%), Query Frame = 1
Query:  889 RNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQP--KPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEIL--AHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVP 2250
            +NFY EH  V KM+ DE E+F                             K+ E  I    +   +P P+R F+E+ F  P+ +L E++++ F++P+ IQC  WP+ ++GRD+IG+A TG+GKTL++ LP  +HI  QP   P +   GP VL+L+PTRELA+QIQ E  K+     I +   YGG  K  QI  L+   EI++ TPGR+ D+ + G  NLK V+YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  VQ++A  ++ +P+QVN+G+L+L A HT+ Q VE V   DK  RLV+ L  A    + KIIIF + K  C ++   L   R  G         A  IHGD  QQER+  L   R+G   IM+ATDVA+RG+D+  +  VINYD P NIE+YVHR+GRTGRAG TG A +F  + + +  A+LI I+++A QE+P
Sbjct:   76 KNFYVEHEDVQKMSTDEVEQF----------------------------RKENEMKI----VGHDVPKPIRTFDEAGF--PEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSPGD---GPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQLVEVVSDFDKRDRLVKHLEIASKDKDSKIIIFASTKRTCDEITSYL---RQDGW-------PALAIHGDKQQQERDWVLNEFRTGRSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEANKTLGAQLISIMREAKQEIP 488          

HSP 2 Score: 150.984 bits (380), Expect = 1.228e-36
Identity = 93/231 (40.26%), Postives = 129/231 (55.84%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQ--MKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
              +NFY EH D++ +S +EVE F  RK N    E+K            H+                + KPIR+F+E  +  PE +L  +K   FE PT IQC GWP+ L GRD IG+A TG+GKTL++ LP ++HI  Q  + P     GP VL+L+PTRELA+QI+ E  K  +   I++ C YGG  K  QI  L+   EI++ TPGR+ D++ +G  NLK V   + D
Sbjct:   74 FEKNFYVEHEDVQKMSTDEVEQF--RKEN----EMKIVG---------HD----------------VPKPIRTFDEAGF--PEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSPGD---GPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLD 268          

HSP 3 Score: 95.5153 bits (236), Expect = 1.082e-18
Identity = 43/78 (55.13%), Postives = 60/78 (76.92%), Query Frame = 1
Query: 3448 EVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            E+    + +V+YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ V+Q+A  Y+ +P+QVN+GSL+L  S
Sbjct:  253 EIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAAS 330          
BLAST of ATP-dependent RNA helicase vs. UniProt/SwissProt
Match: sp|P0CQ76|DBP2_CRYNJ (ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=DBP2 PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 1.134e-99
Identity = 193/402 (48.01%), Postives = 261/402 (64.93%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQP--KPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPED-KIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            K +P P+  FEE+ F  PD I++EIR+  F  PS IQC AWP+ ++GRDL+ IA+TG+GKT++F LPA +HI  QP   P +   GP VLIL+PTRELA+QIQ E  K+     I +   YGGA K  QI  L+   EI V TPGR+ D+ ++G  NLK V+YLV+DEADRMLDMGFE Q+  ++  +R  RQT++ SATWP  VQR+A+  + + +QVN+G+LDL A H V QHVE     DK  +L+  L  I  E+ K++IFVA K    DL    FL+             A  IHGD  Q ER+  L   +SG   IM+ATDVASRGLD+ D+  VINYDFP N E+Y+HR+GRTGRAGR G ++T+   ++   A EL++IL+++  ++P  L ++
Sbjct:  103 KNVPRPITTFEEAGF--PDYIMSEIRRMGFTAPSSIQCQAWPMALSGRDLVAIAETGSGKTISFCLPAMVHINAQPLLAPGD---GPIVLILAPTRELAVQIQTEATKFGQSSRIRNTAIYGGAPKGPQIRDLQRGVEICVATPGRLIDMLETGKTNLKRVTYLVMDEADRMLDMGFEPQIRKIVSQIRPDRQTLLFSATWPKEVQRLAMDFLHDFIQVNIGSLDLTANHNVAQHVEVCTDFDKRSKLLSHLEKISQENGKVLIFVATKRVADDLT--KFLRMD--------GWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATDVASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKAARELVQILRESKADIPPELEEM 489          

HSP 2 Score: 133.265 bits (334), Expect = 3.521e-49
Identity = 86/239 (35.98%), Postives = 123/239 (51.46%), Query Frame = 2
Query: 2741 YTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQ--MKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            + +  +    +NFY + P +   S  EVE+F  R    M  + K  P                             +PI +FEE  +  P+ I+  I+ + F  P+ IQC  WP+ L GRD + IA+TG+GKT++F LPA++HI  Q  + P     GP VLIL+PTRELA+QI++E  K  +   I++   YGGA K  QI  L+   EI V TPGR+ D++  G  NLK V   + D
Sbjct:   62 WQNQSLAKFEKNFYVQDPRVTARSDAEVEAF--RAEKEMKIQGKNVP-----------------------------RPITTFEEAGF--PDYIMSEIRRMGFTAPSSIQCQAWPMALSGRDLVAIAETGSGKTISFCLPAMVHINAQPLLAPGD---GPIVLILAPTRELAVQIQTEATKFGQSSRIRNTAIYGGAPKGPQIRDLQRGVEICVATPGRLIDMLETGKTNLKRVTYLVMD 264          

HSP 3 Score: 86.6557 bits (213), Expect = 3.521e-49
Identity = 37/70 (52.86%), Postives = 57/70 (81.43%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            +V+YLV+DEADRMLDMGFEPQ+  I++  R  RQ+++ SATWP+ V+++A+ ++ + +QVN+GSLDL  +
Sbjct:  257 RVTYLVMDEADRMLDMGFEPQIRKIVSQIRPDRQTLLFSATWPKEVQRLAMDFLHDFIQVNIGSLDLTAN 326          
BLAST of ATP-dependent RNA helicase vs. UniProt/SwissProt
Match: sp|P0CQ77|DBP2_CRYNB (ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=DBP2 PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 1.134e-99
Identity = 193/402 (48.01%), Postives = 261/402 (64.93%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQP--KPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPED-KIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            K +P P+  FEE+ F  PD I++EIR+  F  PS IQC AWP+ ++GRDL+ IA+TG+GKT++F LPA +HI  QP   P +   GP VLIL+PTRELA+QIQ E  K+     I +   YGGA K  QI  L+   EI V TPGR+ D+ ++G  NLK V+YLV+DEADRMLDMGFE Q+  ++  +R  RQT++ SATWP  VQR+A+  + + +QVN+G+LDL A H V QHVE     DK  +L+  L  I  E+ K++IFVA K    DL    FL+             A  IHGD  Q ER+  L   +SG   IM+ATDVASRGLD+ D+  VINYDFP N E+Y+HR+GRTGRAGR G ++T+   ++   A EL++IL+++  ++P  L ++
Sbjct:  103 KNVPRPITTFEEAGF--PDYIMSEIRRMGFTAPSSIQCQAWPMALSGRDLVAIAETGSGKTISFCLPAMVHINAQPLLAPGD---GPIVLILAPTRELAVQIQTEATKFGQSSRIRNTAIYGGAPKGPQIRDLQRGVEICVATPGRLIDMLETGKTNLKRVTYLVMDEADRMLDMGFEPQIRKIVSQIRPDRQTLLFSATWPKEVQRLAMDFLHDFIQVNIGSLDLTANHNVAQHVEVCTDFDKRSKLLSHLEKISQENGKVLIFVATKRVADDLT--KFLRMD--------GWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATDVASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKAARELVQILRESKADIPPELEEM 489          

HSP 2 Score: 133.265 bits (334), Expect = 3.521e-49
Identity = 86/239 (35.98%), Postives = 123/239 (51.46%), Query Frame = 2
Query: 2741 YTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQ--MKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            + +  +    +NFY + P +   S  EVE+F  R    M  + K  P                             +PI +FEE  +  P+ I+  I+ + F  P+ IQC  WP+ L GRD + IA+TG+GKT++F LPA++HI  Q  + P     GP VLIL+PTRELA+QI++E  K  +   I++   YGGA K  QI  L+   EI V TPGR+ D++  G  NLK V   + D
Sbjct:   62 WQNQSLAKFEKNFYVQDPRVTARSDAEVEAF--RAEKEMKIQGKNVP-----------------------------RPITTFEEAGF--PDYIMSEIRRMGFTAPSSIQCQAWPMALSGRDLVAIAETGSGKTISFCLPAMVHINAQPLLAPGD---GPIVLILAPTRELAVQIQTEATKFGQSSRIRNTAIYGGAPKGPQIRDLQRGVEICVATPGRLIDMLETGKTNLKRVTYLVMD 264          

HSP 3 Score: 86.6557 bits (213), Expect = 3.521e-49
Identity = 37/70 (52.86%), Postives = 57/70 (81.43%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            +V+YLV+DEADRMLDMGFEPQ+  I++  R  RQ+++ SATWP+ V+++A+ ++ + +QVN+GSLDL  +
Sbjct:  257 RVTYLVMDEADRMLDMGFEPQIRKIVSQIRPDRQTLLFSATWPKEVQRLAMDFLHDFIQVNIGSLDLTAN 326          
BLAST of ATP-dependent RNA helicase vs. TrEMBL
Match: A0A1B6GVC3 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.12726 PE=3 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 1.595e-140
Identity = 248/475 (52.21%), Postives = 326/475 (68.63%), Query Frame = 1
Query:  880 PVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL------MKDHQD 2286
            P+ + FY+E P V  M  +  ++F L+K NI++     E GE+                         IPNPV  FE++F  +PDIL  I  Q F EPSPIQC AWPIL++G+DLIGIAQTGTGKTLAFLLPAFIHIEGQP PR +R GP VLIL+PTRELA QIQ E  KY+Y  I S+  YGG D+R+QI  L++  EI+V TPGR+ DL  +G +NL  V+YLVLDEADRMLDMGFE ++   +  +R  RQTVMTSATWP GV+R+A ++M+NP+QV VG+LDL A HTV Q +E +D  +K  +L+E   ++ PEDK+++FV +K++  D++ EL LK          ++    IHGD +Q +RE AL  ++SG   I+IATDVASRG+DI D+T +INYDFP+NIEEYVHRVGRTGRAGRTGEA +F+ + D + A ELI +L++A+Q VP+ L Q+      MK+ +D
Sbjct:   27 PIVKEFYKEDPQVKNMDSEMVKQFRLEKKNIVVSHTFGECGEA-------------------------IPNPVITFEQAFAPYPDILELIYNQNFTEPSPIQCQAWPILLSGKDLIGIAQTGTGKTLAFLLPAFIHIEGQPVPRSQRGGPNVLILAPTRELAQQIQMEANKYSYRGIKSICIYGGGDRREQINSLRQGVEIIVATPGRMNDLIQAGEINLNAVTYLVLDEADRMLDMGFEPEIRKTLLDIRPDRQTVMTSATWPPGVRRLAQSYMQNPIQVYVGSLDLAATHTVTQTIEIIDEDEKDNKLMEFFCNMAPEDKVMVFVGKKSRADDISSELALK----------SIICDVIHGDREQCDREKALYDLKSGEIRILIATDVASRGIDIQDITHIINYDFPRNIEEYVHRVGRTGRAGRTGEAISFVTRQDWAQARELIAMLEEANQIVPEELYQMADRFEAMKEKRD 466          

HSP 2 Score: 206.838 bits (525), Expect = 1.296e-71
Identity = 108/228 (47.37%), Postives = 140/228 (61.40%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI + FY+E P ++N+  E V+ F L K NI++    TF      +C +                  I  P+ +FE+ F  +P+IL++I   NF  P+PIQC  WP++L G+D IGIAQTGTGKTL F+LPA IHIEGQ  PR  R GP VLIL+PTRELA QI+ E  K  Y  IKS+C YGG ++  QINSLR   EI+V TPGR+NDL+  G +NL  V   + D
Sbjct:   27 PIVKEFYKEDPQVKNMDSEMVKQFRLEKKNIVVSH--TFG-----ECGE-----------------AIPNPVITFEQAFAPYPDILELIYNQNFTEPSPIQCQAWPILLSGKDLIGIAQTGTGKTLAFLLPAFIHIEGQPVPRSQRGGPNVLILAPTRELAQQIQMEANKYSYRGIKSICIYGGGDRREQINSLRQGVEIIVATPGRMNDLIQAGEINLNAVTYLVLD 230          

HSP 3 Score: 96.2857 bits (238), Expect = 1.296e-71
Identity = 44/69 (63.77%), Postives = 54/69 (78.26%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            V+YLVLDEADRMLDMGFEP++   + D R  RQ++MTSATWP  VR++A  YM NP+QV VGSLDL  +
Sbjct:  224 VTYLVLDEADRMLDMGFEPEIRKTLLDIRPDRQTVMTSATWPPGVRRLAQSYMQNPIQVYVGSLDLAAT 292          
BLAST of ATP-dependent RNA helicase vs. TrEMBL
Match: A0A1B6L5T6 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.5971 PE=3 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.673e-140
Identity = 253/483 (52.38%), Postives = 329/483 (68.12%), Query Frame = 1
Query:  859 TKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACE-IHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL------MKDHQD 2286
             K S   PV + FY E P V  M  +  ++F LDK NI++     E GE+                         IPNPV  FE++F  +PDIL  I  QKF EPSPIQC AWPIL+ G+DLIGIAQTGTGKTLAFLLPAFIHIEGQP PR +R GP VLIL+PTRELA QIQ E  KY+Y  I S+  YGG D+R+QI  L++  EI+V TPGR+ DL  +G +NL  V+YLVLDEADRMLDMGFE ++   +  +R  RQT+MTSATWP GV+R+A ++M+NP+QV VG+LDL A HTV Q +E +D  +K  RL+E   ++ PEDK+++FV +K++  D++ EL L   KG++        C+ IHGD +Q +RE AL  ++SG   I+IATDVASRG+DI D+T +INYDFP+NIEEYVHRVGRTGRAGRTGEA + + + D + A ELI +L++A+Q +P+ L Q+      MK+ +D
Sbjct:   51 AKWSQCPPVIKEFYEEDPQVKNMHPEMVKQFRLDKKNIVVNYTFGECGET-------------------------IPNPVMTFEQAFAPYPDILQLIYNQKFTEPSPIQCQAWPILLGGKDLIGIAQTGTGKTLAFLLPAFIHIEGQPVPRSQRGGPNVLILAPTRELAQQIQMEANKYSYRGIKSICIYGGGDRREQINSLRQGVEIIVATPGRMNDLIQAGEINLNAVTYLVLDEADRMLDMGFEPEIRKTLLDIRPDRQTIMTSATWPPGVRRLAQSYMQNPIQVYVGSLDLAATHTVTQTIEIIDEGEKEDRLMEFFCNMAPEDKVMVFVGKKSRADDISSELAL---KGIV--------CDVIHGDREQCDREKALYDLKSGEIRILIATDVASRGIDIQDITHIINYDFPRNIEEYVHRVGRTGRAGRTGEAISLVTRQDWAQARELIGMLEEANQIIPEELYQMADRFEAMKEKKD 497          

HSP 2 Score: 204.527 bits (519), Expect = 3.096e-71
Identity = 108/228 (47.37%), Postives = 139/228 (60.96%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            P+ + FYEE P ++N+  E V+ F L K NI++    TF      +C +                  I  P+ +FE+ F  +P+IL +I    F  P+PIQC  WP++LGG+D IGIAQTGTGKTL F+LPA IHIEGQ  PR  R GP VLIL+PTRELA QI+ E  K  Y  IKS+C YGG ++  QINSLR   EI+V TPGR+NDL+  G +NL  V   + D
Sbjct:   58 PVIKEFYEEDPQVKNMHPEMVKQFRLDKKNIVVN--YTFG-----ECGET-----------------IPNPVMTFEQAFAPYPDILQLIYNQKFTEPSPIQCQAWPILLGGKDLIGIAQTGTGKTLAFLLPAFIHIEGQPVPRSQRGGPNVLILAPTRELAQQIQMEANKYSYRGIKSICIYGGGDRREQINSLRQGVEIIVATPGRMNDLIQAGEINLNAVTYLVLD 261          

HSP 3 Score: 97.4413 bits (241), Expect = 3.096e-71
Identity = 45/69 (65.22%), Postives = 54/69 (78.26%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            V+YLVLDEADRMLDMGFEP++   + D R  RQ+IMTSATWP  VR++A  YM NP+QV VGSLDL  +
Sbjct:  255 VTYLVLDEADRMLDMGFEPEIRKTLLDIRPDRQTIMTSATWPPGVRRLAQSYMQNPIQVYVGSLDLAAT 323          
BLAST of ATP-dependent RNA helicase vs. TrEMBL
Match: A0A087ZUZ1 (Uncharacterized protein OS=Apis mellifera OX=7460 GN=LOC411450 PE=3 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 9.899e-140
Identity = 244/477 (51.15%), Postives = 331/477 (69.39%), Query Frame = 1
Query:  862 KDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYR 2292
            K S F P+ +NFY+EHP+V+ MT ++        NNI +K +  E G +                +D +     IPNP+  FE++F  +P+IL EIRKQKF +PSPIQ  AWPIL++GRDLIGIAQTGTGKTLAFLLPA IHIEGQ  PR +R+GP VLI++PTRELA+QI+ EV KY+YH I +V  YGG  ++ Q+  + E  EIV+ TPGR+ DL ++ +LN+  ++YLVLDEADRMLDMGFE Q+   +  +R  RQTVMTSATWP GV+R+A ++MKNP+QV VG+LDL   HTV Q V  VD  +KT  + E    + P DK+IIF  +K +  D+A +L L+          +V    IHG  +Q +RE AL+ +++G   I++ATDVASRG+DI D+T V+NYDFP++IEEYVHRVGRTGRAGR+GE+ TFM + D ++A +LI IL++A+QEVP+ L Q+ + H+ ++
Sbjct:  154 KWSKFAPIIKNFYKEHPTVTAMTKEQVAHIRKTNNNIEVKHVFEEQGNN----------------VDLLK----IPNPIETFEQAFEIYPEILDEIRKQKFVKPSPIQSQAWPILLSGRDLIGIAQTGTGKTLAFLLPALIHIEGQQIPRVERKGPNVLIMAPTRELALQIEKEVNKYSYHGIKAVCLYGGGSRKKQVNVVTEGVEIVIATPGRLNDLVEAKILNISSITYLVLDEADRMLDMGFEPQIRKTLLDIRPDRQTVMTSATWPQGVRRLAQSYMKNPIQVFVGSLDLATVHTVMQKVYIVDEEEKTDMMYEFFRKMSPNDKVIIFFGKKTKVDDVASDLALQ----------SVNCQSIHGGREQSDREQALEDLKTGEVQILLATDVASRGIDIEDITHVLNYDFPRDIEEYVHRVGRTGRAGRSGESITFMTRKDWTHAKDLINILEEANQEVPEELYQMAERHKAWK 600          

HSP 2 Score: 206.453 bits (524), Expect = 3.447e-52
Identity = 108/230 (46.96%), Postives = 142/230 (61.74%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDE--DQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI +NFY+EHP +  ++ E+V       NNI +K +                 F+E  + V++L     I  PI +FE+ F  +PEILD I+   F  P+PIQ   WP++L GRD IGIAQTGTGKTL F+LPALIHIEGQ  PR  R GP VLI++PTRELA+QIE E+ K  YH IK+VC YGG  +  Q+N + +  EIV+ TPGR+NDLV    LN+  +   + D
Sbjct:  160 PIIKNFYKEHPTVTAMTKEQVAHIRKTNNNIEVKHV-----------------FEEQGNNVDLLK----IPNPIETFEQAFEIYPEILDEIRKQKFVKPSPIQSQAWPILLSGRDLIGIAQTGTGKTLAFLLPALIHIEGQQIPRVERKGPNVLIMAPTRELALQIEKEVNKYSYHGIKAVCLYGGGSRKKQVNVVTEGVEIVIATPGRLNDLVEAKILNISSITYLVLD 368          

HSP 3 Score: 102.449 bits (254), Expect = 3.004e-18
Identity = 47/75 (62.67%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 3448 EVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            E  +L I  ++YLVLDEADRMLDMGFEPQ+   + D R  RQ++MTSATWP+ VR++A  YM NP+QV VGSLDL
Sbjct:  353 EAKILNISSITYLVLDEADRMLDMGFEPQIRKTLLDIRPDRQTVMTSATWPQGVRRLAQSYMKNPIQVFVGSLDL 427          
BLAST of ATP-dependent RNA helicase vs. TrEMBL
Match: A0A2A3E7G4 (ATP-dependent RNA helicase OS=Apis cerana cerana OX=94128 GN=APICC_00802 PE=3 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 4.571e-139
Identity = 241/477 (50.52%), Postives = 328/477 (68.76%), Query Frame = 1
Query:  862 KDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYR 2292
            K S F P+ +NFY+EHP+V+ MT ++         +I       E    F   G+   D     L+        IPNP+  FE++F  +P+IL EI+KQKF +PSPIQ  AWPIL++GRDLIGIAQTGTGKTLAFLLPA IHIEGQ  PR +R+GP VLI++PTRELA+QI+ EV KY+YH I +V  YGG  ++ Q+  + E  EIV+ TPGR+ DL ++ +LN+  ++YLVLDEADRMLDMGFE Q+   +  +R  RQTVMTSATWP GV+R+A ++MK+P+QV VG+LDL   HTV Q V  VD  +KT  + E    + P DK+IIF  +K +  D+A +L L+          +V    IHG  +Q +RE AL+ +++G   I++ATDVASRG+DI D+T V+NYDFP++IEEYVHRVGRTGRAGR+GE+ TFM + D ++A +LI IL++A+QEVP+ L Q+ + H+ ++
Sbjct:  154 KWSKFPPIIKNFYKEHPTVTAMTKEQ-------VAHIRKTNNNIEVKHVFEEKGNNNVD-----LLK-------IPNPIETFEQAFEVYPEILDEIKKQKFVKPSPIQSQAWPILLSGRDLIGIAQTGTGKTLAFLLPALIHIEGQQTPRVERKGPNVLIMAPTRELALQIEKEVNKYSYHGIKAVCLYGGGSRKKQVNVVTEGVEIVIATPGRLNDLVEAKILNISSITYLVLDEADRMLDMGFEPQIRKTLLDIRPDRQTVMTSATWPQGVRRLAQSYMKHPIQVFVGSLDLATVHTVMQKVYIVDEEEKTDMMYEFFRKMTPNDKVIIFFGKKTKVDDVASDLALQ----------SVNCQSIHGGREQSDREQALEDLKTGEVQILLATDVASRGIDIEDITHVLNYDFPRDIEEYVHRVGRTGRAGRSGESITFMTRKDWTHAKDLINILEEANQEVPEELYQMAERHKAWK 601          

HSP 2 Score: 208.764 bits (530), Expect = 5.824e-53
Identity = 109/231 (47.19%), Postives = 142/231 (61.47%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDE---DQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI +NFY+EHP +  ++ E+V       NNI +K +                 F+E   + V++L     I  PI +FE+ F  +PEILD IK   F  P+PIQ   WP++L GRD IGIAQTGTGKTL F+LPALIHIEGQ  PR  R GP VLI++PTRELA+QIE E+ K  YH IK+VC YGG  +  Q+N + +  EIV+ TPGR+NDLV    LN+  +   + D
Sbjct:  160 PIIKNFYKEHPTVTAMTKEQVAHIRKTNNNIEVKHV-----------------FEEKGNNNVDLLK----IPNPIETFEQAFEVYPEILDEIKKQKFVKPSPIQSQAWPILLSGRDLIGIAQTGTGKTLAFLLPALIHIEGQQTPRVERKGPNVLIMAPTRELALQIEKEVNKYSYHGIKAVCLYGGGSRKKQVNVVTEGVEIVIATPGRLNDLVEAKILNISSITYLVLD 369          

HSP 3 Score: 100.908 bits (250), Expect = 1.102e-17
Identity = 46/75 (61.33%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 3448 EVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            E  +L I  ++YLVLDEADRMLDMGFEPQ+   + D R  RQ++MTSATWP+ VR++A  YM +P+QV VGSLDL
Sbjct:  354 EAKILNISSITYLVLDEADRMLDMGFEPQIRKTLLDIRPDRQTVMTSATWPQGVRRLAQSYMKHPIQVFVGSLDL 428          
BLAST of ATP-dependent RNA helicase vs. TrEMBL
Match: A0A0L7QSF0 (Putative ATP-dependent RNA helicase DDX43 OS=Habropoda laboriosa OX=597456 GN=WH47_06660 PE=3 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.557e-137
Identity = 235/467 (50.32%), Postives = 317/467 (67.88%), Query Frame = 1
Query:  862 KDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEI---PIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPD 2253
            K S   PV +NFY+EHP+V+ MT                        E   N   T  + + + + DE         IPNP+  FE++F   P+IL EIRKQ+F +PSPIQC AWPIL++G+DLIGIAQTGTGKTLAFLLPA IHIEGQP PR +R GP VL+++PTRELA+QI+ EV KY+YH   +V  YGG  +++Q+  + +  EIV+ TPGR+ DL +S +LNL  ++YLVLDEADRMLDMGFE Q+   +  +R  RQTVMTSATWP GV+R+A ++MKNP+QV VG+LDL   HTV Q +  ++  +KT  + +    + P DK+++F  +K++  D+A +L L+           V    IHG  +Q +RE AL+ +++G   I++ATDVASRG+DI D+T V+NYDFP++IEEYVHRVGRTGRAGRTGE+ TFM + D S+A ELI IL++A+QEVP+
Sbjct:  155 KWSKCVPVIKNFYKEHPAVANMT-----------------------KEQVANIRKTNNNIEVKYMFDEQGNDTEQSSIPNPIETFEQAFEIFPEILEEIRKQRFTKPSPIQCQAWPILLSGQDLIGIAQTGTGKTLAFLLPALIHIEGQPIPRSERNGPNVLVMAPTRELALQIEKEVNKYSYHGFKAVCLYGGGSRKEQVNVVTKGVEIVIATPGRLNDLVESNILNLNSITYLVLDEADRMLDMGFEPQIRKTLLDIRPDRQTVMTSATWPQGVRRLAQSYMKNPIQVFVGSLDLATVHTVLQKIYIIEETEKTDMMYQFFREMAPTDKVMVFFGKKSRVDDIASDLALQ----------GVNCQSIHGGREQCDREQALEDLKTGEVQILLATDVASRGIDIEDITHVLNYDFPRDIEEYVHRVGRTGRAGRTGESITFMTRRDWSHAKELINILEEANQEVPE 588          

HSP 2 Score: 208.379 bits (529), Expect = 9.190e-53
Identity = 104/228 (45.61%), Postives = 140/228 (61.40%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            P+ +NFY+EHP + N++ E+V +     NNI +K +           D+  +D ++           I  PI +FE+ F   PEIL+ I+   F  P+PIQC  WP++L G+D IGIAQTGTGKTL F+LPALIHIEGQ  PR  R GP VL+++PTRELA+QIE E+ K  YH  K+VC YGG  +  Q+N +    EIV+ TPGR+NDLV    LNL  +   + D
Sbjct:  161 PVIKNFYKEHPAVANMTKEQVANIRKTNNNIEVKYM----------FDEQGNDTEQ---------SSIPNPIETFEQAFEIFPEILEEIRKQRFTKPSPIQCQAWPILLSGQDLIGIAQTGTGKTLAFLLPALIHIEGQPIPRSERNGPNVLVMAPTRELALQIEKEVNKYSYHGFKAVCLYGGGSRKEQVNVVTKGVEIVIATPGRLNDLVESNILNLNSITYLVLD 369          

HSP 3 Score: 101.293 bits (251), Expect = 6.889e-18
Identity = 46/75 (61.33%), Postives = 59/75 (78.67%), Query Frame = 1
Query: 3448 EVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            E ++L +  ++YLVLDEADRMLDMGFEPQ+   + D R  RQ++MTSATWP+ VR++A  YM NP+QV VGSLDL
Sbjct:  354 ESNILNLNSITYLVLDEADRMLDMGFEPQIRKTLLDIRPDRQTVMTSATWPQGVRRLAQSYMKNPIQVFVGSLDL 428          
BLAST of ATP-dependent RNA helicase vs. Ensembl Cavefish
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:103021425])

HSP 1 Score: 396.741 bits (1018), Expect = 1.708e-120
Identity = 206/403 (51.12%), Postives = 285/403 (70.72%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQD 2286
            +VIP PV  F E+F  +P+I+  I +  FQ+P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++ QP PR K+ GP +L+L+PTRELA+QI+ E  KY+Y    S+  YGG D+R QI  +    +IV+ TPGR+ DL+ + ++NL+ ++YLVLDEADRMLDMGFE Q++ +I  +R  RQTVMTSATWP GV+R+A +++K+P+ V VGTLDL A +TV+Q V +V   +K   + + + +++P DK++IFV +K    DL+ +L L+           +    +HGD +Q +RE AL+  + G   I++ATD+ASRGLD+ D+T V NYDFP+NIEEYVHRVGRTGRAGR+G + T + + D   AAELI IL+ A QEVPD L  LM +  D
Sbjct:  277 RVIPYPVYTFLEAFQHYPEIMENIHRVGFQKPTPIQSQAWPVVLKGLDLIGIAQTGTGKTLAYLLPGFIHMDEQPVPRNKQSGPGMLVLTPTRELALQIEVECNKYSYKGFKSICVYGGGDRRAQIKMVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPAGVRRLARSYLKDPMMVYVGTLDLAAVNTVQQTVLFVQEEEKKAYVFDFIHNMEPLDKVLIFVGKKIVADDLSSDLCLR----------GIAVQSLHGDREQCDREEALQDFKDGRVRILVATDLASRGLDVHDITHVFNYDFPRNIEEYVHRVGRTGRAGRSGASVTLITRGDWKWAAELIHILERAGQEVPDEL-VLMAERYD 668          

HSP 2 Score: 174.481 bits (441), Expect = 2.632e-44
Identity = 91/228 (39.91%), Postives = 128/228 (56.14%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            P+ +NFY E   +   S EE+  +    NNI +                  DD  E +  V+P       P+ +F E F  +PEI++ I  + F+ PTPIQ   WPV+L G D IGIAQTGTGKTL ++LP  IH++ Q  PR  + GP +L+L+PTRELA+QIE E  K  Y   KS+C YGG ++  QI  +    +IV+ TPGR+NDL +   +NL+ +   + D
Sbjct:  236 PLKKNFYIEDEAVARRSAEEITVWRKENNNIFV------------------DDLKEGEKRVIP------YPVYTFLEAFQHYPEIMENIHRVGFQKPTPIQSQAWPVVLKGLDLIGIAQTGTGKTLAYLLPGFIHMDEQPVPRNKQSGPGMLVLTPTRELALQIEVECNKYSYKGFKSICVYGGGDRRAQIKMVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLD 439          

HSP 3 Score: 95.9005 bits (237), Expect = 1.597e-19
Identity = 43/73 (58.90%), Postives = 58/73 (79.45%), Query Frame = 1
Query: 3454 DLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            +L+ +  ++YLVLDEADRMLDMGFEPQ++ II D R  RQ++MTSATWP  VR++A  Y+ +P+ V VG+LDL
Sbjct:  426 ELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPAGVRRLARSYLKDPMMVYVGTLDL 498          
BLAST of ATP-dependent RNA helicase vs. Ensembl Cavefish
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:103021425])

HSP 1 Score: 329.331 bits (843), Expect = 7.081e-98
Identity = 163/350 (46.57%), Postives = 228/350 (65.14%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVH 2127
            +VIP PV  F E+F  +P+I+  I +  FQ+P+PIQ  AWP+++ G DLIGIAQTGTGKTLA+LLP FIH++ QP PR K+ GP +L+L+PTRELA+QI+ E  KY+Y    S+  YGG D+R QI  +    +IV+ TPGR+ DL+ + ++NL+ ++YLVLDEADRMLDMGFE Q++ +I  +R  RQTVMTSATWP GV+R+A +++K+P+ V VGTLDL     +   + + ++                         R     DL+ +L L+           +    +HGD +Q +RE AL+  + G   I++ATD+ASRGLD+ D+T V NYDFP+NIEEYVH
Sbjct:  245 RVIPYPVYTFLEAFQHYPEIMENIHRVGFQKPTPIQSQAWPVVLKGLDLIGIAQTGTGKTLAYLLPGFIHMDEQPVPRNKQSGPGMLVLTPTRELALQIEVECNKYSYKGFKSICVYGGGDRRAQIKMVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPAGVRRLARSYLKDPMMVYVGTLDLAVSWDMFNVLSWENF------------------------LRPLMADDLSSDLCLR----------GIAVQSLHGDREQCDREEALQDFKDGRVRILVATDLASRGLDVHDITHVFNYDFPRNIEEYVH 560          

HSP 2 Score: 173.711 bits (439), Expect = 8.025e-45
Identity = 91/228 (39.91%), Postives = 128/228 (56.14%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            P+ +NFY E   +   S EE+  +    NNI +                  DD  E +  V+P       P+ +F E F  +PEI++ I  + F+ PTPIQ   WPV+L G D IGIAQTGTGKTL ++LP  IH++ Q  PR  + GP +L+L+PTRELA+QIE E  K  Y   KS+C YGG ++  QI  +    +IV+ TPGR+NDL +   +NL+ +   + D
Sbjct:  204 PLKKNFYIEDEAVARRSAEEITVWRKENNNIFV------------------DDLKEGEKRVIP------YPVYTFLEAFQHYPEIMENIHRVGFQKPTPIQSQAWPVVLKGLDLIGIAQTGTGKTLAYLLPGFIHMDEQPVPRNKQSGPGMLVLTPTRELALQIEVECNKYSYKGFKSICVYGGGDRRAQIKMVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLD 407          

HSP 3 Score: 97.4413 bits (241), Expect = 4.063e-20
Identity = 49/93 (52.69%), Postives = 70/93 (75.27%), Query Frame = 1
Query: 3454 DLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS--LYSSL-YHNFLSDII 3723
            +L+ +  ++YLVLDEADRMLDMGFEPQ++ II D R  RQ++MTSATWP  VR++A  Y+ +P+ V VG+LDL VS  +++ L + NFL  ++
Sbjct:  394 ELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPAGVRRLARSYLKDPMMVYVGTLDLAVSWDMFNVLSWENFLRPLM 486          
BLAST of ATP-dependent RNA helicase vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 317.39 bits (812), Expect = 1.620e-93
Identity = 192/467 (41.11%), Postives = 274/467 (58.67%), Query Frame = 1
Query:  889 RNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTE-IRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKD 2277
            +NFY+EHP +++ ++ E E++   K                     T   +D              P PV  F E+ F  P+ + E I KQ + EP+PIQ   WP+ ++G+D++GIAQTG+GKTLA+LLPA +HI  QP   E   GP  L+L+PTRELA Q+Q    +Y     + S   YGGA K  QI  L+   EI + TPGR+ D  ++G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K  VQ+N+G L L+A H + Q V+  +  +K  +L+ +L  I  + E+K IIFV  K +C +L   +   R  G         A  IHGD  QQER+  L   + G   I+IATDVASRGLD+ D+  VINYD+P + E+Y+HR+GRT R+ +TG A+TF   N+M  A +LI +L++A+Q +   L Q+ +D
Sbjct:   56 KNFYKEHPDITRRSMQEVEQYRRAKEV-------------------TVKGRD-------------CPKPVMKFNEATF--PNYVMEVINKQAWSEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPF-LEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALQLSANHNILQIVDVCNDGEKDDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRM---RRDGW-------PAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQANDLISVLREANQAINPKLLQMAED 477          

HSP 2 Score: 136.732 bits (343), Expect = 5.279e-51
Identity = 80/220 (36.36%), Postives = 116/220 (52.73%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY+EHPDI   S++EVE +  R   + +K           DC                      KP+  F E  + +  ++++I    +  PTPIQ  GWP+ L G+D +GIAQTG+GKTL ++LPA++HI  Q    ++  GP  L+L+PTRELA Q++    +  +   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   54 FEKNFYKEHPDITRRSMQEVEQY-RRAKEVTVK---------GRDC---------------------PKPVMKFNEATFPN-YVMEVINKQAWSEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQ-PFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLR 240          

HSP 3 Score: 87.0409 bits (214), Expect = 5.279e-51
Identity = 42/80 (52.50%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++   VQ+N+G+L L      S  HN L
Sbjct:  241 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALQL------SANHNIL 314          
BLAST of ATP-dependent RNA helicase vs. Ensembl Cavefish
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103024726])

HSP 1 Score: 313.153 bits (801), Expect = 4.645e-92
Identity = 191/464 (41.16%), Postives = 270/464 (58.19%), Query Frame = 1
Query:  889 RNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPI-PKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            +NFY+EHP V + T  E E++   K                                 EI +  +  P PV  F ES F    ++  I KQ + +P+PIQ   WP+ ++G+D++GIAQTG+GKTL++LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q    +Y     + S   YGGA K  QI  L+   EI + TPGR+ D  ++G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K  VQ+NVG L L+A H + Q V+  +  +K  +L+ +L  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD  QQER+  L   + G   I+IATDVASRGLD+ D+  VIN+D+P N E+Y+HR+GRT R+ +TG A+TF   N+M  A +L+ +L++A+Q +   L Q+
Sbjct:   58 KNFYQEHPDVGRRTPQEVEQYRRSK---------------------------------EITVKGRECPKPVMRFHESNFPS-YVMDVISKQNWTDPTPIQAQGWPLALSGQDMVGIAQTGSGKTLSYLLPAIVHINHQPF-LERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQLSANHNILQIVDVCNDGEKEDKLLRLLEEIMSEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQM 476          

HSP 2 Score: 134.035 bits (336), Expect = 1.953e-50
Identity = 82/221 (37.10%), Postives = 116/221 (52.49%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY+EHPD+   + +EVE +  R   I +K           +C                      KP+  F E  +    ++D+I   N+  PTPIQ  GWP+ L G+D +GIAQTG+GKTL+++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++    +  +   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   56 FEKNFYQEHPDVGRRTPQEVEQYR-RSKEITVK---------GREC---------------------PKPVMRFHESNFPS-YVMDVISKQNWTDPTPIQAQGWPLALSGQDMVGIAQTGSGKTLSYLLPAIVHINHQ--PFLERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLR 242          

HSP 3 Score: 87.4261 bits (215), Expect = 1.953e-50
Identity = 43/80 (53.75%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++   VQ+NVG+L L      S  HN L
Sbjct:  243 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQL------SANHNIL 316          
BLAST of ATP-dependent RNA helicase vs. Ensembl Cavefish
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:103041720])

HSP 1 Score: 283.493 bits (724), Expect = 2.059e-78
Identity = 178/470 (37.87%), Postives = 270/470 (57.45%), Query Frame = 1
Query:  874 FYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIP-KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDL--KDSG-VLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            +    +NFY E P +++MT +E  ++ L+                                ++ I +  K  P P++ + +       +L  ++K  +++P+PIQ  A P +M+GRDLIGIA+TG+GKT+AFLLP F HI  Q +P E+ +GP  +I++PTRELA+QI  E +K++      VVC YGG    +QI +LK   EI+V TPGR+ D+   +SG V NL+ V+Y+V+DEADRM DMGFE QV+ ++  VR  RQTVM SAT+P  ++ +A   +  PV+V VG   +  C  V+QHV  ++   K  +L+EIL H + +  +IIFV ++     L  +L           K +     +HG +DQ +R+  +   ++GA  +M+AT VA+RGLD+  L  V+NY+ P + E+YVHR GRTGRAG  G A+TF+       A ++I+ L+ +   VP  L QL
Sbjct:  330 YESYRKNFYVEVPELARMTPEEVNEYRLE--------------------------------LEGITVKGKGCPKPIKTWVQCGTSM-KVLNALKKHNYEKPTPIQSQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQ-RPLEEGEGPIAVIMTPTRELALQITKECKKFSKPLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANSGRVTNLRRVTYVVVDEADRMFDMGFEPQVMRIMDNVRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSV-VCSDVEQHVIVIEEDKKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLM----------KASYPCMSLHGGIDQYDRDSIINDFKNGACRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGFAYTFITDEQARYAGDIIKALELSGSAVPSELEQL 754          

HSP 2 Score: 120.168 bits (300), Expect = 3.717e-43
Identity = 75/211 (35.55%), Postives = 109/211 (51.66%), Query Frame = 2
Query: 2768 HRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLV 3397
             +NFY E P++  ++ EEV  + L    I +K                                G  KPI+++ +      ++L+ +K  N+E PTPIQ    P I+ GRD IGIA+TG+GKT+ F+LP   HI  Q +P +   GP  +I++PTRELA+QI  E  K  K   ++ VC YGG     QI  L+   EI+V TPGR+ D++
Sbjct:  334 RKNFYVEVPELARMTPEEVNEYRLELEGITVK------------------------------GKGCPKPIKTWVQC-GTSMKVLNALKKHNYEKPTPIQSQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQ-RPLEEGEGPIAVIMTPTRELALQITKECKKFSKPLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDML 512          

HSP 3 Score: 77.0258 bits (188), Expect = 3.717e-43
Identity = 33/70 (47.14%), Postives = 51/70 (72.86%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            +V+Y+V+DEADRM DMGFEPQV+ I+++ R  RQ++M SAT+P  +  +A   ++ PV+V VG   ++ S
Sbjct:  524 RVTYVVVDEADRMFDMGFEPQVMRIMDNVRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCS 593          
BLAST of ATP-dependent RNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006773.1 (pep scaffold:Pmarinus_7.0:GL491147:244:6091:-1 gene:ENSPMAG00000006112.1 transcript:ENSPMAT00000006773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 264.233 bits (674), Expect = 1.371e-79
Identity = 144/323 (44.58%), Postives = 199/323 (61.61%), Query Frame = 1
Query:  790 PTYLEEEKPIRKRPDNANIKMK-----CTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDL 1743
            P   + E P RK  D  +I  +       K ++  P+ +NFY E PSV++M   E    L  + +     +        C  G                  + IPNPVR F ++F   PDIL  I +  F  PSPIQ  AWP+++ G DL+GIAQTGTGKTLAFL P FIH+  QP PRE+R+GP +LIL+PTRELA+QI++E  KY+Y  I SV  YGG ++R+QI       +IV+ TPGR+ DL  +G ++++ ++YLVLDEAD MLD+GFE Q++ ++  VR  RQT MTSATWP GV+R+A +++K+PV V VG+L+L
Sbjct:   14 PASEDTENPPRKCVDWTSINERQADFVALKWNDCPPIKKNFYFESPSVTRM---EPWPLLATRKSNNNISVVD-----MCEEGG-----------------RSIPNPVRTFADAFEHFPDILDNICRAGFTTPSPIQSQAWPVVLLGWDLVGIAQTGTGKTLAFLFPGFIHLTLQPIPREQREGPGMLILTPTRELALQIKSECSKYSYQGITSVCIYGGGNRREQIDIATRGVDIVIATPGRLNDLMMNGHISMRGITYLVLDEAD-MLDLGFEPQIMKILLDVRPDRQTTMTSATWPPGVRRLARSYLKDPVLVYVGSLNL 310          

HSP 2 Score: 167.162 bits (422), Expect = 1.927e-59
Identity = 90/228 (39.47%), Postives = 127/228 (55.70%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            PI +NFY E P +  +    + +     NNI + ++          C++              G   I  P+R+F + F   P+ILD I    F TP+PIQ   WPV+L G D +GIAQTGTGKTL F+ P  IH+  Q  PR+ R GP +LIL+PTRELA+QI+SE  K  Y  I SVC YGG  +  QI+      +IV+ TPGR+NDL++ G ++++ +   + D
Sbjct:   49 PIKKNFYFESPSVTRMEPWPLLATRKSNNNISVVDM----------CEE--------------GGRSIPNPVRTFADAFEHFPDILDNICRAGFTTPSPIQSQAWPVVLLGWDLVGIAQTGTGKTLAFLFPGFIHLTLQPIPREQREGPGMLILTPTRELALQIKSECSKYSYQGITSVCIYGGGNRREQIDIATRGVDIVIATPGRLNDLMMNGHISMRGITYLVLD 252          

HSP 3 Score: 82.0333 bits (201), Expect = 1.927e-59
Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++YLVLDEAD MLD+GFEPQ++ I+ D R  RQ+ MTSATWP  VR++A  Y+ +PV V VGSL+L
Sbjct:  246 ITYLVLDEAD-MLDLGFEPQIMKILLDVRPDRQTTMTSATWPPGVRRLARSYLKDPVLVYVGSLNL 310          
BLAST of ATP-dependent RNA helicase vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 281.567 bits (719), Expect = 1.337e-78
Identity = 176/469 (37.53%), Postives = 264/469 (56.29%), Query Frame = 1
Query:  874 FYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDL--KDSG-VLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            + P  RNFY E P ++KMT +E   + L                               E+   +   K  P P++ + +       IL  ++KQ +++P+PIQ  A P +M+GRDLIGIA+TG+GKT+ FLLP F H+  Q +P E+ +GP  +I++PTRELA+QI  E +K+T      VVC YGG    +QI +LK   EI+V TPGR+ D+   +SG V N +  +Y+VLDEADRM DMGFE QV+ +I   R  RQTVM SAT+P  ++ +A   +  PV+V VG   +  C  V+QHV  ++   K  +L+E+L   + +  +I+FV ++     L  +L           K +     +HG +DQ +R+  +   +SG   +M+AT VA+RGLD+  L  V+NYD P + E+YVHRVGRTGRAG  G ++TF+       + ++I+ L+ +   +P  L +L
Sbjct:  325 YEPFRRNFYVEVPELAKMTAEEVSAYRL-------------------------------EMEGVMVKGKGCPKPIKTWVQCGISM-KILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQ-RPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSV-VCSDVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLM----------KASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFITSEQERYSGDIIKALELSGTPLPPDLERL 749          

HSP 2 Score: 129.798 bits (325), Expect = 1.937e-47
Identity = 78/222 (35.14%), Postives = 116/222 (52.25%), Query Frame = 2
Query: 2735 VVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLV 3397
            V ++ +   P  RNFY E P++  ++ EEV ++ L    +M+K                                G  KPI+++ +      +IL+ +K  N+E PTPIQ    P I+ GRD IGIA+TG+GKT+ F+LP   H+  Q +P +   GP  +I++PTRELA+QI  E  K  K   ++ VC YGG     QI  L+   EI+V TPGR+ D++
Sbjct:  318 VDHSKIAYEPFRRNFYVEVPELAKMTAEEVSAYRLEMEGVMVK------------------------------GKGCPKPIKTWVQCGISM-KILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQ-RPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDML 507          

HSP 3 Score: 79.337 bits (194), Expect = 1.937e-47
Identity = 34/70 (48.57%), Postives = 49/70 (70.00%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            + +Y+VLDEADRM DMGFEPQV+ II  +R  RQ++M SAT+P  +  +A   ++ PV+V VG   ++ S
Sbjct:  519 RATYMVLDEADRMFDMGFEPQVMRIIETSRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCS 588          
BLAST of ATP-dependent RNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006776.1 (pep scaffold:Pmarinus_7.0:GL491147:247:4468:-1 gene:ENSPMAG00000006112.1 transcript:ENSPMAT00000006776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 249.98 bits (637), Expect = 8.352e-76
Identity = 122/228 (53.51%), Postives = 166/228 (72.81%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQP-----KPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDL 1743
            + IPNPVR F ++F   PDIL  I +  F  PSPIQ  AWP+++ G DL+GIAQTGTGKTLAFL P FIH+  QP     +PRE+R+GP +LIL+PTRELA+QI++E  KY+Y      VC YGG ++R+QI       +IV+ TPGR+ DL  +G ++++ ++YLVLDEAD MLD+GFE Q++ ++  VR  RQT MTSATWP GV+R+A +++K+PV V VG+L+L
Sbjct:    5 RSIPNPVRTFADAFEHFPDILDNICRAGFTTPSPIQSQAWPVVLLGWDLVGIAQTGTGKTLAFLFPGFIHLTLQPIQIGGRPREQREGPGMLILTPTRELALQIKSECSKYSYQSCTRSVCIYGGGNRREQIDIATRGVDIVIATPGRLNDLMMNGHISMRGITYLVLDEAD-MLDLGFEPQIMKILLDVRPDRQTTMTSATWPPGVRRLARSYLKDPVLVYVGSLNL 231          

HSP 2 Score: 152.14 bits (383), Expect = 4.376e-55
Identity = 78/171 (45.61%), Postives = 108/171 (63.16%), Query Frame = 2
Query: 2951 GTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQ-----MKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHN-IKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            G   I  P+R+F + F   P+ILD I    F TP+PIQ   WPV+L G D +GIAQTGTGKTL F+ P  IH+  Q      +PR+ R GP +LIL+PTRELA+QI+SE  K  Y +  +SVC YGG  +  QI+      +IV+ TPGR+NDL++ G ++++ +   + D
Sbjct:    3 GGRSIPNPVRTFADAFEHFPDILDNICRAGFTTPSPIQSQAWPVVLLGWDLVGIAQTGTGKTLAFLFPGFIHLTLQPIQIGGRPREQREGPGMLILTPTRELALQIKSECSKYSYQSCTRSVCIYGGGNRREQIDIATRGVDIVIATPGRLNDLMMNGHISMRGITYLVLD 173          

HSP 3 Score: 82.4185 bits (202), Expect = 4.376e-55
Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            ++YLVLDEAD MLD+GFEPQ++ I+ D R  RQ+ MTSATWP  VR++A  Y+ +PV V VGSL+L
Sbjct:  167 ITYLVLDEAD-MLDLGFEPQIMKILLDVRPDRQTTMTSATWPPGVRRLARSYLKDPVLVYVGSLNL 231          
BLAST of ATP-dependent RNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 255.758 bits (652), Expect = 9.045e-74
Identity = 163/434 (37.56%), Postives = 250/434 (57.60%), Query Frame = 1
Query: 1051 ELIDEIPIPKV---IPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHI-EGQP--------------KPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLI----YAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            E  D+IP+       P  + +F E       I++ +   +++ P+P+Q  A PI+   RDL+  AQTG+GKT AFLLP    I  G P              K  +++Q P  L+L+PTRELA+QI +E +K+ Y   +   V YGGAD  +Q+ +L++   ++V TPGR+ D+ + G + L    YLVLDEADRMLDMGFE Q+  ++       +  RQT+M SAT+P  +Q +A   +++ + + VG +  +A   + Q V +V+  DK   L+++L     +   ++FV  K     L         +G L  +G      IHGD  Q++RE AL + R+G R I++AT VA+RGLDIP++  VIN+D P +IEEYVHR+GRTGR G  G+A +F N+ + +   EL+ +L +A QEVP +L  + ++H+
Sbjct:   40 EKYDDIPVEATGNDCPPHIESFHELELGE-IIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVG-SASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADAL---------QGFLCSEG-YSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNENMTRELLHLLVEAHQEVPSWLETMAQEHR 461          

HSP 2 Score: 89.3521 bits (220), Expect = 9.041e-30
Identity = 52/151 (34.44%), Postives = 78/151 (51.66%), Query Frame = 2
Query: 3014 ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHI---------------EGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHN-IKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNL 3418
            I+  +    +E PTP+Q    P+I   RD +  AQTG+GKT  F+LP L  I               +  +K  Q +  P  L+L+PTRELA+QI  E  K  Y + ++    YGGA+   Q+  L+    ++V TPGR+ D++  G + L
Sbjct:   70 IMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGL 220          

HSP 3 Score: 60.4622 bits (145), Expect = 9.041e-30
Identity = 30/66 (45.45%), Postives = 47/66 (71.21%), Query Frame = 1
Query: 3481 YLVLDEADRMLDMGFEPQVVSIIND----TRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSL 3666
            YLVLDEADRMLDMGFEPQ+  I+      T+  RQ++M SAT+P+ ++ +A  ++++ + + VG +
Sbjct:  225 YLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRV 290          
BLAST of ATP-dependent RNA helicase vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 254.603 bits (649), Expect = 1.727e-71
Identity = 160/389 (41.13%), Postives = 224/389 (57.58%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYT-YHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVE-YVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEV 2247
            P P  +F    FD   +L  IRK +F +P+PIQC   PI ++GRD+IGIA+TG+GKT +F+ P  +HI  Q K  +   GP  LI  PTREL  QI  E +++   +++ SV  YGG    +Q   L+E  EIVV TPGR+ D       NL+ V+YLV DEADRM DMGFE QV ++   VR  RQT++ SAT+   V+++A   + +P++V  G +   A   V Q VE + +   K   L   L        ++IFV RK    +L+ +L           +   +   +HGD+DQ ER   +   +     IM+ATDVA+RGLDIP +  V+NYD  ++I+ + HRVGRTGRAG  G AFT M   DM+ A +L+R L+ A+Q V
Sbjct:  245 PKPCSSFGHFGFDE-QLLNLIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQ-KELKPGDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTMLYSATFRMRVEKLARDILIDPIRVVQGDIG-EANEDVTQRVEIFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDL----------EQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKDMNFAGDLVRNLEGANQHV 620          

HSP 2 Score: 127.487 bits (319), Expect = 1.741e-41
Identity = 88/241 (36.51%), Postives = 118/241 (48.96%), Query Frame = 2
Query: 2732 SVVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQ--MKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            S+ ++++   P  +NFY EH +I +L   E              ELK                      +V    P   KP  SF   F    ++L++I+   F  PTPIQC G P+ L GRD IGIA+TG+GKT +F+ P L+HI  Q  +KP     GP  LI  PTREL  QI  E  +  K +N+ SV  YGG     Q  +L++  EIVV TPGR+ D V     NL+ V   +FD
Sbjct:  202 SIDHSEIEYEPFDKNFYVEHEEISSLGASEAH------------ELK---------------------AQVSGAAP--PKPCSSFGH-FGFDEQLLNLIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKPGD---GPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFD 403          

HSP 3 Score: 61.6178 bits (148), Expect = 1.741e-41
Identity = 31/65 (47.69%), Postives = 44/65 (67.69%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSL 3666
            +V+YLV DEADRM DMGFE QV SI N  R  RQ+++ SAT+   V ++A   + +P++V  G +
Sbjct:  396 RVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTMLYSATFRMRVEKLARDILIDPIRVVQGDI 460          
BLAST of ATP-dependent RNA helicase vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 325.865 bits (834), Expect = 2.651e-98
Identity = 186/403 (46.15%), Postives = 259/403 (64.27%), Query Frame = 1
Query: 1084 IPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQP--KPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEIL--AHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMK 2274
            IP P+  F+E+ F  PD +L E++ + F +P+ IQC  WP+ ++GRD++GIA TG+GKTL++ LP  +HI  QP   P +   GP VL+L+PTRELA+QIQ E  K+ +   I +   YGG  K  QI  L    EIV+ TPGR+ D+ + G  NLK V+YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A  ++ +P+QV VG+L+L+A H + Q VE V   +K  RL + L  A    E K +IF + K  C D+   L   R  G         A  IHGD DQ+ER+  L+  R+G   IM+ATDVA+RG+D+  +  VINYD P NIE+YVHR+GRTGRAG TG A +F  + +    A+LI I+++A+Q +P   P+L+K
Sbjct:  108 IPKPITTFDEAGF--PDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGD---GPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYL---REDGW-------PALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGLGAKLISIMREANQNIP---PELLK 492          

HSP 2 Score: 145.976 bits (367), Expect = 8.129e-37
Identity = 89/231 (38.53%), Postives = 124/231 (53.68%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQ--MKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHN-IKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
              +NFY EH  +R+ S  E+  F  RK N M       P                             KPI +F+E  +  P+ +L+ +KA  F+ PT IQC GWP+ L GRD +GIA TG+GKTL++ LP ++HI  Q  + P     GP VL+L+PTRELA+QI++E  K  + + I++ C YGG  K  QI  L    EIV+ TPGR+ D++ +G  NLK V   + D
Sbjct:   73 FEKNFYVEHESVRDRSDSEIAQF--RKENEMTISGHDIP-----------------------------KPITTFDEAGF--PDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGD---GPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLD 267          

HSP 3 Score: 94.3597 bits (233), Expect = 3.404e-20
Identity = 46/82 (56.10%), Postives = 62/82 (75.61%), Query Frame = 1
Query: 3451 VDLLIIIK-----VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            +D+L I K     V+YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ V+Q+A  Y+++P+QV VGSL+L  S
Sbjct:  248 IDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSAS 329          
BLAST of ATP-dependent RNA helicase vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 266.929 bits (681), Expect = 5.583e-78
Identity = 170/404 (42.08%), Postives = 249/404 (61.63%), Query Frame = 1
Query: 1120 FDHPDILTEIRKQ--KFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAV-RRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLD-LNACHTVKQHVEYVDYHDKTQRLVEILA--HIKPE--DKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL-----MKDHQDY 2289
            FD+  + + I+ +  KF +P+PIQ +AWP L++G+D++G+A+TG+GKT AF +PA  H+       +K++G  VL++SPTRELA QI + +   T        C YGG  K +Q  QLK++ ++VV TPGR+ DL   G ++L  V+YLVLDEADRML+ GFE  + N+I      +RQT+M +ATWP  V+ +A T M NP++V++G  D L A   + Q VE VD   K ++L+E+L   H  P+  +K++IF   K + + +  E  LK +              IHGDL QQ+R  AL   +SG  N+++ATDVA+RGLDIP++  VIN  FP  +E+YVHR+GRTGRAG+TG A T   + +   A  L+ +L  A+Q VP+ L +       K+H  Y
Sbjct:  116 FDYLSLDSSIQAEISKFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMND----QKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKKS-QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARV--ERNLKYN--------GYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVPEDLIKFGTHTKKKEHSAY 504          

HSP 2 Score: 107.457 bits (267), Expect = 3.620e-40
Identity = 65/178 (36.52%), Postives = 98/178 (55.06%), Query Frame = 2
Query: 2897 DCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCC-YGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
            D D++   F E+++ V        +P+ SF+ +        +I K   F  PTPIQ + WP +L G+D +G+A+TG+GKT  F +PA+ H+    K R    G  VL++SPTRELA QI   ++ +        CC YGG  K  Q   L+ + ++VV TPGR+ DL+  G ++L  V
Sbjct:   90 DIDEY---FKENEIAVEDSLDLALRPLLSFDYLSLDSSIQAEISK---FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKR----GIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKKS-QVVVATPGRLLDLLQEGSVDLSQV 256          

HSP 3 Score: 76.6406 bits (187), Expect = 3.620e-40
Identity = 34/71 (47.89%), Postives = 56/71 (78.87%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDT-RKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            +V+YLVLDEADRML+ GFE  + +II +T   +RQ++M +ATWP+ VR++A  +M+NP++V++G+ D + +
Sbjct:  255 QVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTA 325          
BLAST of ATP-dependent RNA helicase vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 268.085 bits (684), Expect = 1.703e-77
Identity = 168/430 (39.07%), Postives = 249/430 (57.91%), Query Frame = 1
Query: 1060 DEIPI---PKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIH-IEGQPKPREKRQG--------PTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLI----YAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRIN 2298
            D+IP+    K +P P+  F     D   +L  I+  +F +P+P+Q  + PI+  GRDL+  AQTG+GKT  FL P      +  P P+ + QG        PT +I++PTRELA QI +E +K+TY   + + V YGG+   +Q+ +++   +++V TPGR+ DL + G ++L +V YLVLDEADRMLDMGFE Q+ +++         +RQT+M SAT+P  +Q +A   + + + ++VG +  +    + Q V YV+  DK   L+++L+    +   +IFV  K     L   L ++            +A  IHGD  Q ERE AL   RSGA  +++AT VA+RGLDIP++T VINYD P ++++YVHR+GRTGRAG TG A  F N  + +    L  IL +A+QEVP FL   M      R N
Sbjct:  126 DDIPVDASGKDVPEPITEFTSPPLDGL-LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVG-STSENITQKVLYVENQDKKSALLDLLS-ASTDGLTLIFVETKRMADQLTDFLIMQN----------FRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSENSNIVKGLHEILTEANQEVPSFLKDAMMSAPGSRSN 542          

HSP 2 Score: 98.2117 bits (243), Expect = 3.055e-21
Identity = 55/148 (37.16%), Postives = 81/148 (54.73%), Query Frame = 2
Query: 3014 ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHI---------EGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHN-IKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
            +L+ IK   F  PTP+Q    P++  GRD +  AQTG+GKT  F+ P L            E Q    Q +  PT +I++PTRELA QI  E  K  Y + +K+   YGG+    Q+  +    +++V TPGR+NDL+  G ++L +V
Sbjct:  153 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANV 300          

HSP 3 Score: 63.929 bits (154), Expect = 1.300e-10
Identity = 35/84 (41.67%), Postives = 54/84 (64.29%), Query Frame = 1
Query: 3421 RRNTVVIRYEVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTR----KQRQSIMTSATWPECVRQIALLYMDNPVQVNVG 3660
            R N ++ R ++ L     V YLVLDEADRMLDMGFEPQ+  I+ D       +RQ++M SAT+P  ++ +A  ++ + + ++VG
Sbjct:  285 RLNDLLERGKISL---ANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVG 365          
BLAST of ATP-dependent RNA helicase vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 264.618 bits (675), Expect = 3.012e-76
Identity = 168/422 (39.81%), Postives = 246/422 (58.29%), Query Frame = 1
Query: 1060 DEIPI---PKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHI-EGQPKPR-EKRQG-------PTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLI----YAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMK 2274
            D IP+    K +P P+ +F     D   ++  I+   F +P+P+Q  + PI+  GRDL+  AQTG+GKT  FL P F  +    P P  EK Q        P+ L+L+PTRELA QI  E +K+TY   +   V YGGA   +Q+ ++    +++V TPGR+ DL + G ++L ++ YLVLDEADRMLDMGFE Q+ +++          RQT+M SAT+P  +Q +A   + N + ++VG +  +    + Q + YVD  DK   L+++L+  + +   +IFV  K     L   L ++            KA  IHGD  Q ERE AL   ++   +I++AT VA+RGLDIP++T VINYD P +I++YVHR+GRTGRAG TG A +F N N+ +    L+ IL +A+QEVP FL  L +
Sbjct:  138 DNIPVDASGKDVPEPILDFSSPPLDEL-LMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVG-STSENITQRILYVDDMDKKSALLDLLS-AEHKGLTLIFVETKRMADQLTDFLIMQN----------FKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILNEANQEVPTFLSDLSR 546          

HSP 2 Score: 90.1225 bits (222), Expect = 1.200e-18
Identity = 50/148 (33.78%), Postives = 79/148 (53.38%), Query Frame = 2
Query: 3014 ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHI---------EGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHN-IKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
            +++ IK  +F  PTP+Q    P++  GRD +  AQTG+GKT  F+ P    +         E        +  P+ L+L+PTRELA QI  E  K  Y + ++    YGGA    Q+  +    +++V TPGR+NDL+  G ++L ++
Sbjct:  165 LMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANI 312          

HSP 3 Score: 66.6254 bits (161), Expect = 1.928e-11
Identity = 36/86 (41.86%), Postives = 57/86 (66.28%), Query Frame = 1
Query: 3421 RRNTVVIRYEVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIIND----TRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSL 3666
            R N ++ R +V L     + YLVLDEADRMLDMGFEPQ+  I+ +    + + RQ++M SAT+P  ++ +A  ++DN + ++VG +
Sbjct:  297 RLNDLLERGKVSL---ANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRV 379          
BLAST of ATP-dependent RNA helicase vs. Ensembl Yeast
Match: PRP28 (RNA binding protein; involved in RNA isomerization at the 5' splice site and for exchange of U6 for U1 snRNA at the 5' splice site; similar to the RNA helicases of the DEAD-box family [Source:SGD;Acc:S000002651])

HSP 1 Score: 216.853 bits (551), Expect = 2.732e-60
Identity = 155/408 (37.99%), Postives = 232/408 (56.86%), Query Frame = 1
Query: 1084 IPNPVRNFEESFFDHPDIL-TEIRKQKFQEPSPIQCIAWPILMTG---RDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKR----QGPTVLILSPTRELAIQIQNEVQKYTY-------HDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAV------RRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDY-HDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMN-KNDMSNAAELIRILQDAD 2238
            + NP+RN+EE      D+L   I++ +F  P+PIQ I  P +      RD +G+A TG+GKTLAF++P  I +   P PR        GP  LIL+PTREL  QIQ E QK T        +D   +   GG    +  + L E  +I+V TPGR+ D  ++ +L +K V  LVLDEAD+M+D+GFE QV N++  V         RQT+M +AT    +++IA  +M+ PV   +G ++  +   ++Q VEY D   DK ++L  I+A   P   IIIF+  K Q +D   E F K +         +K   +HG   Q++RE +L++ R+    IMIAT+VA+RGLDIP+++ V+N+   K +++Y+HR+GRTGRA   G A +F++   D S   EL + ++  D
Sbjct:  167 VENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSP-PRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIG-VETGSEPLIQQVVEYADNDEDKFKKLKPIVAKYDPP--IIIFINYK-QTADWLAEKFQKETN--------MKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAEDESLIRELYKYVRKHD 561          

HSP 2 Score: 86.6557 bits (213), Expect = 1.184e-17
Identity = 64/171 (37.43%), Postives = 96/171 (56.14%), Query Frame = 2
Query: 2963 IAKPIRSFEEMFWKHPEILD-IIKALNFETPTPIQCIGWPVILGG---RDFIGIAQTGTGKTLTFVLPALIHIEGQMKPR----QYRYGPTVLILSPTRELAMQIESEILKI-------KYHNIKSVCCYGGAEKMYQIN-SLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
            +  P+R++EE+     ++L  II+ L F +PTPIQ I  P +      RDF+G+A TG+GKTL FV+P LI +  +  PR    +   GP  LIL+PTREL  QI+ E  K+         ++ K +   GG   + +I+ SL +  +I+V TPGR+ D +    L +K V
Sbjct:  167 VENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKM-SRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGG-HSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQV 335          

HSP 3 Score: 60.077 bits (144), Expect = 2.360e-9
Identity = 32/77 (41.56%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 3448 EVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIIN------DTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVG 3660
            E  LL++ +V  LVLDEAD+M+D+GFE QV +I+       D+   RQ++M +AT    + +IA  YM  PV   +G
Sbjct:  326 ENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIG 402          
BLAST of ATP-dependent RNA helicase vs. Ensembl Nematostella
Match: EDO39699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G4])

HSP 1 Score: 406.371 bits (1043), Expect = 2.417e-128
Identity = 215/420 (51.19%), Postives = 288/420 (68.57%), Query Frame = 1
Query: 1078 KVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYL-----------VLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEE-----YVHXXXXXX--XXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQ 2283
            + IPNPV  FEE+F  +P+IL EI+K  F +PSPIQC AWP++M+G DLIGIAQTGTGKTLAFLLPAF+HI+GQ   REKR GP+VL+LSPTRELA+QI+ EV+KY Y  I SV  YGG  ++DQI  +++  EIV+ TPGR+ DL    +L+++ V+YL           VLDEADRMLDMGFE ++  ++  +R  RQTVMTSATWP GVQR+A  +M +PV+V VG LDLNAC  V Q VE VD   K +R++E +  + P +K++IFV +K    DL+ +L L    G+         C IHGD +Q +RE AL   ++G   I+IATDVASRGLDI D+T VINYDFP++IEE     Y+ +        + R+G + TF+++ D  +A +LI+I+  A+QEVPDFL  + K ++
Sbjct:   16 RAIPNPVTKFEEAFEQYPEILEEIKKAGFVKPSPIQCQAWPVVMSGMDLIGIAQTGTGKTLAFLLPAFLHIDGQELAREKRGGPSVLVLSPTRELALQIEQEVKKYHYRGIRSVCIYGGGSRKDQIGVVEKGVEIVIATPGRLNDLLMHDILSVRSVTYLVSMSGHNICSIVLDEADRMLDMGFEPEIKKILLDIRPDRQTVMTSATWPPGVQRMADQYMTDPVRVFVGCLDLNACENVTQLVEEVDGSLKKERVIEFIEGMAPGEKVLIFVGKKVLADDLSSDLMLHGIDGV--------QC-IHGDREQYDREQALDDFKTGLARILIATDVASRGLDIKDITYVINYDFPRHIEEGGGGCYLTQTLSLSFCFSSRSGTSLTFISREDWRSAHKLIKIMVQANQEVPDFLHDMAKRYE 426          

HSP 2 Score: 180.644 bits (457), Expect = 7.160e-64
Identity = 84/156 (53.85%), Postives = 109/156 (69.87%), Query Frame = 2
Query: 2960 GIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
             I  P+  FEE F ++PEIL+ IK   F  P+PIQC  WPV++ G D IGIAQTGTGKTL F+LPA +HI+GQ   R+ R GP+VL+LSPTRELA+QIE E+ K  Y  I+SVC YGG  +  QI  +    EIV+ TPGR+NDL++   L+++ V
Sbjct:   17 AIPNPVTKFEEAFEQYPEILEEIKKAGFVKPSPIQCQAWPVVMSGMDLIGIAQTGTGKTLAFLLPAFLHIDGQELAREKRGGPSVLVLSPTRELALQIEQEVKKYHYRGIRSVCIYGGGSRKDQIGVVEKGVEIVIATPGRLNDLLMHDILSVRSV 172          

HSP 3 Score: 84.3445 bits (207), Expect = 7.160e-64
Identity = 44/84 (52.38%), Postives = 57/84 (67.86%), Query Frame = 1
Query: 3454 DLLIIIKVSYLV-----------LDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            D+L +  V+YLV           LDEADRMLDMGFEP++  I+ D R  RQ++MTSATWP  V+++A  YM +PV+V VG LDL
Sbjct:  165 DILSVRSVTYLVSMSGHNICSIVLDEADRMLDMGFEPEIKKILLDIRPDRQTVMTSATWPPGVQRMADQYMTDPVRVFVGCLDL 248          
BLAST of ATP-dependent RNA helicase vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 302.368 bits (773), Expect = 9.099e-91
Identity = 180/392 (45.92%), Postives = 243/392 (61.99%), Query Frame = 1
Query: 1084 IPNPVRNFEESFFDHPD-ILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYH-DIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEV 2247
            +P PV  FEES F  PD I +  +++ F EP+ IQ   WP+ +TGR+L+GIAQTG+GKTL+F+LP  +HI  QP   +   GP VL+L PTRELA Q+Q        H  + S   YGGA K  QI +L+   EI + TPGR+ D+ +S   NL+  +YLVLDEADRMLDMGFE Q+  +I  +R  RQT+M SATWP  VQ +A   + + V + VG+L L A H + Q V+  + H+K  +L+++L  I  + E+K +IF   K +  +L  +L   RS G         A  IHGD  Q ER+  L   R G   I++ATDVASRGLDI D+  VIN+DFP   E+YVHR+GRT R+ RTG ++TF   N+   A EL+ +LQ+A Q V
Sbjct:   53 VPKPVTTFEESAF--PDYIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPL-LQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLIFTETKRRADELTRKL---RSDGW-------PAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFFTVNNAKQAKELVSVLQEAKQHV 431          

HSP 2 Score: 124.79 bits (312), Expect = 4.317e-46
Identity = 79/221 (35.75%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 2771 RNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQ--MKPRQYRYGPTVLILSPTRELAMQIESEILKIKYH-NIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
            +NFY EHP ++     EV+++  R++  +    +  P                             KP+ +FEE  +  P+ I    K   F  PT IQ  GWPV L GR+ +GIAQTG+GKTL+F+LP ++HI  Q  ++P     GP VL+L PTRELA Q++     +  H  ++S C YGGA K  QI  L    EI + TPGR+ D++     NL+
Sbjct:   20 KNFYREHPVVQARGQHEVDAY--RRSKDLTVNGRNVP-----------------------------KPVTTFEESAF--PDYIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPLLQPGD---GPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLR 204          

HSP 3 Score: 80.4925 bits (197), Expect = 4.317e-46
Identity = 37/70 (52.86%), Postives = 52/70 (74.29%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            + +YLVLDEADRMLDMGFEPQ+ +II+  R  RQ++M SATWP+ V+ +A  ++ + V + VGSL L  +
Sbjct:  205 RCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTAN 274          
BLAST of ATP-dependent RNA helicase vs. Ensembl Nematostella
Match: EDO42894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S034])

HSP 1 Score: 277.33 bits (708), Expect = 1.711e-78
Identity = 179/478 (37.45%), Postives = 277/478 (57.95%), Query Frame = 1
Query:  874 FYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPI-PKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTY-HDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDL---KDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYR 2292
            + P  ++FY E P ++KMT +E ++F L                                 ++ I +  K  P PV+ + ++      IL  ++K  +++P+PIQ  A P++M+GRD+IGIA+TG+GKTLAFL+P F HI+ QP P E+ +GP  ++++PTRELAIQI  E +K+   +++  V  YGG    +QI +LK   EI+V TPGR+ D+    +  V N +  +YLVLDEADRM DMGFE QV+ +I  +R  RQTVM SAT+P  ++ +A   +  P+++ VG   +  C  V+Q+V  ++  DK  +L+E+L   + +  +++FV  K   +D  F+  LKRS   L          +HG +DQ +R+  +   ++G   +MIAT VA+RGLD+  L  V+NYD P + E+YVHRVGRTGRAG  G A+TF+       A ++I+ L+ A+  VP+ +  L   + + R
Sbjct:   93 YQPFRKDFYVEVPELAKMTPEETDEFRLS--------------------------------LENIHVRGKNAPKPVKTWAQTGV-QLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIGIAKTGSGKTLAFLIPMFRHIKDQP-PLEREEGPIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQVMRIIDCIRPDRQTVMFSATFPRQMEALARKILDKPIEIQVGGRSV-VCSDVEQNVVVIEEDDKFLKLLELLGLYQEQGSVLVFV-EKQDSADSLFKDLLKRSYPCLS---------LHGGMDQFDRDSTIADFKNGVTKLMIATSVAARGLDVKHLNLVVNYDCPNHYEDYVHRVGRTGRAGNKGTAYTFLTPEQGRFAIDVIKALEMAENPVPEDVRNLANTYIETR 525          

HSP 2 Score: 129.028 bits (323), Expect = 1.699e-46
Identity = 80/223 (35.87%), Postives = 121/223 (54.26%), Query Frame = 2
Query: 2732 SVVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLV 3397
            +VVY      P  ++FY E P++  ++ EE + F L   NI ++  K  P                             KP++++ +   +  +ILD++K  ++E PTPIQ    PVI+ GRD IGIA+TG+GKTL F++P   HI+ Q  P +   GP  ++++PTRELA+QI  E  K  K +N++ VC YGG     QI  L+   EI+V TPGR+ D++
Sbjct:   90 TVVYQ-----PFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRG-KNAP-----------------------------KPVKTWAQTGVQL-KILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIGIAKTGSGKTLAFLIPMFRHIKDQ-PPLEREEGPIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDML 275          

HSP 3 Score: 77.7962 bits (190), Expect = 1.699e-46
Identity = 34/70 (48.57%), Postives = 49/70 (70.00%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVS 3681
            + +YLVLDEADRM DMGFEPQV+ II+  R  RQ++M SAT+P  +  +A   +D P+++ VG   ++ S
Sbjct:  287 RCTYLVLDEADRMFDMGFEPQVMRIIDCIRPDRQTVMFSATFPRQMEALARKILDKPIEIQVGGRSVVCS 356          
BLAST of ATP-dependent RNA helicase vs. Ensembl Nematostella
Match: EDO43557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY08])

HSP 1 Score: 261.151 bits (666), Expect = 1.271e-75
Identity = 188/525 (35.81%), Postives = 272/525 (51.81%), Query Frame = 1
Query:  751 PSESYVQDDDW-------GIPTYLEEEKPIRKRP--DNANIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYT-YHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVE-YVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYR 2292
            P  SY  D+D        G P   E+ K I   P  D++ I  K        P ++NFY EHP ++K +  E +         +   + +    SF +FG   FD+                               ++  IRK ++ +P+ IQC A PI ++GRD+IGIA+TG+GKT AFL PA +HI  QP+  +   GP VLI +PTREL  QI  E +++   ++I  V  +GG +K +Q   L+E  EIVV TPGR+ D   +   NL  V+YLV DEADRM DMGFE QV ++   VR  RQT++ SAT+   V+ +    + +PV+V +G L   A   V Q V  +     K + L + L        ++IFV +K    +LA  L           K   +   +HGD+DQ ER   L   +     I++ATDVA+RGLDIP +  VINYD  ++I  + HR+GRTGRAG  G A+T + ++D + A +L+R L+ A+Q VP+ L  L   +  +R
Sbjct:   21 PVVSYTDDEDLEIEYDSDGNPIVPEKSKIIEPLPRVDHSEIDYK--------PFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFG---FDEQ------------------------------MMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPE-LQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQEGAEIVVATPGRLIDHVKAKATNLHRVTYLVFDEADRMFDMGFEPQVRSIANNVRPDRQTLLFSATFKKKVEHLCRDILVDPVRVVIGELG-EANEDVTQIVHIFNSMPSKWEWLTQNLVSFASAGSVLIFVTKKLNSEELATNL----------RKNDFEVALLHGDMDQFERSKVLGQFKKREIPILVATDVAARGLDIPSIKTVINYDVARDITTHTHRIGRTGRAGEKGNAYTLLTQSDQNFAGDLVRNLEIANQVVPESLMALAMKNSWFR 492          

HSP 2 Score: 133.265 bits (334), Expect = 1.880e-45
Identity = 86/238 (36.13%), Postives = 122/238 (51.26%), Query Frame = 2
Query: 2735 VVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*LFD 3445
            V ++++   P ++NFYEEHP+I   S +E++  L +K  I +                            +P  P I+     F+E      +++  I+ L +  PT IQC   P+ L GRD IGIA+TG+GKT  F+ PAL+HI  Q +  Q   GP VLI +PTREL  QI +E  +  K +NI  V  +GG  K  Q  +L++  EIVV TPGR+ D V     NL  V   +FD
Sbjct:   56 VDHSEIDYKPFNKNFYEEHPEITKQSKQEIDD-LRKKMGIKVS-------------------------GAMPARPCISFAHFGFDE------QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPE-LQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQEGAEIVVATPGRLIDHVKAKATNLHRVTYLVFD 260          

HSP 3 Score: 69.707 bits (169), Expect = 1.880e-45
Identity = 33/65 (50.77%), Postives = 46/65 (70.77%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSL 3666
            +V+YLV DEADRM DMGFEPQV SI N+ R  RQ+++ SAT+ + V  +    + +PV+V +G L
Sbjct:  253 RVTYLVFDEADRMFDMGFEPQVRSIANNVRPDRQTLLFSATFKKKVEHLCRDILVDPVRVVIGEL 317          
BLAST of ATP-dependent RNA helicase vs. Ensembl Nematostella
Match: PL10 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM49])

HSP 1 Score: 263.848 bits (673), Expect = 4.426e-75
Identity = 169/423 (39.95%), Postives = 247/423 (58.39%), Query Frame = 1
Query: 1051 ELIDEIPIPKVIPNPVRNFEESFFDHPDI----LTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAF--IHIEGQPKPRE------KRQGPTVLILSPTRELAIQIQNEVQKYTYHDI-DSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLI----YAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            E  D+IP+        +N E   F+  D+    L  +    +++P+P+Q  A PI+   RDL+  AQTG+GKT AFL+P    I++EG P P +      +RQ P  L+L+PTRELA+QI +E +K++Y  +    V YGGAD   Q+ +L  N  ++V TPGR+ D+ D G + L  + +LVLDEADRMLDMGFE Q+  ++          RQT+M SAT+P  +Q +A   ++N + + VG +  +    + Q V +VD  DK   L+++L    P+   ++FV  K      A E+FL         K       IHGD  Q+ERE AL+  R G   I++AT VA+RGLDIP++  VIN+D P +IEEYVHR+GRTGR G TG A +F N  + + A EL+ IL+++ QE+P +L  +
Sbjct:  173 EKYDDIPVEATGQECPKNIE--LFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILSRIYMEGPPAPPDIKHAGRRRQYPICLVLAPTRELAVQIFDEARKFSYRSLCRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRMLDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQMLARDFLENYIFLAVGKVG-STSENITQKVVWVDEFDKRSFLLDLLNASGPQQLTLVFVETKKGAD--ALEMFLA--------KDGYYCTSIHGDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNHKNKNVAKELMDILEESKQEIPSWLESM 582          

HSP 2 Score: 94.7449 bits (234), Expect = 2.244e-30
Identity = 56/150 (37.33%), Postives = 83/150 (55.33%), Query Frame = 2
Query: 3014 ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPAL--IHIEGQMKP---------RQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVC-CYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
            +L  +    ++ PTP+Q    P++ G RD +  AQTG+GKT  F++P L  I++EG   P         RQY   P  L+L+PTRELA+QI  E  K  Y ++   C  YGGA+   Q+  L  N  ++V TPGR+ D++  G + L  +
Sbjct:  203 LLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILSRIYMEGPPAPPDIKHAGRRRQY---PICLVLAPTRELAVQIFDEARKFSYRSLCRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMMDRGRVGLDSI 349          

HSP 3 Score: 58.151 bits (139), Expect = 2.244e-30
Identity = 30/68 (44.12%), Postives = 50/68 (73.53%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIIN-DTRKQ---RQSIMTSATWPECVRQIALLYMDNPVQVNVGSL 3666
            + +LVLDEADRMLDMGFEPQ+  I++ D+  +   RQ++M SAT+P+ ++ +A  +++N + + VG +
Sbjct:  349 IRFLVLDEADRMLDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQMLARDFLENYIFLAVGKV 416          
BLAST of ATP-dependent RNA helicase vs. Ensembl Medaka
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:101166328])

HSP 1 Score: 390.193 bits (1001), Expect = 5.213e-119
Identity = 219/471 (46.50%), Postives = 309/471 (65.61%), Query Frame = 1
Query:  880 PVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYR 2292
            P+ + FY E  SVS +T +E  ++  D                     +  F  D  E  +  P    IPNP R F E+F  +P+I+  I +  F  P+PIQ  AWP+L++G DLI IAQTGTGKTLA+LLP FIH++GQP PR +  GP +L+L+PTRELA+QI+ E +KY+Y    S+  YGG D+R QI  +K   +IV+ TPGR+ DL+ + ++NL  ++YLVLDEADRMLDMGFE Q++ ++  +R  RQTVMTSATWP GV+R+A +++KNP+ V VGTLDL A  TV+Q +  V   +K   +++ + ++ P+DK IIFV +K +  DL+ +L L   +GL     AV++  +HGD +Q++RE ALK  +     I++ATD+ASRGLD+ D+T V NYDFP+NIEEYVHRVGRTGRAGR+G A T + + D   A ELI IL+ + QEVP  L  + + ++ ++
Sbjct:  176 PLKKKFYCEAESVSALTPEEVAEWRKDN--------------------NNIFVDDLMEGGERRP----IPNPCRTFLEAFERYPEIMENIDRVGFVRPTPIQSQAWPVLLSGEDLIAIAQTGTGKTLAYLLPGFIHMDGQPVPRAEWGGPGMLVLTPTRELALQIETECKKYSYKGYKSICIYGGGDRRGQINLVKSGVDIVIATPGRLNDLQMNELINLFSITYLVLDEADRMLDMGFEPQIMKILLDIRPDRQTVMTSATWPSGVRRLAKSYLKNPMMVYVGTLDLAAVDTVQQTITIVQEEEKKAFVMDFIRNMLPQDKAIIFVGKKIKADDLSSDLCL---QGL-----AVQS--LHGDREQRDREEALKDFKESRVRILVATDLASRGLDVHDITHVFNYDFPRNIEEYVHRVGRTGRAGRSGAAVTLVTREDWRMAPELIPILERSGQEVPHELVLMAERYEKHK 612          

HSP 2 Score: 169.474 bits (428), Expect = 3.280e-64
Identity = 91/219 (41.55%), Postives = 125/219 (57.08%), Query Frame = 2
Query: 2762 PIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNL 3418
            P+ + FY E   +  L+ EEV  +    NNI + +L                    +  E  P    I  P R+F E F ++PEI++ I  + F  PTPIQ   WPV+L G D I IAQTGTGKTL ++LP  IH++GQ  PR    GP +L+L+PTRELA+QIE+E  K  Y   KS+C YGG ++  QIN ++   +IV+ TPGR+NDL +   +NL
Sbjct:  176 PLKKKFYCEAESVSALTPEEVAEWRKDNNNIFVDDLM-------------------EGGERRP----IPNPCRTFLEAFERYPEIMENIDRVGFVRPTPIQSQAWPVLLSGEDLIAIAQTGTGKTLAYLLPGFIHMDGQPVPRAEWGGPGMLVLTPTRELALQIETECKKYSYKGYKSICIYGGGDRRGQINLVKSGVDIVIATPGRLNDLQMNELINL 371          

HSP 3 Score: 98.2117 bits (243), Expect = 3.280e-64
Identity = 43/73 (58.90%), Postives = 58/73 (79.45%), Query Frame = 1
Query: 3454 DLLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            +L+ +  ++YLVLDEADRMLDMGFEPQ++ I+ D R  RQ++MTSATWP  VR++A  Y+ NP+ V VG+LDL
Sbjct:  367 ELINLFSITYLVLDEADRMLDMGFEPQIMKILLDIRPDRQTVMTSATWPSGVRRLAKSYLKNPMMVYVGTLDL 439          
BLAST of ATP-dependent RNA helicase vs. Ensembl Medaka
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101160075])

HSP 1 Score: 322.398 bits (825), Expect = 3.038e-95
Identity = 185/401 (46.13%), Postives = 255/401 (63.59%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPDILTE-IRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKD 2277
            PNP+ +F E+ F  P  + E I KQ + EP+PIQ   WP+ ++G+D++GIAQTG+GKTL++LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q    +Y     + S   YGGA K  QI  L+   EI + TPGR+ D  +SG  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K  VQ+NVG L L+A H + Q V+     +K  +LV +L  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD  QQER+  L   + G   I+IATDVASRGLD+ D+  VINYD+P N E+Y+HR+GRT R+ +TG A+TF   N+M  A++LI +L++A+Q +   L Q+ +D
Sbjct:   98 PNPITHFHEASF--PSYVMEVINKQNWTEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPF-LERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQLSANHNILQIVDVCTDGEKENKLVRLLEEIMSEKENKTIIFVETKRRCDDLTRRM---RRDGW-------PAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINYDYPNNSEDYIHRIGRTARSSKTGTAYTFFTANNMRQASDLIAVLREANQAINPKLLQMAED 485          

HSP 2 Score: 130.568 bits (327), Expect = 2.203e-49
Identity = 78/221 (35.29%), Postives = 115/221 (52.04%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY++H D+   S +EVE +  R+  ++  + +  P                              PI  F E  +    ++++I   N+  PTPIQ  GWP+ L G+D +GIAQTG+GKTL+++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++    +  +   +KS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   62 FEKNFYQQHADVARRSPQEVEQY--RRTKVITVKGRECPN-----------------------------PITHFHEASFPS-YVMEVINKQNWTEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQ--PFLERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLR 248          

HSP 3 Score: 87.4261 bits (215), Expect = 2.203e-49
Identity = 43/80 (53.75%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++   VQ+NVG+L L      S  HN L
Sbjct:  249 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQL------SANHNIL 322          
BLAST of ATP-dependent RNA helicase vs. Ensembl Medaka
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101167926])

HSP 1 Score: 310.457 bits (794), Expect = 4.826e-91
Identity = 190/467 (40.69%), Postives = 270/467 (57.82%), Query Frame = 1
Query:  886 HRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKD 2277
             +NFY+EHP V+  +  E E++   K                     T   +D              P P+  F E+ F    ++  I KQ F +P+PIQ   WP+ ++G+D++GIAQTG+GKTLA+LLPA +HI+ QP   E   GP  L+L+PTRELA Q+Q    +Y     + S   YGGA K  QI  L+   EI + TPGR+ D  +    NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K+ VQ+N+G L L+A H + Q V+  +  +K  +L+ +L  I  + E+K IIFV  K +C +L   +   R  G         A  IHGD  QQER+  L   R G   I+IATDVASRGLD+ D+  VINYD+P + E+Y+HR+GRT R+ +TG A+TF   N+M  A +LI +L++A+Q +   L Q+ +D
Sbjct:   61 QKNFYQEHPDVTHRSPQEIEQYRRSKEV-------------------TVKGRD-------------CPKPMIKFNEASFPS-YVMDMIVKQNFTDPTPIQSQGWPVALSGKDMVGIAQTGSGKTLAYLLPAIVHIQHQPF-LEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECNKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINIGALQLSANHNILQIVDVCNDMEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRM---RRDGW-------PAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAGDLISVLREANQAINPKLIQMAED 483          

HSP 2 Score: 136.346 bits (342), Expect = 4.843e-51
Identity = 82/221 (37.10%), Postives = 117/221 (52.94%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKP-RQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY+EHPD+ + S +E+E +  R   + +K           DC                      KP+  F E  +    ++D+I   NF  PTPIQ  GWPV L G+D +GIAQTG+GKTL ++LPA++HI  Q +P  ++  GP  L+L+PTRELA Q++    +  +   +KS C YGGA K  QI  L    EI + TPGR+ D +     NL+
Sbjct:   60 FQKNFYQEHPDVTHRSPQEIEQY-RRSKEVTVK---------GRDC---------------------PKPMIKFNEASFPS-YVMDMIVKQNFTDPTPIQSQGWPVALSGKDMVGIAQTGSGKTLAYLLPAIVHI--QHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECNKTNLR 246          

HSP 3 Score: 87.4261 bits (215), Expect = 4.843e-51
Identity = 42/80 (52.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++ + VQ+N+G+L L      S  HN L
Sbjct:  247 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINIGALQL------SANHNIL 320          
BLAST of ATP-dependent RNA helicase vs. Ensembl Medaka
Match: ENSORLT00000031911.1 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101171584])

HSP 1 Score: 307.375 bits (786), Expect = 5.693e-90
Identity = 175/399 (43.86%), Postives = 251/399 (62.91%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMK 2274
            P P+ +F ++ F    ++  + +Q F+EP+ IQ   +P+ ++GRD++GIAQTG+GKTLA+LLPA +HI  QP   ++  GP  L+L+PTRELA Q+Q     Y     I S   YGGA K  QI  L+   EI + TPGR+ D  +SG  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   +K  VQ+N+G L+L+A H + Q V+     +K Q+L++++  I  + E+K IIFV  K +C DL   +   R  G         A  IHGD  Q ER+  L   RSG   ++IATDVASRGLD+ D+  VINYD+P + E+Y+HR+GRT R+   G A+TF    ++  A EL+R+L++A Q +   L QL++
Sbjct:   89 PKPLTSFHQAQFPQ-YVIDVLMQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LDRGDGPICLVLAPTRELAQQVQQVACDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALELSANHNILQIVDVCTESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRM---RRDGW-------PAMCIHGDKSQPERDWVLSEFRSGKAPVLIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTNKGTAYTFFTPGNVRQARELVRVLEEARQAINPKLLQLVE 475          

HSP 2 Score: 131.339 bits (329), Expect = 1.329e-49
Identity = 83/222 (37.39%), Postives = 115/222 (51.80%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPE-ILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY EH ++  +S  +VE F  RK  I ++                                G  KP+ SF +   + P+ ++D++   NF+ PT IQ  G+P+ L GRD +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   IKS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   53 FEKNFYSEHAEVERMSQFDVEEFR-RKKEITVR------------------------------GSGCPKPLTSFHQA--QFPQYVIDVLMQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLDRGDGPICLVLAPTRELAQQVQQVACDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLR 239          

HSP 3 Score: 87.4261 bits (215), Expect = 1.329e-49
Identity = 42/80 (52.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++   VQ+N+G+L+L      S  HN L
Sbjct:  240 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALEL------SANHNIL 313          
BLAST of ATP-dependent RNA helicase vs. Ensembl Medaka
Match: si:dkey-156n14.5 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101158507])

HSP 1 Score: 303.908 bits (777), Expect = 1.448e-88
Identity = 173/398 (43.47%), Postives = 250/398 (62.81%), Query Frame = 1
Query: 1087 PNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHD-IDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHI--KPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLM 2271
            P PV  F ++ F    ++  + +Q F+EP+ IQ   +P+ ++G+D++GIAQTG+GKTLA+LLPA +HI  QP   E+  GP  L+L+PTRELA Q+Q     Y     I S   YGGA K  QI  L+   EI + TPGR+ D  ++G  NL+  +YLVLDEADRMLDMGFE Q+  ++  +R  RQT+M SATWP  V+++A   ++  +Q+N+G L+L+A H + Q V+    ++K  +L++++  I  + E+K IIFV  K +C DL  ++   R  G         A  IHGD  Q ER+  L   RSG   I+IATDVASRGLD+ D+  VINYD+P + E+YVHR+GRT R+   G A+TF    ++  A +L+R+L++A Q +   L QL+
Sbjct:   92 PKPVTAFHQAHFPQ-YVMDVLMQQNFKEPTAIQSQGFPVALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPY-LERGDGPICLVLAPTRELAQQVQQVAYDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLREYIQINIGALELSANHNILQIVDVCMENEKDNKLLQLMEEIMAEKENKTIIFVETKKRCDDLTRKM---RRDGW-------PAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQLV 477          

HSP 2 Score: 135.191 bits (339), Expect = 1.930e-50
Identity = 84/221 (38.01%), Postives = 116/221 (52.49%), Query Frame = 2
Query: 2765 IHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRY-GPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLK 3421
              +NFY EHP+++++S  EVE F  RK  I I+                                G  KP+ +F +  +    ++D++   NF+ PT IQ  G+PV L G+D +GIAQTG+GKTL ++LPA++HI  Q  P   R  GP  L+L+PTRELA Q++       K   IKS C YGGA K  QI  L    EI + TPGR+ D +  G  NL+
Sbjct:   56 FEKNFYIEHPEVQHVSQFEVEEFR-RKKEITIR------------------------------GSGCPKPVTAFHQAHFPQ-YVMDVLMQQNFKEPTAIQSQGFPVALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQ--PYLERGDGPICLVLAPTRELAQQVQQVAYDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLR 242          

HSP 3 Score: 86.6557 bits (213), Expect = 1.930e-50
Identity = 41/80 (51.25%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHNFL 3711
            + +YLVLDEADRMLDMGFEPQ+  I++  R  RQ++M SATWP+ VRQ+A  ++   +Q+N+G+L+L      S  HN L
Sbjct:  243 RCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLREYIQINIGALEL------SANHNIL 316          
BLAST of ATP-dependent RNA helicase vs. Planmine SMEST
Match: SMESG000011907.1 (SMESG000011907.1)

HSP 1 Score: 1505.73 bits (3897), Expect = 0.000e+0
Identity = 894/895 (99.89%), Postives = 894/895 (99.89%), Query Frame = 1
Query:   37 MNDERTTIYVPSRHLGLIIGKGGSRIKELSEECGCRINIKKDQAVNDEVPVYLEGSSRNIEKAKSKIDEITRRQHKRHMNDNDSHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKRKSPNDDRNERSYDKDKYNSSRTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDHDNDYSHGSSKQXXXXXXXXXXXXXXXXXXXXXXXXXXADMDALIFSGEELMKSNLKSNFVPSESYVQDDDWGIPTYLEEEKPIRKRPDNANIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRNGSNFNRRNKFDDTDDVQTDSSWPDFTNRSLSINSKLSKCYIQDEASDNEYWGNWNQEVITEKEAQPDIVMLSPNKVEQQQQPNIKISTQHCIKPFILANKDRSEY 2721
            MNDERTTIYVPSRHLGLIIGKGGSRIKELSEECGCRINIKKDQAVNDEVPVYLEGSSRNIEKAKSKIDEITRRQHKRHMNDNDSHYNESDNDKSFSNSNYSNKRSSKYNDDDDYDNSSSWKRKSPNDDRNERSYDKDKYNSSRTDDSSWRNGNSRNNNSYNDNNNDYNSNSRSSYKDHDNDYSHGSSKQRANNVSRNNVANGDDWGGWGKKNDDNADMDALIFSGEELMKSNLKSNFVPSESYVQDDDWGIPTYLEEEKPIRKRPDNANIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDKNNIIIKEIESETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHRVGRTGRAGRTGEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRINGGGRGGRFGGRGGGRGRGGGGGGFGGGDRDRGGQRNGSNFNRRNKFDDTDDVQTDSSWPDFTNRSLSINSKLSKCYIQDEASDNEYWGNWNQEVITEKEAQPDIVMLSPNKVEQQQQPNIKISTQHCIKPFILANKDRS Y
Sbjct:    1 MNDERTTIYVPSRHLGLIIGKGGSRIKELSEECGCRINIKKDQAVNDEVPVYLEGSSRNIEKAKSKIDEITRRQHKRHMNDNDSHYNESDNDKSFSNSNYSNKRSSKYNDDDDYDNSSSWKRKSPNDDRNERSYDKDKYNSSRTDDSSWRNGNSRNNNSYNDNNNDYNSNSRSSYKDHDNDYSHGSSKQRANNVSRNNVANGDDWGGWGKKNDDNADMDALIFSGEELMKSNLKSNFVPSESYVQDDDWGIPTYLEEEKPIRKRPDNANIKMKCTKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDKNNIIIKEIESETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHRVGRTGRAGRTGEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQDYRINGGGRGGRFGGRGGGRGRGGGGGGFGGGDRDRGGQRNGSNFNRRNKFDDTDDVQTDSSWPDFTNRSLSINSKLSKCYIQDEASDNEYWGNWNQEVITEKEAQPDIVMLSPNKVEQQQQPNIKISTQHCIKPFILANKDRSIY 895          

HSP 2 Score: 477.248 bits (1227), Expect = 2.581e-169
Identity = 229/242 (94.63%), Postives = 231/242 (95.45%), Query Frame = 2
Query: 2702 IKTEVSI*GFSVVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
            I T+  I  F +   D  IYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV
Sbjct:  876 ISTQHCIKPFILANKDRSIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 1117          

HSP 3 Score: 140.198 bits (352), Expect = 2.581e-169
Identity = 67/68 (98.53%), Postives = 67/68 (98.53%), Query Frame = 1
Query: 3475 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIV 3678
            VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLI 
Sbjct: 1117 VSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIA 1184          

HSP 4 Score: 494.197 bits (1271), Expect = 2.224e-148
Identity = 260/468 (55.56%), Postives = 334/468 (71.37%), Query Frame = 1
Query:  862 KDSNFYPVHRNFYREHPSVSKMTIDEKEKFLL---DXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDF 2256
            KD + YP+HRNFY EHP +  ++++E E FLL   +     +K   ++  E  C+  +  FD+D  E++   P    I  P+R+FEE F+ HP+IL  I+   F+ P+PIQCI WP+++ GRD IGIAQTGTGKTL F+LPA IHIEGQ KPR+ R GPTVLILSPTRELA+QI++E+ K  YH+I SV CYGGA+K  QI  L++NPEIVVGTPGRI DL   G LNLKDVSYLVLDEADRMLDMGFE QVV++I   R+QRQ++MTSATWP  V++IAL +M NPVQVNVG+LDL AC+ V Q +++V   DKT  L+ I+  +   DK+I+FV RK QC  L   L        L P  ++  CEIHGDL Q++RE +L   R G  +I+IAT+VASRGLDI D+T V+NYDFPK+IEEYVHRVGRTGRAG+ G++ TFMN+ D  ++ EL  IL  ++Q  P +
Sbjct:  890 KDRSIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDED-CDQHNDDFDEDQVEVLPGTP---GIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIACNDVVQEIKFVTNFDKTNELINIICDMNETDKVIVFVTRKVQCRSLTKYLDKLIRSNQLSPFASI--CEIHGDLSQEDREQSLSWFRDGHCSILIATNVASRGLDIADITCVVNYDFPKDIEEYVHRVGRTGRAGKAGKSITFMNEADWKHSFELRNILIQSNQNAPSW 1351          

HSP 5 Score: 269.24 bits (687), Expect = 3.779e-95
Identity = 132/230 (57.39%), Postives = 168/230 (73.04%), Query Frame = 2
Query: 2747 DLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTP---GIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDV 3427
            D   YP+HRNFY EHP +  ++++E E FLL KNNI+IKE+++   +    C+  +  FD+D  E++   P    I  P+R+FEE F+ HP+IL  I+   F+ P+PIQCI WP+++ GRD IGIAQTGTGKTL F+LPA IHIEGQ KPR+ R GPTVLILSPTRELA+QI++E+ K  YH+I SV CYGGA+K  QI  L++NPEIVVGTPGRI DL   G LNLKDV
Sbjct:  277 DSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDKNNIIIKEIESETGE--SFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDV 504          

HSP 6 Score: 101.293 bits (251), Expect = 3.779e-95
Identity = 50/72 (69.44%), Postives = 61/72 (84.72%), Query Frame = 1
Query: 3457 LLIIIKVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            +L +  VSYLVLDEADRMLDMGFE QVV++I   R+QRQ++MTSATWP  V++IAL +M NPVQVNVG+LDL
Sbjct:  498 VLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDL 569          
BLAST of ATP-dependent RNA helicase vs. Planmine SMEST
Match: SMESG000005969.1 (SMESG000005969.1)

HSP 1 Score: 340.117 bits (871), Expect = 7.612e-102
Identity = 199/465 (42.80%), Postives = 281/465 (60.43%), Query Frame = 1
Query:  880 PVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVC-YGGADKRDQIYQL-KENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            P  +NFY EHP V+  +  E ++F                             ++ +E+     + K +P P+ NF E  F +  ILT I K K+  P+PIQC  WP+ M+GR+++GIAQTG+GKT AFLLPA IHI  QP P     GP  L+L PTRELA Q+++ V+++      ++VC YGG+D+++QI  L  + PEI+V TPGR+ DL      NL+  +YLVLDEADRMLDMGFE Q+  ++  VR  RQ ++ SATWP  V+R+A   +   +QVN+G + L+A H + Q+VE +D   K +RL+E+L       K ++FVA K +C  ++ ++   RS          KA  +HGD  Q+ERE AL+  R+G  NIM+ATDVASRGLDI D+  VINYDFP  IE+YVHR+GRT R  + G ++TF   N+  +A +L+ IL++A Q + D L  L
Sbjct:   42 PFKKNFYIEHPIVTARSSYEIDRF-----------------------------RNEKEMT---VVGKNVPRPIFNFSEMNFPN-FILTTILKNKWVRPTPIQCQGWPMAMSGRNVVGIAQTGSGKTAAFLLPALIHIRAQP-PLVAGDGPICLVLVPTRELAQQVESVVEEFGISGGFNMVCVYGGSDRQNQIKNLHTKRPEILVATPGRLLDLLKQNETNLRRTTYLVLDEADRMLDMGFEPQIRAVLNQVRPDRQMLLWSATWPLEVRRLAEDFLNEYIQVNIGAMSLHANHNICQYVEVIDEFGKERRLIELLKQFNGL-KTLVFVALKKRCDRMS-DMLNSRS---------FKALAMHGDKPQRERERALENFRNGRSNIMVATDVASRGLDIDDIMLVINYDFPTQIEDYVHRIGRTARQEKKGTSYTFFTNNEKKHAQKLVSILEEATQNISDKLYDL 461          

HSP 2 Score: 128.642 bits (322), Expect = 8.114e-47
Identity = 81/224 (36.16%), Postives = 115/224 (51.34%), Query Frame = 2
Query: 2756 IYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYH-NIKSVCCYGGAEKMYQINSLR-DNPEIVVGTPGRINDLVLMGCLNLK 3421
            + P  +NFY EHP +   S  E++ F                                ++ E+      + +PI +F EM + +  +  I+K   +  PTPIQC GWP+ + GR+ +GIAQTG+GKT  F+LPALIHI  Q  P     GP  L+L PTRELA Q+ES + +         VC YGG+++  QI +L    PEI+V TPGR+ DL+     NL+
Sbjct:   40 LMPFKKNFYIEHPIVTARSSYEIDRF-------------------------------RNEKEMTVVGKNVPRPIFNFSEMNFPNFILTTILKN-KWVRPTPIQCQGWPMAMSGRNVVGIAQTGSGKTAAFLLPALIHIRAQ-PPLVAGDGPICLVLVPTRELAQQVESVVEEFGISGGFNMVCVYGGSDRQNQIKNLHTKRPEILVATPGRLLDLLKQNETNLR 230          

HSP 3 Score: 80.4925 bits (197), Expect = 8.114e-47
Identity = 35/67 (52.24%), Postives = 52/67 (77.61%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +YLVLDEADRMLDMGFEPQ+ +++N  R  RQ ++ SATWP  VR++A  +++  +QVN+G++ L
Sbjct:  231 RTTYLVLDEADRMLDMGFEPQIRAVLNQVRPDRQMLLWSATWPLEVRRLAEDFLNEYIQVNIGAMSL 297          
BLAST of ATP-dependent RNA helicase vs. Planmine SMEST
Match: SMESG000033908.1 (SMESG000033908.1)

HSP 1 Score: 315.079 bits (806), Expect = 2.041e-93
Identity = 186/467 (39.83%), Postives = 274/467 (58.67%), Query Frame = 1
Query:  871 NFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYH-DIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            N  P  +NFYRE+P VS  +  E E                    ++      T   D             I  P+ +F E      +I++ IR  K+ EP+PIQ    P+ ++GR+L+G+A+TG+GKT ++L+PA +H++ QP P  +  GP  LI+ PTRELA Q+Q     +     I SV  YGGA+K DQI QL+   EI+V TPGR+ DL  S + NL   +Y+VLDEADRMLDMGFE Q+  +   VR+ RQT+M SATWP  VQR+A   +   +QVN+G+ +L+A   ++Q VE +D + K +RL+E+++   P DK+I+F   K +   +    FL+  +  +G         +HGD  Q +RE  L   R    NI++ATDVASRGLD+ D+  VINYDFP   E+Y+HR+GRTGR G++G ++TF N+ +  +A +L++++++A+Q V D L  L
Sbjct:   95 NLIPFEKNFYRENPVVSNRSSSEIE--------------------NYRRLKEMTVKGDN------------INKPIFSFNEIDLSR-EIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQP-PLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRSGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKT-PRDKMIVFAETKKKADMIC--SFLRSKQFRVGA--------MHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 516          

HSP 2 Score: 135.191 bits (339), Expect = 1.079e-48
Identity = 82/230 (35.65%), Postives = 121/230 (52.61%), Query Frame = 2
Query: 2732 SVVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNL 3418
            SV +    + P  +NFY E+P + N S  E+E++         + LK    + D                       I KPI SF E+     EI+ +I+   +  PTPIQ  G P+ L GR+ +G+A+TG+GKT ++++PA++H++ Q  P +   GP  LI+ PTRELA Q+++      +   I+SVC YGGA K  QI  LR   EI+V TPGR+ DL+     NL
Sbjct:   88 SVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENY---------RRLKEMTVKGD----------------------NINKPIFSFNEIDLSR-EIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQ-PPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRSGAEIIVATPGRLIDLLKSSITNL 284          

HSP 3 Score: 80.1073 bits (196), Expect = 1.079e-48
Identity = 35/67 (52.24%), Postives = 52/67 (77.61%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +Y+VLDEADRMLDMGFEPQ+  I +  R+ RQ++M SATWP+ V+++A  ++   +QVN+GS +L
Sbjct:  286 RTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQEL 352          
BLAST of ATP-dependent RNA helicase vs. Planmine SMEST
Match: SMESG000033916.1 (SMESG000033916.1)

HSP 1 Score: 314.309 bits (804), Expect = 2.946e-93
Identity = 186/467 (39.83%), Postives = 274/467 (58.67%), Query Frame = 1
Query:  871 NFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYH-DIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQL 2268
            N  P  +NFYRE+P VS  +  E E                    ++      T   D             I  P+ +F E      +I++ IR  K+ EP+PIQ    P+ ++GR+L+G+A+TG+GKT ++L+PA +H++ QP P  +  GP  LI+ PTRELA Q+Q     +     I SV  YGGA+K DQI QL+   EI+V TPGR+ DL  S + NL   +Y+VLDEADRMLDMGFE Q+  +   VR+ RQT+M SATWP  VQR+A   +   +QVN+G+ +L+A   ++Q VE +D + K +RL+E+++   P DK+I+F   K +   +    FL+  +  +G         +HGD  Q +RE  L   R    NI++ATDVASRGLD+ D+  VINYDFP   E+Y+HR+GRTGR G++G ++TF N+ +  +A +L++++++A+Q V D L  L
Sbjct:   89 NLIPFEKNFYRENPVVSNRSSSEIE--------------------NYRRLKEMTVKGDN------------INKPIFSFNEIDLSR-EIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQP-PLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRNGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKT-PRDKMIVFAETKKKADMICS--FLRSKQFRVG--------AMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 510          

HSP 2 Score: 136.346 bits (342), Expect = 5.384e-49
Identity = 82/230 (35.65%), Postives = 122/230 (53.04%), Query Frame = 2
Query: 2732 SVVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKI-KYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNL 3418
            SV +    + P  +NFY E+P + N S  E+E++         + LK    + D                       I KPI SF E+     EI+ +I+   +  PTPIQ  G P+ L GR+ +G+A+TG+GKT ++++PA++H++ Q  P +   GP  LI+ PTRELA Q+++      +   I+SVC YGGA K  QI  LR+  EI+V TPGR+ DL+     NL
Sbjct:   82 SVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENY---------RRLKEMTVKGD----------------------NINKPIFSFNEIDLSR-EIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQ-PPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRNGAEIIVATPGRLIDLLKSSITNL 278          

HSP 3 Score: 80.1073 bits (196), Expect = 5.384e-49
Identity = 35/67 (52.24%), Postives = 52/67 (77.61%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +Y+VLDEADRMLDMGFEPQ+  I +  R+ RQ++M SATWP+ V+++A  ++   +QVN+GS +L
Sbjct:  280 RTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQEL 346          
BLAST of ATP-dependent RNA helicase vs. Planmine SMEST
Match: SMESG000033348.1 (SMESG000033348.1)

HSP 1 Score: 315.849 bits (808), Expect = 3.197e-93
Identity = 192/501 (38.32%), Postives = 283/501 (56.49%), Query Frame = 1
Query:  859 TKDSNFYPVHRNFYREHPSVSKMTIDEKEKFLLDXXXXXXXXXXSETGESFCNFGSTTFDKDPEELIDEIPIPKVIPNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYH-DIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPEDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIP-------------------DLTKVINYDFPKNIEEYVHXXXXXXXXXXXXEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMK-DHQDYRIN 2298
            + D NF P  +NFY+E+  VS  +  E E +              E      N     F        DEI + +                 +I++ IR  K+ EP+PIQ    P+ ++GR+L+G+A+TG+GKT ++L+PA +H++ QP P  +  GP  LI+ PTRELA Q+Q     ++    I SV  YGGA+K DQI QL+   EI+V TPGR+ DL  S + NL   +Y+VLDEADRMLDMGFE Q+  +   VR+ RQT+M SATWP  VQR+A   +   +QVN+G+ +L+A   ++Q VE +D H K +RL+EI++   P DK+I+F   K +   + +  FL+  +  +G         +HGD  Q +R+  LK  R    NI++ATDVASRGL IP                   D+  VINYDFP   E+Y+HR+GRTGR  +TG ++TF N+N+  +AA L+++++ ++Q VP+ L   +   + DY +N
Sbjct:  131 SNDQNFIPFQKNFYQENRVVSNRSSSEIENY----------RRLKEMTVKGDNINKPIFS------FDEIDLSR-----------------EIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQP-PLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSK-NPNDKMIVFAETKKKADIICY--FLRSKQFRVGA--------MHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLVIPNYKWVINLNLLAYRYSNIDDIKIVINYDFPNQFEDYIHRIGRTGRKDKTGLSYTFFNENNSRSAASLVKVMEKSNQIVPEALYNFIHYKNNDYAVN 586          

HSP 2 Score: 132.494 bits (332), Expect = 2.272e-48
Identity = 81/229 (35.37%), Postives = 119/229 (51.97%), Query Frame = 2
Query: 2735 VVYTDLGIYPIHRNFYEEHPDIRNLSLEEVESFLLRKNNIMIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWKHPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYH-NIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNL 3418
            V   D    P  +NFY+E+  + N S  E+E++         + LK    + D                       I KPI SF+E+     EI+ +I+   +  PTPIQ  G P+ L GR+ +G+A+TG+GKT ++++PA++H++ Q  P +   GP  LI+ PTRELA Q+++          I+SVC YGGA K  QI  LR   EI+V TPGR+ DL+     NL
Sbjct:  129 VNSNDQNFIPFQKNFYQENRVVSNRSSSEIENY---------RRLKEMTVKGD----------------------NINKPIFSFDEIDLSR-EIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQ-PPLRRGDGPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNL 324          

HSP 3 Score: 81.6481 bits (200), Expect = 2.272e-48
Identity = 35/67 (52.24%), Postives = 52/67 (77.61%), Query Frame = 1
Query: 3472 KVSYLVLDEADRMLDMGFEPQVVSIINDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDL 3672
            + +Y+VLDEADRMLDMGFEPQ+  I +  R+ RQ++M SATWP+ V+++A  ++   +QVN+GS +L
Sbjct:  326 RTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQEL 392          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX431.355e-11643.85DEAD-box helicase 43 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX535.482e-10143.00DEAD-box helicase 53 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX51.398e-9039.48DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX51.849e-9039.48DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX172.954e-9044.80DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y54G11A.31.329e-11146.97pep chromosome:WBcel235:II:14276621:14283973:1 gen... [more]
ddx-175.996e-9240.99DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-175.996e-9240.99DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-175.996e-9240.99DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-175.996e-9240.99DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG78782.071e-12748.13gene:FBgn0037549 transcript:FBtr0113205[more]
Rm621.867e-9638.81gene:FBgn0003261 transcript:FBtr0302597[more]
Rm621.867e-9638.81gene:FBgn0003261 transcript:FBtr0078653[more]
Rm622.008e-9638.81gene:FBgn0003261 transcript:FBtr0301947[more]
Rm622.008e-9638.81gene:FBgn0003261 transcript:FBtr0078650[more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx434.220e-12149.88DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:... [more]
ddx51.065e-9244.14DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx51.497e-9044.33DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
DDX172.636e-8843.97si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:dkey-156n14.53.634e-8843.14si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx439.627e-12444.31DEAD-box helicase 43 [Source:NCBI gene;Acc:779928][more]
ddx434.366e-11749.23DEAD-box helicase 43 [Source:NCBI gene;Acc:779928][more]
ddx431.329e-11649.23DEAD-box helicase 43 [Source:NCBI gene;Acc:779928][more]
ddx431.407e-11649.23DEAD-box helicase 43 [Source:NCBI gene;Acc:779928][more]
ddx433.576e-11649.23DEAD-box helicase 43 [Source:NCBI gene;Acc:779928][more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx432.580e-12044.82DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:... [more]
Ddx173.501e-9144.80DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx173.681e-9144.80DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx53.514e-9039.27DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:M... [more]
Ddx174.342e-7740.35DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NXZ2|DDX43_HUMAN6.506e-11643.85Probable ATP-dependent RNA helicase DDX43 OS=Homo ... [more]
sp|Q86TM3|DDX53_HUMAN2.633e-10043.00Probable ATP-dependent RNA helicase DDX53 OS=Homo ... [more]
sp|Q755N4|DBP2_ASHGO3.969e-10043.70ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii... [more]
sp|P0CQ76|DBP2_CRYNJ1.134e-9948.01ATP-dependent RNA helicase DBP2-A OS=Cryptococcus ... [more]
sp|P0CQ77|DBP2_CRYNB1.134e-9948.01ATP-dependent RNA helicase DBP2-A OS=Cryptococcus ... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6GVC31.595e-14052.21Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
A0A1B6L5T61.673e-14052.38Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A087ZUZ19.899e-14051.15Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
A0A2A3E7G44.571e-13950.52ATP-dependent RNA helicase OS=Apis cerana cerana O... [more]
A0A0L7QSF01.557e-13750.32Putative ATP-dependent RNA helicase DDX43 OS=Habro... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx431.708e-12051.12DEAD-box helicase 43 [Source:NCBI gene;Acc:1030214... [more]
ddx437.081e-9846.57DEAD-box helicase 43 [Source:NCBI gene;Acc:1030214... [more]
DDX51.620e-9341.11probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx54.645e-9241.16probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx462.059e-7837.87DEAD-box helicase 46 [Source:NCBI gene;Acc:1030417... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006773.11.371e-7944.58pep scaffold:Pmarinus_7.0:GL491147:244:6091:-1 gen... [more]
ddx461.337e-7837.53DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ENSPMAT00000006776.18.352e-7653.51pep scaffold:Pmarinus_7.0:GL491147:247:4468:-1 gen... [more]
ENSPMAT00000003898.19.045e-7437.56pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx421.727e-7141.13DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP22.651e-9846.15ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP35.583e-7842.08RNA-Dependent ATPase, member of DExD/H-box family;... [more]
DED11.703e-7739.07ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP13.012e-7639.81Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
PRP282.732e-6037.99RNA binding protein; involved in RNA isomerization... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO396992.417e-12851.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380619.099e-9145.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428941.711e-7837.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435571.271e-7535.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
PL104.426e-7539.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx435.213e-11946.50DEAD-box helicase 43 [Source:NCBI gene;Acc:1011663... [more]
ddx53.038e-9546.13probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
DDX54.826e-9140.69probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ENSORLT00000031911.15.693e-9043.86probable ATP-dependent RNA helicase DDX17 [Source:... [more]
si:dkey-156n14.51.448e-8843.47probable ATP-dependent RNA helicase DDX17 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011907.12.581e-16999.89SMESG000011907.1[more]
SMESG000005969.17.612e-10242.80SMESG000005969.1[more]
SMESG000033908.12.041e-9339.83SMESG000033908.1[more]
SMESG000033916.12.946e-9339.83SMESG000033916.1[more]
SMESG000033348.13.197e-9338.32SMESG000033348.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030038 ID=SMED30030038|Name=ATP-dependent RNA helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=4761bp
CAGTACTTTTAAATTTTTTATAATACTTTTTGTTTAATGAATGACGAAAG
AACAACTATATATGTCCCATCAAGGCATTTGGGCTTGATTATAGGTAAAG
GCGGTTCTCGAATAAAAGAACTTTCTGAAGAATGCGGTTGTCGAATAAAT
ATAAAAAAGGATCAAGCTGTAAATGATGAAGTACCGGTGTATTTAGAAGG
TTCTTCAAGGAATATAGAAAAAGCAAAGTCTAAAATAGATGAAATAACTA
GACGTCAACATAAGCGTCACATGAATGATAATGATAGTCATTATAATGAA
AGTGATAATGACAAGTCTTTCTCAAATAGTAATTACTCAAATAAGCGATC
GTCTAAATATAATGATGATGATGATTATGATAACAGTTCTTCATGGAAAA
GAAAATCTCCGAACGACGACAGAAATGAAAGGTCTTATGATAAAGATAAA
TATAACAGTAGTAGAACAGATGATAGTTCATGGAGAAATGGAAATAGTCG
AAATAACAATAGCTACAATGATAACAATAACGATTATAATAGTAACTCAA
GAAGTAGCTACAAAGATCATGATAACGATTATTCACATGGATCTAGTAAG
CAGCGTGCCAATAATGTTTCAAGGAATAATGTAGCCAATGGTGATGATTG
GGGAGGATGGGGAAAGAAAAATGACGATAATGCAGATATGGATGCTTTGA
TATTTTCAGGTGAAGAACTTATGAAGAGTAATTTAAAATCTAACTTCGTT
CCGAGTGAAAGTTATGTGCAAGATGATGATTGGGGAATTCCAACATATCT
GGAGGAAGAAAAACCTATTAGAAAAAGGCCAGATAACGCAAATATTAAGA
TGAAATGTACTAAAGATAGTAATTTTTACCCAGTTCACAGAAATTTTTAT
CGTGAACATCCTTCTGTGTCAAAAATGACAATTGACGAAAAGGAAAAATT
TTTATTAGATAAAAATAATATCATTATTAAAGAAATAGAATCTGAAACCG
GGGAATCATTTTGTAATTTTGGAAGTACAACATTTGACAAAGACCCAGAA
GAATTAATTGATGAAATTCCAATTCCCAAAGTGATTCCAAATCCAGTTCG
AAATTTTGAAGAGTCATTTTTTGATCACCCAGATATTTTAACAGAAATTA
GGAAACAGAAATTTCAAGAACCATCACCTATTCAATGTATTGCATGGCCG
ATTTTAATGACGGGGCGGGATTTAATAGGTATTGCTCAGACAGGAACTGG
AAAAACATTGGCTTTCTTATTACCTGCATTTATTCACATTGAAGGGCAAC
CAAAACCTAGAGAAAAACGACAGGGTCCTACTGTATTAATTTTGAGTCCT
ACGAGAGAATTAGCAATTCAAATTCAAAACGAGGTTCAGAAATATACATA
TCACGATATCGATTCAGTTGTTTGTTATGGAGGAGCAGACAAGCGTGATC
AAATTTATCAATTGAAAGAAAACCCTGAAATAGTTGTCGGTACTCCTGGG
CGTATTCAAGATTTGAAAGATTCTGGTGTATTGAATTTGAAAGATGTCAG
TTATTTGGTTCTTGACGAAGCTGATCGAATGCTTGATATGGGTTTTGAAA
TACAAGTTGTCAATTTAATATACGCCGTTCGAAGACAAAGACAAACTGTC
ATGACAAGTGCCACATGGCCTTTCGGTGTTCAACGAATCGCTTTGACTCA
TATGAAAAATCCAGTTCAAGTCAATGTTGGAACTCTGGATCTAAATGCCT
GTCATACAGTCAAACAACATGTGGAATATGTCGATTATCACGATAAAACT
CAGAGACTAGTTGAAATACTCGCACACATTAAACCGGAAGATAAAATCAT
TATTTTCGTGGCACGAAAAGCACAGTGTAGCGATTTGGCATTTGAGTTAT
TTTTGAAAAGATCAAAAGGCCTATTGGGTCCGAAAGGAGCAGTTAAAGCC
TGTGAAATTCACGGAGATTTAGATCAACAAGAAAGAGAAATGGCATTGAA
AATGATGAGATCTGGCGCTAGAAATATTATGATAGCTACAGATGTTGCAT
CTCGCGGTCTCGATATTCCCGATTTAACAAAGGTTATCAATTATGACTTC
CCAAAGAACATCGAAGAATATGTTCATCGTGTAGGCAGAACGGGTCGAGC
CGGGCGAACCGGTGAAGCATTCACATTCATGAACAAAAATGATATGAGCA
ATGCAGCAGAATTAATCAGAATTCTCCAAGATGCTGACCAAGAGGTTCCA
GATTTTCTGCCACAATTAATGAAAGATCACCAGGATTATCGAATTAATGG
CGGCGGTCGTGGTGGAAGGTTTGGTGGTCGTGGCGGTGGACGAGGCAGAG
GAGGAGGAGGAGGAGGATTCGGTGGTGGTGATCGAGATCGTGGTGGGCAA
AGAAATGGATCGAATTTCAACCGCCGAAATAAATTCGACGATACAGACGA
TGTTCAAACCGATTCCAGTTGGCCAGATTTCACAAATCGCTCTTTAAGTA
TTAATTCAAAATTGAGTAAATGTTATATACAAGACGAAGCTAGTGATAAC
GAATACTGGGGAAATTGGAATCAGGAAGTTATTACGGAAAAAGAAGCTCA
ACCAGATATAGTTATGCTCTCACCGAATAAAGTCGAACAACAACAACAAC
CGAACATCAAAATAAGCACTCAGCACTGTATTAAACCGTTTATTTTGGCC
AATAAAGACAGAAGTGAGTATTTGAGGTTTTTCTGTTGTTTATACCGATT
TAGGCATTTACCCAATTCATCGTAATTTTTACGAGGAACATCCGGATATC
AGAAATCTGTCACTGGAGGAAGTCGAATCGTTTTTGTTGAGGAAGAATAA
TATAATGATTAAAGAATTGAAAACTTTTCCAACGCAACTCGATGAAGATT
GTGATCAACATAATGATGATTTTGATGAAGATCAAGTTGAGGTATTGCCA
GGAACACCGGGAATTGCCAAGCCGATAAGATCATTTGAAGAAATGTTTTG
GAAACATCCGGAAATTCTAGATATTATCAAAGCGTTGAATTTTGAGACTC
CTACTCCAATTCAATGCATTGGTTGGCCAGTGATATTGGGCGGTAGGGAT
TTTATCGGAATTGCTCAAACTGGTACCGGGAAAACGTTAACATTTGTTTT
ACCGGCCTTAATTCATATCGAGGGACAAATGAAACCTAGACAGTATCGAT
ACGGTCCTACAGTTCTTATTCTAAGCCCAACTAGAGAATTAGCTATGCAA
ATTGAGAGTGAAATTTTGAAAATAAAATACCACAATATTAAATCGGTTTG
TTGCTATGGAGGAGCTGAAAAAATGTATCAAATTAATTCTTTAAGAGACA
ATCCAGAAATTGTCGTTGGTACTCCTGGTCGTATTAATGATCTCGTTTTA
ATGGGATGCTTGAATTTAAAAGACGTAATACAGTAGTTATTCGATATGAG
GTGGATTTATTGATAATAATCAAGGTCAGCTATTTGGTGCTTGATGAAGC
TGATAGGATGCTAGATATGGGATTTGAACCCCAGGTAGTTAGCATTATCA
ATGATACTAGAAAACAACGCCAATCGATTATGACAAGTGCTACATGGCCG
GAATGTGTCAGGCAAATTGCGTTGTTATACATGGATAATCCGGTTCAAGT
TAACGTAGGCTCATTGGATCTCATAGTTAGTTTATATAGTTCTTTGTATC
ATAATTTCCTTTCAGATATAATTTTTTAATAGGTTTACTGATTATCTAAT
CTTTAATTTCATTTCTCCTCAACTTATAAATTCTTCATTTTAACATGAAT
TTATTGATACACAATAGTTAGGGGGCTTGGTAACTCAGGGTTTAGAAATC
TCAACTAATATCGATTTATAAAACGATTATTGAATAATTTTCCCACCTTT
TTACGAACATAAAATTATTTCTGAAGATTATCGATTGTTTTAATTTTTCA
TAAGATTAATCGAGAATCAAGTAACCTTTGTTGGTTTTCAAAGTAATATA
TTCTTATAGAGCTTAATATTACCAATGATTTTTCCTATCGGTCAATAAAG
AAAATTTATTCTATAAATTTTCGAAAAAGAATAAATTCGGACATGGAATT
ATTTTTGTTGATTATCGATTGATATTGAAAATCAATAACGGTCGATTCTT
GCTTTTTATTAATTAGCGCTCTTATTAATTTCCAACACTGACGACAATGT
GACTTATAGATTTGTAGACCATGCGGAACAATGCAATACAAATGACTGAT
CATTGAAATCGATTTTTTACACTTGAGTTTTGTGATAAGAACAATAAGAA
TTTCCTAAAAATTATGGTCCTAAGAATGATAATATTTAAAAAACATTTTA
TTGAACTAAAAAATTAAAATCAAAAACACTTGGTTTAAATATTTTCTAGC
TCGGTTTGCGACTAATGCGTGTCCATGTTCGTTGGTTGATTTTCTACAAT
CTGTATGTGTCGGACAATGTAAGTGTGATCCAAGAATTATAAAGTTGCAG
AAGCATTGGTTCCATAAATCTGAAATGCCAACCAAAAGTTTTATAAATGC
ATATAGAAAAAACAAAAAAATGAATTGATAAATCTTTTTGTTGATTGAAT
ATTAATTTTACGGAATTGTGATTTAATCAATATTTTTTTTCTATACTCAA
TTTTATTACCAAACCCTTCAAAAGATCTAAAAAAATGATGTTCCCGAGTG
TTATTATTTATTTTATTATTATTTATGGACGGCATTTTATATACCGTTAA
TAAATTATTTC
back to top

protein sequence of SMED30030038-orf-1

>SMED30030038-orf-1 ID=SMED30030038-orf-1|Name=SMED30030038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MLEFKRRNTVVIRYEVDLLIIIKVSYLVLDEADRMLDMGFEPQVVSIIND
TRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIVSLYSSLYHN
FLSDIIF*
back to top

protein sequence of SMED30030038-orf-2

>SMED30030038-orf-2 ID=SMED30030038-orf-2|Name=SMED30030038-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=913bp
MNDERTTIYVPSRHLGLIIGKGGSRIKELSEECGCRINIKKDQAVNDEVP
VYLEGSSRNIEKAKSKIDEITRRQHKRHMNDNDSHYNESDNDKSFSNSNY
SNKRSSKYNDDDDYDNSSSWKRKSPNDDRNERSYDKDKYNSSRTDDSSWR
NGNSRNNNSYNDNNNDYNSNSRSSYKDHDNDYSHGSSKQRANNVSRNNVA
NGDDWGGWGKKNDDNADMDALIFSGEELMKSNLKSNFVPSESYVQDDDWG
IPTYLEEEKPIRKRPDNANIKMKCTKDSNFYPVHRNFYREHPSVSKMTID
EKEKFLLDKNNIIIKEIESETGESFCNFGSTTFDKDPEELIDEIPIPKVI
PNPVRNFEESFFDHPDILTEIRKQKFQEPSPIQCIAWPILMTGRDLIGIA
QTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEV
QKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLN
LKDVSYLVLDEADRMLDMGFEIQVVNLIYAVRRQRQTVMTSATWPFGVQR
IALTHMKNPVQVNVGTLDLNACHTVKQHVEYVDYHDKTQRLVEILAHIKP
EDKIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQER
EMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHRVG
RTGRAGRTGEAFTFMNKNDMSNAAELIRILQDADQEVPDFLPQLMKDHQD
YRINGGGRGGRFGGRGGGRGRGGGGGGFGGGDRDRGGQRNGSNFNRRNKF
DDTDDVQTDSSWPDFTNRSLSINSKLSKCYIQDEASDNEYWGNWNQEVIT
EKEAQPDIVMLSPNKVEQQQQPNIKISTQHCIKPFILANKDRSEYLRFFC
CLYRFRHLPNSS*
back to top

protein sequence of SMED30030038-orf-3

>SMED30030038-orf-3 ID=SMED30030038-orf-3|Name=SMED30030038-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MIKELKTFPTQLDEDCDQHNDDFDEDQVEVLPGTPGIAKPIRSFEEMFWK
HPEILDIIKALNFETPTPIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLP
ALIHIEGQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCC
YGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0016740transferase activity
GO:0016787hydrolase activity
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0004386helicase activity
Vocabulary: biological process
TermDefinition
GO:0006955immune response
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR014001Helicase_ATP-bd
IPR011545DEAD/DEAH_box_helicase_dom
IPR027417P-loop_NTPase
IPR014014RNA_helicase_DEAD_Q_motif
IPR000629RNA-helicase_DEAD-box_CS
IPR004087KH_dom
IPR001650Helicase_C
IPR004088KH_dom_type_1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 53..73
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 564..750
e-value: 1.6E-53
score: 182.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 343..563
e-value: 9.1E-83
score: 278.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..171
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..211
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..90
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 755..808
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..200
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 348..733
NoneNo IPR availablePANTHERPTHR24031:SF242ATP-DEPENDENT RNA HELICASE DDX43-RELATEDcoord: 348..733
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 3..67
score: 17.611
NoneNo IPR availableCDDcd17958DEADc_DDX43_DDX53coord: 367..562
e-value: 1.39495E-95
score: 296.683
NoneNo IPR availableCDDcd00105KH-Icoord: 7..67
e-value: 9.33889E-17
score: 73.3631
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 575..714
e-value: 3.66851E-53
score: 179.24
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 375..578
e-value: 1.4E-59
score: 214.0
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 387..562
score: 30.289
IPR004087K Homology domainSMARTSM00322kh_6coord: 2..72
e-value: 8.0E-17
score: 71.9
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 617..706
e-value: 1.0E-28
score: 111.4
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 586..706
e-value: 1.4E-29
score: 102.7
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 590..745
score: 22.051
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 2..76
e-value: 4.3E-19
score: 69.9
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 6..73
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 6..68
e-value: 2.7E-15
score: 55.9
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 381..550
e-value: 9.3E-46
score: 155.8
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 508..516
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 356..384
score: 8.49
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 429..721