Argininosuccinate lyase

Overview
NameArgininosuccinate lyase
Smed IDSMED30030034
Length (bp)1597
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Argininosuccinate lyase (SMED30030034) t-SNE clustered cells

Violin plots show distribution of expression levels for Argininosuccinate lyase (SMED30030034) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Argininosuccinate lyase (SMED30030034) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Argininosuccinate lyase (SMED30030034) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030034

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30030034h1SMcG0018054 SmedASXL_005315SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30030034h1SMcG0018054 SmedASXL_005315SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30030034h1SMcG0018054 dd_Smed_v4_3792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030034h1SMcG0018054 dd_Smed_v4_3792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030034h1SMcG0018054 dd_Smed_v4_3792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030034h1SMcG0018054 dd_Smed_v4_3792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030034h1SMcG0018054 Contig39428newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030034h1SMcG0018054 Contig39428uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30030034h1SMcG0018054 dd_Smed_v6_3792_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Argininosuccinate lyase vs. Ensembl Human
Match: ASL (argininosuccinate lyase [Source:HGNC Symbol;Acc:HGNC:746])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 258/448 (57.59%), Postives = 338/448 (75.45%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FNASI +D+ LW  D+ GSKAY+  + K  LLT  E ++++ GLD++ EEW    F LN  DEDIHTANERRLKELIG T GKLHTGRSRNDQV TD RLW RQ        +   I+ +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM++++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV+ +W+Y +SVEQY  LGGT+  SV++QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQV 455          
BLAST of Argininosuccinate lyase vs. Ensembl Human
Match: ASL (argininosuccinate lyase [Source:HGNC Symbol;Acc:HGNC:746])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 258/448 (57.59%), Postives = 338/448 (75.45%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FNASI +D+ LW  D+ GSKAY+  + K  LLT  E ++++ GLD++ EEW    F LN  DEDIHTANERRLKELIG T GKLHTGRSRNDQV TD RLW RQ        +   I+ +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM++++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV+ +W+Y +SVEQY  LGGT+  SV++QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQV 455          
BLAST of Argininosuccinate lyase vs. Ensembl Human
Match: ASL (argininosuccinate lyase [Source:HGNC Symbol;Acc:HGNC:746])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 245/448 (54.69%), Postives = 324/448 (72.32%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FNASI +D+ LW  D+ GSKAY+  + K  LLT  E ++++ GLD++ EEW    F LN  DEDIHTANERRLKELIG T GKLHTGRSRNDQV TD RLW RQ        +   I+ +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G                    +EDKE++F++ DTM++++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV+ +W+Y +SVEQY  LGGT+  SV++QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFG--------------------REDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQV 435          
BLAST of Argininosuccinate lyase vs. Ensembl Human
Match: ASL (argininosuccinate lyase [Source:HGNC Symbol;Acc:HGNC:746])

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 246/448 (54.91%), Postives = 320/448 (71.43%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FNASI +D+ LW  D+ GSKAY+  + K  LLT  E ++++ GLD++ EEW    F LN  DEDIHTANERRLKELIG T GKLHTGRSRNDQV TD RLW RQ        +   I+ +  RA +E ++L PGYTHLQ+AQPIRWSHW++S                          GA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM++++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV+ +W+Y +SVEQY  LGGT+  SV++QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILS--------------------------GAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQV 429          
BLAST of Argininosuccinate lyase vs. Ensembl Human
Match: ASL (argininosuccinate lyase [Source:HGNC Symbol;Acc:HGNC:746])

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 246/448 (54.91%), Postives = 320/448 (71.43%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FNASI +D+ LW  D+ GSKAY+  + K  LLT  E ++++ GLD++ EEW    F LN  DEDIHTANERRLKELIG T GKLHTGRSRNDQV TD RLW RQ        +   I+ +  RA +E ++L PGYTHLQ+AQPIRWSHW++S                          GA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM++++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV+ +W+Y +SVEQY  LGGT+  SV++QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILS--------------------------GAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQV 429          
BLAST of Argininosuccinate lyase vs. Ensembl Celegans
Match: fum-1 (Probable fumarate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O17214])

HSP 1 Score: 48.9062 bits (115), Expect = 5.061e-6
Identity = 45/214 (21.03%), Postives = 84/214 (39.25%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWC-RQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSM---------NSLDGVSSRDYIVELQSCATICAINLSRLAEDL-IIYSTKEFSFVRIS-DAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAI 1030
            +S ND   T   +   R+   + L  +K     +  +A    +I+  G TH Q A P+       +Y + L    +R    + R+    L +G  A       RK  A+++  T   +         N  + +++ D +VE+       A++  ++  D+  + S        +S      GSS+MP K NP   E I     ++ G  +  ++
Sbjct:    3 QSSNDTFPTAMHIAVGREVNSRLLPALKKLRTALHNKAEEFKDIIKIGRTHTQDAVPLTLGQEFSAYVTQLDNSIARVESTLPRL--YQLAAGGTAVGTGLNTRKGFAEKVAATVSELTGLPFVTAPNKFEALAAHDALVEVHGALNTVAVSFMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCEAITMVAAQVMGNQVAVSV 214          
BLAST of Argininosuccinate lyase vs. Ensembl Celegans
Match: fum-1 (Probable fumarate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O17214])

HSP 1 Score: 48.9062 bits (115), Expect = 5.061e-6
Identity = 45/214 (21.03%), Postives = 84/214 (39.25%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWC-RQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSM---------NSLDGVSSRDYIVELQSCATICAINLSRLAEDL-IIYSTKEFSFVRIS-DAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAI 1030
            +S ND   T   +   R+   + L  +K     +  +A    +I+  G TH Q A P+       +Y + L    +R    + R+    L +G  A       RK  A+++  T   +         N  + +++ D +VE+       A++  ++  D+  + S        +S      GSS+MP K NP   E I     ++ G  +  ++
Sbjct:    3 QSSNDTFPTAMHIAVGREVNSRLLPALKKLRTALHNKAEEFKDIIKIGRTHTQDAVPLTLGQEFSAYVTQLDNSIARVESTLPRL--YQLAAGGTAVGTGLNTRKGFAEKVAATVSELTGLPFVTAPNKFEALAAHDALVEVHGALNTVAVSFMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCEAITMVAAQVMGNQVAVSV 214          
BLAST of Argininosuccinate lyase vs. Ensembl Celegans
Match: fum-1 (Probable fumarate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O17214])

HSP 1 Score: 48.9062 bits (115), Expect = 5.061e-6
Identity = 45/214 (21.03%), Postives = 84/214 (39.25%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWC-RQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSM---------NSLDGVSSRDYIVELQSCATICAINLSRLAEDL-IIYSTKEFSFVRIS-DAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAI 1030
            +S ND   T   +   R+   + L  +K     +  +A    +I+  G TH Q A P+       +Y + L    +R    + R+    L +G  A       RK  A+++  T   +         N  + +++ D +VE+       A++  ++  D+  + S        +S      GSS+MP K NP   E I     ++ G  +  ++
Sbjct:    3 QSSNDTFPTAMHIAVGREVNSRLLPALKKLRTALHNKAEEFKDIIKIGRTHTQDAVPLTLGQEFSAYVTQLDNSIARVESTLPRL--YQLAAGGTAVGTGLNTRKGFAEKVAATVSELTGLPFVTAPNKFEALAAHDALVEVHGALNTVAVSFMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCEAITMVAAQVMGNQVAVSV 214          
BLAST of Argininosuccinate lyase vs. Ensembl Celegans
Match: fum-1 (Probable fumarate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O17214])

HSP 1 Score: 48.9062 bits (115), Expect = 5.061e-6
Identity = 45/214 (21.03%), Postives = 84/214 (39.25%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWC-RQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSM---------NSLDGVSSRDYIVELQSCATICAINLSRLAEDL-IIYSTKEFSFVRIS-DAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAI 1030
            +S ND   T   +   R+   + L  +K     +  +A    +I+  G TH Q A P+       +Y + L    +R    + R+    L +G  A       RK  A+++  T   +         N  + +++ D +VE+       A++  ++  D+  + S        +S      GSS+MP K NP   E I     ++ G  +  ++
Sbjct:    3 QSSNDTFPTAMHIAVGREVNSRLLPALKKLRTALHNKAEEFKDIIKIGRTHTQDAVPLTLGQEFSAYVTQLDNSIARVESTLPRL--YQLAAGGTAVGTGLNTRKGFAEKVAATVSELTGLPFVTAPNKFEALAAHDALVEVHGALNTVAVSFMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCEAITMVAAQVMGNQVAVSV 214          
BLAST of Argininosuccinate lyase vs. Ensembl Celegans
Match: fum-1 (Probable fumarate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O17214])

HSP 1 Score: 48.9062 bits (115), Expect = 5.061e-6
Identity = 45/214 (21.03%), Postives = 84/214 (39.25%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWC-RQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSM---------NSLDGVSSRDYIVELQSCATICAINLSRLAEDL-IIYSTKEFSFVRIS-DAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAI 1030
            +S ND   T   +   R+   + L  +K     +  +A    +I+  G TH Q A P+       +Y + L    +R    + R+    L +G  A       RK  A+++  T   +         N  + +++ D +VE+       A++  ++  D+  + S        +S      GSS+MP K NP   E I     ++ G  +  ++
Sbjct:    3 QSSNDTFPTAMHIAVGREVNSRLLPALKKLRTALHNKAEEFKDIIKIGRTHTQDAVPLTLGQEFSAYVTQLDNSIARVESTLPRL--YQLAAGGTAVGTGLNTRKGFAEKVAATVSELTGLPFVTAPNKFEALAAHDALVEVHGALNTVAVSFMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCEAITMVAAQVMGNQVAVSV 214          
BLAST of Argininosuccinate lyase vs. Ensembl Fly
Match: Argl (gene:FBgn0032076 transcript:FBtr0100481)

HSP 1 Score: 445.662 bits (1145), Expect = 1.023e-152
Identity = 210/452 (46.46%), Postives = 305/452 (67.48%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLK 1465
            + +WGGRF+      + + N S+ +D RL+ +D+D SKAYA A+++  L+   E +K++  L+ ++ +W      +   DED+HT NER L E+ G  G +LHTGRSRNDQV TD +LW R+ + + L  +   I+    +A   + +LMPGYTHLQ+AQ +++SHWL+S+A +L+ D  R  +L  R ++ PLGSGALAGNP  IDR  LA+ L F+ V+ NS+  V  RD++V+   C ++ +++LSRLAEDLIIYSTKEF F++++D +S+GSSLMPQK+NPDSLELIRG  G I   + G  +T+KGTPSTYNKD Q DK+  F   D ++ ++++  GVL T++V +     ALS DMLATD AYYLV+KGVPFR AH I G+ V+ +EK G  I+ L LG L     LF  D++ + +Y N+V+QY+ +GGT+  S+  Q++ + K
Sbjct:    9 YKMWGGRFTEGPHEALHSLNNSLPYDSRLYADDLDASKAYAEALHRAGLINSAEADKLVKNLELLRFDWIEGTVKILPGDEDVHTVNERLLVEITGELGQRLHTGRSRNDQVVTDMKLWLRKAIRETLGRLSGIIETATRQAELHLGVLMPGYTHLQRAQTVQFSHWLLSHAFALREDGQRLLELRDRANVLPLGSGALAGNPLGIDRLWLAERLGFSGVTANSMHAVGDRDFVVDFIYCCSMVSLHLSRLAEDLIIYSTKEFDFIKLADGFSSGSSLMPQKRNPDSLELIRGMAGVITANLTGIMMTIKGTPSTYNKDLQYDKQFCFQSFDKLSQVLEVTDGVLQTIQVKQESMEAALSTDMLATDWAYYLVKKGVPFRQAHHIIGRVVSEAEKRGVDITDLPLGDLQKFSPLFGSDIVAVADYSNNVQQYNAIGGTASSSIVEQLRLLKK 460          
BLAST of Argininosuccinate lyase vs. Ensembl Fly
Match: Argl (gene:FBgn0032076 transcript:FBtr0299780)

HSP 1 Score: 445.662 bits (1145), Expect = 1.023e-152
Identity = 210/452 (46.46%), Postives = 305/452 (67.48%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLK 1465
            + +WGGRF+      + + N S+ +D RL+ +D+D SKAYA A+++  L+   E +K++  L+ ++ +W      +   DED+HT NER L E+ G  G +LHTGRSRNDQV TD +LW R+ + + L  +   I+    +A   + +LMPGYTHLQ+AQ +++SHWL+S+A +L+ D  R  +L  R ++ PLGSGALAGNP  IDR  LA+ L F+ V+ NS+  V  RD++V+   C ++ +++LSRLAEDLIIYSTKEF F++++D +S+GSSLMPQK+NPDSLELIRG  G I   + G  +T+KGTPSTYNKD Q DK+  F   D ++ ++++  GVL T++V +     ALS DMLATD AYYLV+KGVPFR AH I G+ V+ +EK G  I+ L LG L     LF  D++ + +Y N+V+QY+ +GGT+  S+  Q++ + K
Sbjct:    9 YKMWGGRFTEGPHEALHSLNNSLPYDSRLYADDLDASKAYAEALHRAGLINSAEADKLVKNLELLRFDWIEGTVKILPGDEDVHTVNERLLVEITGELGQRLHTGRSRNDQVVTDMKLWLRKAIRETLGRLSGIIETATRQAELHLGVLMPGYTHLQRAQTVQFSHWLLSHAFALREDGQRLLELRDRANVLPLGSGALAGNPLGIDRLWLAERLGFSGVTANSMHAVGDRDFVVDFIYCCSMVSLHLSRLAEDLIIYSTKEFDFIKLADGFSSGSSLMPQKRNPDSLELIRGMAGVITANLTGIMMTIKGTPSTYNKDLQYDKQFCFQSFDKLSQVLEVTDGVLQTIQVKQESMEAALSTDMLATDWAYYLVKKGVPFRQAHHIIGRVVSEAEKRGVDITDLPLGDLQKFSPLFGSDIVAVADYSNNVQQYNAIGGTASSSIVEQLRLLKK 460          
BLAST of Argininosuccinate lyase vs. Ensembl Fly
Match: Argl (gene:FBgn0032076 transcript:FBtr0340263)

HSP 1 Score: 445.662 bits (1145), Expect = 1.023e-152
Identity = 210/452 (46.46%), Postives = 305/452 (67.48%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLK 1465
            + +WGGRF+      + + N S+ +D RL+ +D+D SKAYA A+++  L+   E +K++  L+ ++ +W      +   DED+HT NER L E+ G  G +LHTGRSRNDQV TD +LW R+ + + L  +   I+    +A   + +LMPGYTHLQ+AQ +++SHWL+S+A +L+ D  R  +L  R ++ PLGSGALAGNP  IDR  LA+ L F+ V+ NS+  V  RD++V+   C ++ +++LSRLAEDLIIYSTKEF F++++D +S+GSSLMPQK+NPDSLELIRG  G I   + G  +T+KGTPSTYNKD Q DK+  F   D ++ ++++  GVL T++V +     ALS DMLATD AYYLV+KGVPFR AH I G+ V+ +EK G  I+ L LG L     LF  D++ + +Y N+V+QY+ +GGT+  S+  Q++ + K
Sbjct:    9 YKMWGGRFTEGPHEALHSLNNSLPYDSRLYADDLDASKAYAEALHRAGLINSAEADKLVKNLELLRFDWIEGTVKILPGDEDVHTVNERLLVEITGELGQRLHTGRSRNDQVVTDMKLWLRKAIRETLGRLSGIIETATRQAELHLGVLMPGYTHLQRAQTVQFSHWLLSHAFALREDGQRLLELRDRANVLPLGSGALAGNPLGIDRLWLAERLGFSGVTANSMHAVGDRDFVVDFIYCCSMVSLHLSRLAEDLIIYSTKEFDFIKLADGFSSGSSLMPQKRNPDSLELIRGMAGVITANLTGIMMTIKGTPSTYNKDLQYDKQFCFQSFDKLSQVLEVTDGVLQTIQVKQESMEAALSTDMLATDWAYYLVKKGVPFRQAHHIIGRVVSEAEKRGVDITDLPLGDLQKFSPLFGSDIVAVADYSNNVQQYNAIGGTASSSIVEQLRLLKK 460          
BLAST of Argininosuccinate lyase vs. Ensembl Fly
Match: Fum4 (gene:FBgn0051874 transcript:FBtr0079964)

HSP 1 Score: 55.0694 bits (131), Expect = 1.025e-7
Identity = 55/238 (23.11%), Postives = 102/238 (42.86%), Query Frame = 2
Query:  383 KELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFL-EDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKS--------LAKELNFTDV--SMNSLDGVSSRDYIVELQSCATICAINLSRLAEDL-IIYSTKEFSFVRIS-DAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTY 1057
            KE + P    ++  +S +D  +T  R+     + + L   ++  I ++  ++N  M+++  G THL  A P+        Y   L    +R    M R+   P+G  ++     K+D K+           EL F     S N  + +S+ D +VEL       A ++ ++A D+  + S     F  +       GSS+MP K NP   E +   C ++ G  +  A+++ G+   +
Sbjct:  147 KEPVDPNE-HVNMAQSSHDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKSNDWMDLIKIGRTHLMDAVPLSLGQEFSGYQQQLVNGRTRLDCAMCRLYQLPMGGTSVG---TKVDTKAEYSAQCIKRIAELTFLPFVESPNFFESISACDCLVELHGELNTIAASVMKIANDIRFLGSGPRCGFGELHLPENEPGSSIMPGKVNPTQCEAMSMICAQVMGNHV--AVSMGGSSGHF 378          
BLAST of Argininosuccinate lyase vs. Ensembl Fly
Match: Fum1 (gene:FBgn0286222 transcript:FBtr0070954)

HSP 1 Score: 51.2174 bits (121), Expect = 1.887e-6
Identity = 56/221 (25.34%), Postives = 90/221 (40.72%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVI--ATRANSE--MEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDR----KSLAKELNFTDVSM----NSLDGVSSRDYIVELQSCATICAINLSRLAEDL-IIYSTKEFSFVRIS-DAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGT 1045
            +S ND   T   +      L+   ++K  IK +  A RA SE   +I+  G TH   A P+        YA  L     R    + R+    LG G   G      +    K  AK    T +      N  + +++RD +VE+       A++L ++A D+  + S        +S      GSS+MP K NP   E +     ++ G  +  A+T+ G+
Sbjct:  142 QSSNDTFPTAIHISV---ALELNNNLKPAIKTLHDALRAKSEEFKDIIKIGRTHTMDAVPLTLGQEFSGYAQQLAYAQERIDACLPRVYELALG-GTAVGTGLNTRKGFAEKCAAKIAELTSLPFVTAPNKFEALAARDAMVEVHGVLNTIAVSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCESLTMLSAQVMGNQV--AVTIGGS 356          
BLAST of Argininosuccinate lyase vs. Ensembl Zebrafish
Match: asl (argininosuccinate lyase [Source:ZFIN;Acc:ZDB-GENE-040426-1152])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 255/454 (56.17%), Postives = 336/454 (74.01%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            + LWGGRF G  DPIME FNASI +D+R+W+ DI GSKAY  A+ K +L+T  E  +++ GLD++ +EW   +F +   DEDIHTANERRLKELIG   GKLHTGRSRNDQVATD RLW R  +    E     I  +  RA +E+EIL PGYTH+Q+AQPIRWSHWL+S+  ++ RD  R  D+ KR+++ PLGSGA+AGNPF IDR+ L +EL+F  +S+NS+D    RD++ E     ++C  +LS++AEDLI+YSTKEFSF+ ++DAYSTGSSLMPQKKN DSLELIR K GR+ G+  GF +TLKG PSTYNKD QEDKE++FD  DT+ +++++ATGV++TL+V++ K  +ALSPDMLATD+AY+LVRKG+PFR+AHG +GK V ++E     +S LT+  L ++  LF+ DV  +W+Y  SVEQYS  GGTS  SV  QI+    W+
Sbjct:    7 NKLWGGRFVGNTDPIMEKFNASISYDQRMWKADIKGSKAYVKALQKASLVTQNEMEQILTGLDKVLDEWSKGEFEIKPGDEDIHTANERRLKELIGDAAGKLHTGRSRNDQVATDMRLWLRDGIATLKELALQLINTMVERAAAEIEILCPGYTHMQRAQPIRWSHWLLSHVVAISRDVERLEDIRKRVNVMPLGSGAIAGNPFDIDRELLRQELSFDSISINSMDATGQRDFVAEFLFWGSMCLTHLSKMAEDLILYSTKEFSFINLTDAYSTGSSLMPQKKNADSLELIRSKAGRVFGRCAGFLMTLKGLPSTYNKDLQEDKEAMFDTYDTVHAVLQVATGVISTLKVNQVKMEEALSPDMLATDLAYHLVRKGMPFREAHGCAGKAVYIAESKNIRLSQLTVEDLQTVSSLFDKDVSSVWDYVKSVEQYSAPGGTSKSSVTAQIQHFKTWL 460          
BLAST of Argininosuccinate lyase vs. Ensembl Zebrafish
Match: asl (argininosuccinate lyase [Source:ZFIN;Acc:ZDB-GENE-040426-1152])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 255/454 (56.17%), Postives = 336/454 (74.01%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            + LWGGRF G  DPIME FNASI +D+R+W+ DI GSKAY  A+ K +L+T  E  +++ GLD++ +EW   +F +   DEDIHTANERRLKELIG   GKLHTGRSRNDQVATD RLW R  +    E     I  +  RA +E+EIL PGYTH+Q+AQPIRWSHWL+S+  ++ RD  R  D+ KR+++ PLGSGA+AGNPF IDR+ L +EL+F  +S+NS+D    RD++ E     ++C  +LS++AEDLI+YSTKEFSF+ ++DAYSTGSSLMPQKKN DSLELIR K GR+ G+  GF +TLKG PSTYNKD QEDKE++FD  DT+ +++++ATGV++TL+V++ K  +ALSPDMLATD+AY+LVRKG+PFR+AHG +GK V ++E     +S LT+  L ++  LF+ DV  +W+Y  SVEQYS  GGTS  SV  QI+    W+
Sbjct:    7 NKLWGGRFVGNTDPIMEKFNASISYDQRMWKADIKGSKAYVKALQKASLVTQNEMEQILTGLDKVLDEWSKGEFEIKPGDEDIHTANERRLKELIGDAAGKLHTGRSRNDQVATDMRLWLRDGIATLKELALQLINTMVERAAAEIEILCPGYTHMQRAQPIRWSHWLLSHVVAISRDVERLEDIRKRVNVMPLGSGAIAGNPFDIDRELLRQELSFDSISINSMDATGQRDFVAEFLFWGSMCLTHLSKMAEDLILYSTKEFSFINLTDAYSTGSSLMPQKKNADSLELIRSKAGRVFGRCAGFLMTLKGLPSTYNKDLQEDKEAMFDTYDTVHAVLQVATGVISTLKVNQVKMEEALSPDMLATDLAYHLVRKGMPFREAHGCAGKAVYIAESKNIRLSQLTVEDLQTVSSLFDKDVSSVWDYVKSVEQYSAPGGTSKSSVTAQIQHFKTWL 460          
BLAST of Argininosuccinate lyase vs. Ensembl Zebrafish
Match: asl (argininosuccinate lyase [Source:ZFIN;Acc:ZDB-GENE-040426-1152])

HSP 1 Score: 289.656 bits (740), Expect = 6.874e-95
Identity = 130/234 (55.56%), Postives = 169/234 (72.22%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYI 811
            + LWGGRF G  DPIME FNASI +D+R+W+ DI GSKAY  A+ K +L+T  E  +++ GLD++ +EW   +F +   DEDIHTANERRLKELIG   GKLHTGRSRNDQVATD RLW R  +    E     I  +  RA +E+EIL PGYTH+Q+AQPIRWSHWL+S+  ++ RD  R  D+ KR+++ PLGSGA+AGNPF IDR+ L +EL+F  +S+NS+D    RD++
Sbjct:    7 NKLWGGRFVGNTDPIMEKFNASISYDQRMWKADIKGSKAYVKALQKASLVTQNEMEQILTGLDKVLDEWSKGEFEIKPGDEDIHTANERRLKELIGDAAGKLHTGRSRNDQVATDMRLWLRDGIATLKELALQLINTMVERAAAEIEILCPGYTHMQRAQPIRWSHWLLSHVVAISRDVERLEDIRKRVNVMPLGSGAIAGNPFDIDRELLRQELSFDSISINSMDATGQRDFV 240          
BLAST of Argininosuccinate lyase vs. Ensembl Zebrafish
Match: CABZ01084963.1 (fumarate hydratase, mitochondrial-like [Source:NCBI gene;Acc:100535417])

HSP 1 Score: 52.7582 bits (125), Expect = 4.648e-7
Identity = 49/218 (22.48%), Postives = 91/218 (41.74%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWCRQWVLK-FLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRI-DICPLGSGALAGNPFKI-------DRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVR--ISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGT 1045
            +S ND   T   +   + V +  L  ++     +A +A    +I+  G TH Q A P+        Y   +K   +R    + R+ ++   G+    G   +I       D+ S    L F   + N  + +++ D +VEL       A+++ ++A D+    +   S +   I      GSS+MP K NP   E +     ++ G  +G  +T+ G+
Sbjct:    7 QSSNDTFPTAMHIAAAKEVHEVLLPGLQTLHDALAAKAEQFKDIIKIGRTHTQDAVPLSLGQEFGGYVQQVKYSIARVKASLPRVYELAAGGTAVGTGLNTRIGFAEKVADKVSALTGLPFVTAA-NKFEALAAHDALVELSGALNTVAVSMMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVG--VTVGGS 221          
BLAST of Argininosuccinate lyase vs. Ensembl Zebrafish
Match: fh (fumarate hydratase [Source:NCBI gene;Acc:393938])

HSP 1 Score: 50.8322 bits (120), Expect = 3.556e-6
Identity = 48/218 (22.02%), Postives = 91/218 (41.74%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWCRQWVLK-FLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRI-DICPLGSGALAGNPFKI-------DRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISD--AYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGT 1045
            +S ND   T   +   + V +  L  ++     +A +A    +I+  G TH Q A P+        Y   +K   +R    + R+ ++   G+    G   +I       D+ S    L F   + N  + +++ D +VEL       A+++ ++A D+    +   S +   +      GSS+MP K NP   E +     ++ G  +  A+T+ G+
Sbjct:  184 QSSNDTFPTAMHIAAAKEVHEVLLPGLQTLHDALAAKAEQFKDIIKIGRTHTQDAVPLSLGQEFGGYVQQVKYSIARVKASLPRVYELAAGGTAVGTGLNTRIGFAEKVADKVSALTGLPFVTAA-NKFEALAAHDALVELSGALNTVAVSMMKIANDIRFLGSGPRSGLGELNLPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHV--AVTVGGS 398          
BLAST of Argininosuccinate lyase vs. Ensembl Xenopus
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:100127798])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 260/452 (57.52%), Postives = 335/452 (74.12%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            LWGGRF G +DPIME FN S+ +D+R+W  DI GS+AY  A+ K  L++  E  ++ +GLD+I +EW    F L + DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R         +   I+ +  RA  E+ IL PGYTH+Q+AQPIRWSHW++S+A +L RD  R  ++ KR++I PLGSGA+AGNP  +DR+ L KEL+F  +S+NS+D  S RD+I E    A++C  +LS+++EDLIIYSTKEF FV +SD+YSTGSSLMPQKKNPDSLELIRGK GR+ G+  GF  TLKG PSTYNKD QEDKE++FD+ DT+ +++++A+GV+ATL+++K     ALSPDMLATDIAYYLVRKG+PFR AHG+SGK V L+E  G S+  L+L  + SI  LF  DV K+W+Y NSVEQY+  GGT+  SV  QI+++  W+
Sbjct:    8 LWGGRFVGSIDPIMEMFNCSVTYDQRMWSADIRGSQAYVKALEKAGLVSKPEMEQITSGLDKIHDEWSTGTFALTKGDEDIHTANERRLKELIGEVAGKLHTGRSRNDQVVTDMRLWLRDSCSTLYTHLTHLIQTMVERAAIEVNILFPGYTHMQRAQPIRWSHWILSHAVALSRDAERLGEVKKRVNILPLGSGAIAGNPLGVDRELLRKELHFDSLSLNSMDATSERDFIAEFLFWASLCMTHLSKMSEDLIIYSTKEFGFVTLSDSYSTGSSLMPQKKNPDSLELIRGKTGRVFGRCSGFLTTLKGLPSTYNKDLQEDKEAMFDVYDTVCAVLQVASGVIATLQINKEAMEKALSPDMLATDIAYYLVRKGMPFRQAHGVSGKVVQLAETKGISVDKLSLEDMKSISPLFSGDVSKVWDYTNSVEQYTAAGGTAKSSVLVQIEQLRTWM 459          
BLAST of Argininosuccinate lyase vs. Ensembl Xenopus
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:100127798])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 252/456 (55.26%), Postives = 328/456 (71.93%), Query Frame = 2
Query:  104 TEHSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            T + LWGGRF G +DPIME FN S+ +D+R+W  DI GS+AY  A+ K  L++  E  ++ +GLD+I +EW    F L + DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R         +   I+ +  RA  E+ IL PGYTH+Q+AQPIRWSHW++S+A +L RD  R  ++ KR++I PL    L+  PF++       EL+F  +S+NS+D  S RD+I E    A++C  +LS+++EDLIIYSTKEF FV +SD+YSTGSSLMPQKKNPDSLELIRGK GR+ G+  GF  TLKG PSTYNKD QEDKE++FD+ DT+ +++++A+GV+ATL+++K     ALSPDMLATDIAYYLVRKG+PFR AHG+SGK V L+E  G S+  L+L  + SI  LF  DV K+W+Y NSVEQY+  GGT+  SV  QI+++  W+
Sbjct:    4 TGNKLWGGRFVGSIDPIMEMFNCSVTYDQRMWSADIRGSQAYVKALEKAGLVSKPEMEQITSGLDKIHDEWSTGTFALTKGDEDIHTANERRLKELIGEVAGKLHTGRSRNDQVVTDMRLWLRDSCSTLYTHLTHLIQTMVERAAIEVNILFPGYTHMQRAQPIRWSHWILSHAVALSRDAERLGEVKKRVNILPLVH--LSFFPFQL-------ELHFDSLSLNSMDATSERDFIAEFLFWASLCMTHLSKMSEDLIIYSTKEFGFVTLSDSYSTGSSLMPQKKNPDSLELIRGKTGRVFGRCSGFLTTLKGLPSTYNKDLQEDKEAMFDVYDTVCAVLQVASGVIATLQINKEAMEKALSPDMLATDIAYYLVRKGMPFRQAHGVSGKVVQLAETKGISVDKLSLEDMKSISPLFSGDVSKVWDYTNSVEQYTAAGGTAKSSVLVQIEQLRTWM 450          
BLAST of Argininosuccinate lyase vs. Ensembl Xenopus
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:100127798])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 254/463 (54.86%), Postives = 330/463 (71.27%), Query Frame = 2
Query:   83 FSLNNLMTEHSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            FS N     + LWGGRF G +DPIME FN S+ +D+R+W  DI GS+AY  A+ K  L++  E  ++ +GLD+I +EW    F L + DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R         +   I+ +  RA  E+ IL PGYTH+Q+AQPIRWSHW++S+A +L RD  R  ++ KR++I PL    L+  PF++       EL+F  +S+NS+D  S RD+I E    A++C  +LS+++EDLIIYSTKEF FV +SD+YSTGSSLMPQKKNPDSLELIRGK GR+ G+  GF  TLKG PSTYNKD QEDKE++FD+ DT+ +++++A+GV+ATL+++K     ALSPDMLATDIAYYLVRKG+PFR AHG+SGK V L+E  G S+  L+L  + SI  LF  DV K+W+Y NSVEQY+  GGT+  SV  QI+++  W+
Sbjct:    1 FSANG----NKLWGGRFVGSIDPIMEMFNCSVTYDQRMWSADIRGSQAYVKALEKAGLVSKPEMEQITSGLDKIHDEWSTGTFALTKGDEDIHTANERRLKELIGEVAGKLHTGRSRNDQVVTDMRLWLRDSCSTLYTHLTHLIQTMVERAAIEVNILFPGYTHMQRAQPIRWSHWILSHAVALSRDAERLGEVKKRVNILPLVH--LSFFPFQL-------ELHFDSLSLNSMDATSERDFIAEFLFWASLCMTHLSKMSEDLIIYSTKEFGFVTLSDSYSTGSSLMPQKKNPDSLELIRGKTGRVFGRCSGFLTTLKGLPSTYNKDLQEDKEAMFDVYDTVCAVLQVASGVIATLQINKEAMEKALSPDMLATDIAYYLVRKGMPFRQAHGVSGKVVQLAETKGISVDKLSLEDMKSISPLFSGDVSKVWDYTNSVEQYTAAGGTAKSSVLVQIEQLRTWM 450          
BLAST of Argininosuccinate lyase vs. Ensembl Xenopus
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:100127798])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 251/457 (54.92%), Postives = 329/457 (71.99%), Query Frame = 2
Query:  101 MTEHSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            ++ + LWGGRF G +DPIME FN S+ +D+R+W  DI GS+AY  A+ K  L++  E  ++ +GLD+I +EW    F L + DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R         +   I+ +  RA  E+ IL PGYTH+Q+AQPIRWSHW++S+A +L RD  R  ++ KR++I PL    L+  PF++       EL+F  +S+NS+D  S RD+I E    A++C  +LS+++EDLIIYSTKEF FV +SD+YSTGSSLMPQKKNPDSLELIRGK GR+ G+  GF  TLKG PSTYNKD QEDKE++FD+ DT+ +++++A+GV+ATL+++K     ALSPDMLATDIAYYLVRKG+PFR AHG+SGK V L+E  G S+  L+L  + SI  LF  DV K+W+Y NSVEQY+  GGT+  SV  QI+++  W+
Sbjct:    1 LSGNKLWGGRFVGSIDPIMEMFNCSVTYDQRMWSADIRGSQAYVKALEKAGLVSKPEMEQITSGLDKIHDEWSTGTFALTKGDEDIHTANERRLKELIGEVAGKLHTGRSRNDQVVTDMRLWLRDSCSTLYTHLTHLIQTMVERAAIEVNILFPGYTHMQRAQPIRWSHWILSHAVALSRDAERLGEVKKRVNILPLVH--LSFFPFQL-------ELHFDSLSLNSMDATSERDFIAEFLFWASLCMTHLSKMSEDLIIYSTKEFGFVTLSDSYSTGSSLMPQKKNPDSLELIRGKTGRVFGRCSGFLTTLKGLPSTYNKDLQEDKEAMFDVYDTVCAVLQVASGVIATLQINKEAMEKALSPDMLATDIAYYLVRKGMPFRQAHGVSGKVVQLAETKGISVDKLSLEDMKSISPLFSGDVSKVWDYTNSVEQYTAAGGTAKSSVLVQIEQLRTWM 448          
BLAST of Argininosuccinate lyase vs. Ensembl Xenopus
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:100127798])

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 251/452 (55.53%), Postives = 326/452 (72.12%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            LWGGRF G +DPIME FN S+ +D+R+W  DI GS+AY  A+ K  L++  E  ++ +GLD+I +EW    F L + DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R         +   I+ +  RA  E+ IL PGYTH+Q+AQPIRWSHW++S+A +L RD  R  ++ KR++I PL    L+  PF++       EL+F  +S+NS+D  S RD+I E    A++C  +LS+++EDLIIYSTKEF FV +SD+YSTGSSLMPQKKNPDSLELIRGK GR+ G+  GF  TLKG PSTYNKD QEDKE++FD+ DT+ +++++A+GV+ATL+++K     ALSPDMLATDIAYYLVRKG+PFR AHG+SGK V L+E  G S+  L+L  + SI  LF  DV K+W+Y NSVEQY+  GGT+  SV  QI+++  W+
Sbjct:   15 LWGGRFVGSIDPIMEMFNCSVTYDQRMWSADIRGSQAYVKALEKAGLVSKPEMEQITSGLDKIHDEWSTGTFALTKGDEDIHTANERRLKELIGEVAGKLHTGRSRNDQVVTDMRLWLRDSCSTLYTHLTHLIQTMVERAAIEVNILFPGYTHMQRAQPIRWSHWILSHAVALSRDAERLGEVKKRVNILPLVH--LSFFPFQL-------ELHFDSLSLNSMDATSERDFIAEFLFWASLCMTHLSKMSEDLIIYSTKEFGFVTLSDSYSTGSSLMPQKKNPDSLELIRGKTGRVFGRCSGFLTTLKGLPSTYNKDLQEDKEAMFDVYDTVCAVLQVASGVIATLQINKEAMEKALSPDMLATDIAYYLVRKGMPFRQAHGVSGKVVQLAETKGISVDKLSLEDMKSISPLFSGDVSKVWDYTNSVEQYTAAGGTAKSSVLVQIEQLRTWM 457          
BLAST of Argininosuccinate lyase vs. Ensembl Mouse
Match: Asl (argininosuccinate lyase [Source:MGI Symbol;Acc:MGI:88084])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 258/448 (57.59%), Postives = 337/448 (75.22%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FN+SI +D+ LW  D+ GSKAY+  + K  LLT  E  +++ GLD++ EEW    F L+  DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW RQ   K    +++ I  +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM +++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV  +W+Y +SVEQYS LGGT+  SVE+QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQV 455          
BLAST of Argininosuccinate lyase vs. Ensembl Mouse
Match: Asl (argininosuccinate lyase [Source:MGI Symbol;Acc:MGI:88084])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 258/448 (57.59%), Postives = 337/448 (75.22%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FN+SI +D+ LW  D+ GSKAY+  + K  LLT  E  +++ GLD++ EEW    F L+  DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW RQ   K    +++ I  +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM +++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV  +W+Y +SVEQYS LGGT+  SVE+QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQV 455          
BLAST of Argininosuccinate lyase vs. Ensembl Mouse
Match: Asl (argininosuccinate lyase [Source:MGI Symbol;Acc:MGI:88084])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 258/448 (57.59%), Postives = 337/448 (75.22%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FN+SI +D+ LW  D+ GSKAY+  + K  LLT  E  +++ GLD++ EEW    F L+  DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW RQ   K    +++ I  +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM +++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV  +W+Y +SVEQYS LGGT+  SVE+QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQV 455          
BLAST of Argininosuccinate lyase vs. Ensembl Mouse
Match: Asl (argininosuccinate lyase [Source:MGI Symbol;Acc:MGI:88084])

HSP 1 Score: 312.383 bits (799), Expect = 1.678e-103
Identity = 141/255 (55.29%), Postives = 183/255 (71.76%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLII 880
            LWGGRF G VDPIME FN+SI +D+ LW  D+ GSKAY+  + K  LLT  E  +++ GLD++ EEW    F L+  DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW RQ   K    +++ I  +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+
Sbjct:    8 LWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLIL 262          
BLAST of Argininosuccinate lyase vs. Ensembl Mouse
Match: Asl (argininosuccinate lyase [Source:MGI Symbol;Acc:MGI:88084])

HSP 1 Score: 309.301 bits (791), Expect = 3.495e-102
Identity = 145/257 (56.42%), Postives = 195/257 (75.88%), Query Frame = 2
Query:  707 AGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYI------VELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            AGNP  +DR+ L  ELNF  +++NS+D  S RD++       E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM +++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV  +W+Y +SVEQYS LGGT+  SVE+QI+++
Sbjct:    2 AGNPLGVDRELLRAELNFGAITLNSMDATSERDFVGLLSLPAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQV 258          
BLAST of Argininosuccinate lyase vs. UniProt/SwissProt
Match: sp|Q91YI0|ARLY_MOUSE (Argininosuccinate lyase OS=Mus musculus OX=10090 GN=Asl PE=1 SV=1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 258/448 (57.59%), Postives = 337/448 (75.22%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FN+SI +D+ LW  D+ GSKAY+  + K  LLT  E  +++ GLD++ EEW    F L+  DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW RQ   K    +++ I  +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM +++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV  +W+Y +SVEQYS LGGT+  SVE+QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQV 455          
BLAST of Argininosuccinate lyase vs. UniProt/SwissProt
Match: sp|P51464|ARLY_LITCT (Argininosuccinate lyase OS=Lithobates catesbeianus OX=8400 GN=ASL PE=3 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 262/452 (57.96%), Postives = 338/452 (74.78%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            LWGGRF G +DPIME FN+S+ +D+R+W  DI GS+AY  A+ K  L++  E   ++ GLDQI EEW    F+L + DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R         +   I+ +  RA  E++IL PGYTH+Q+AQPIRWSHW++S+A +L RD  R  +L KRI++ PLGSGA+AGNP  +DR+ L KEL F  VS+NS+D  S RD+I E    A++C  +LS+++EDLIIYSTKEFSFV +SD+YSTGSSLMPQKKNPDSLELIR K GR+ G+  GF +TLKG PSTYNKD QEDKE++FD+ DT+ +++++A+GV++TL+++K     ALSPDMLATDIAYYLVRKG+PFR AHG+SGK V L+E  G +++ L+L  L SI  LF +DV K+WNY NSVEQY+  GGT+   V  Q++++  W+
Sbjct:    8 LWGGRFVGSIDPIMEMFNSSVSYDQRMWSADIRGSQAYVKALEKAGLVSPTEMEHILTGLDQIHEEWSKGTFVLTKADEDIHTANERRLKELIGEPAGKLHTGRSRNDQVVTDMRLWLRDSCSALHLHLTRLIRTMVDRAAIEIDILFPGYTHMQRAQPIRWSHWILSHAVALCRDAERLGELRKRINVLPLGSGAIAGNPLGVDRELLRKELEFDSVSLNSMDATSERDFIAEFLFWASLCMTHLSKMSEDLIIYSTKEFSFVTLSDSYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCSGFLMTLKGLPSTYNKDLQEDKEAMFDVYDTVCAVLQVASGVISTLQINKEGMEKALSPDMLATDIAYYLVRKGMPFRQAHGLSGKVVQLAETKGIALNKLSLEDLKSISPLFSNDVSKVWNYTNSVEQYTAAGGTAKSCVVAQVEQLRTWL 459          
BLAST of Argininosuccinate lyase vs. UniProt/SwissProt
Match: sp|P04424|ARLY_HUMAN (Argininosuccinate lyase OS=Homo sapiens OX=9606 GN=ASL PE=1 SV=4)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 258/448 (57.59%), Postives = 338/448 (75.45%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FNASI +D+ LW  D+ GSKAY+  + K  LLT  E ++++ GLD++ EEW    F LN  DEDIHTANERRLKELIG T GKLHTGRSRNDQV TD RLW RQ        +   I+ +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM++++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV+ +W+Y +SVEQY  LGGT+  SV++QI+++
Sbjct:    8 LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQV 455          
BLAST of Argininosuccinate lyase vs. UniProt/SwissProt
Match: sp|P20673|ARLY_RAT (Argininosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Asl PE=2 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 255/448 (56.92%), Postives = 336/448 (75.00%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF+G VDP M+ FN+SI +D+ LW  D+ GSKAY+  + K  LLT  E  +++ GLD++ EEW    F L   DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW RQ   K    +K+ I+ +  RA +E E+L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  ELNF  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEF+FV++SDAYSTGSSLMPQKKNPDSLELIR K  R+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTMT+++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L ++  LF  DV  +W+Y +SVEQY+ LGGT+  SVE+QI ++
Sbjct:    8 LWGGRFAGSVDPTMDKFNSSIAYDRHLWNVDLQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGIFKLYPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTYSKLSTFLKVLIEAMVDRAEAECEVLFPGYTHLQRAQPIRWSHWILSHAVALTRDLERLKEVQKRINVLPLGSGAIAGNPLGVDREFLCAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFNFVQLSDAYSTGSSLMPQKKNPDSLELIRSKARRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMTAVLQVATGVISTLQIHRENMAQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVVVAEMKGVALNQLSLQELQTVSPLFSSDVNLVWDYSHSVEQYTALGGTAQSSVEWQISQV 455          
BLAST of Argininosuccinate lyase vs. UniProt/SwissProt
Match: sp|Q3SZJ0|ARLY_BOVIN (Argininosuccinate lyase OS=Bos taurus OX=9913 GN=ASL PE=2 SV=1)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 256/448 (57.14%), Postives = 336/448 (75.00%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF G VDPIME FN+SI +D+ LW  D+ GSKAY+  + K  LLT  E ++++ GLD++ EEW    F LN  DEDIHTANERRLKELIG T GKLHTGRSRNDQV TD RLW RQ        +   I+ +  RA +E ++L PGYTHLQ+AQPIRWSHW++S+A +L RD  R  ++ KRI++ PLGSGA+AGNP  +DR+ L  EL+F  +++NS+D  S RD++ E    A++C  +LSR+AEDLI+Y TKEFSFV++SDAYSTGSSLMPQKKNPDSLELIR K GR+ G+  G  +TLKG PSTYNKD QEDKE++F++ DTM++++++ATGV++TL++ +     ALSPDMLATD+AYYLVRKG+PFR AH  SGK V ++E  G +++ L+L +L +I  LF  DV  +W+Y +SVEQY  LGGT+  SV++QI ++
Sbjct:    8 LWGGRFVGTVDPIMEKFNSSITYDRHLWEADVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNPNDEDIHTANERRLKELIGETAGKLHTGRSRNDQVVTDLRLWMRQNCSMLSALLCELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELDFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHRENMGRALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVSHVWDYGHSVEQYEALGGTARSSVDWQIGQL 455          
BLAST of Argininosuccinate lyase vs. TrEMBL
Match: A0A210Q843 (Argininosuccinate lyase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16713 PE=3 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 284/457 (62.14%), Postives = 349/457 (76.37%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLC----IKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWVD 1474
            LWGGRF+G  DP+MEAFNASI +DKR+WR DI GSKAY +AI K  L+TV+E++ +  GLD++ EEW ND F +   DEDIHTANERRLKELIGPT GKLHTGRSRNDQV TD RLW R      L ++K C    IKV+  RA  E+++LMPGYTHLQ+AQPIRWSHWL+SYA  LKRD  R  +L +R++I PLGSGALAGNPF +DR  LAKEL F+ +S NSLD VS RD++ E    A++  I+LSR AEDLI+Y +KEF F+ +SDAYSTGSSLMPQKKN DSLELIRGK GR+ G+  GF +TLKG PSTYNKD QEDKES+FD   T++ ++K++TGVL+TL++   K   ALSPDMLATDIAYYLVRKGVPFR AHG+SG CVA++E   C +S LTL  L S+   FE+D++K+W+Y+NSV+QY   GGT   SV  QI+ +  W+D
Sbjct:   19 LWGGRFTGNTDPVMEAFNASIHYDKRMWRADIQGSKAYVSAIQKAGLVTVQERDAIREGLDKVAEEWANDVFEIRPGDEDIHTANERRLKELIGPTAGKLHTGRSRNDQVTTDMRLWLRD----ALTELKTCVIDLIKVMINRAKLEIDVLMPGYTHLQRAQPIRWSHWLLSYAWMLKRDVERLMELSERVNILPLGSGALAGNPFAVDRDFLAKELGFSQISGNSLDAVSDRDFVAEYLFWASMLGIHLSRWAEDLILYCSKEFGFISLSDAYSTGSSLMPQKKNADSLELIRGKSGRLFGKFSGFMMTLKGLPSTYNKDLQEDKESMFDTYTTLSGVLKVSTGVLSTLQIHPEKMRGALSPDMLATDIAYYLVRKGVPFRQAHGLSGTCVAMAETKQCPLSDLTLEDLKSVSPCFEEDIVKLWDYDNSVDQYKAYGGTGKVSVSQQIQSLSTWLD 471          
BLAST of Argininosuccinate lyase vs. TrEMBL
Match: V4B241 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_200177 PE=3 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 283/455 (62.20%), Postives = 354/455 (77.80%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLED-IKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            + LWGGRF+GK DPIME FNASI +DK++W+ DI GS+AY  AI KV L+T EE+  +  GL +I++EWEN++FI+   DEDIHTANERRLKELIG   GKLHTGRSRNDQVATD RLW +   LK L   +   +KVI  RA  E+++LMPGYTHLQ+AQPIRWSHWL+SYA  L+RD  R+ +L KR  + PLGSGALAGNPF +DR+ LAKEL+  +VS NSLD VS RD+IVE    +++ + +LSR AEDLI+Y TKEF+FV +SDAYSTGSSLMPQKKN DSLELIRGK GR+ G   GF +TLKG PSTYNKDFQEDK ++FD  +T++ ++K+ATGVL+TL +       ALSPDMLATD+AYYLVRKGVPFR+AHG++G CVAL+EK GC++S LT+    SI  LF+ DV ++WNYENSV QY+ +GGT  +SV  QI+++ KW+
Sbjct:    8 NKLWGGRFTGKTDPIMEEFNASISYDKKMWKADIRGSQAYVKAIEKVGLVTSEEREAIYNGLGKIEKEWENNEFIIKAGDEDIHTANERRLKELIGSASGKLHTGRSRNDQVATDMRLWLKD-SLKILTGLVSDFMKVILKRAAVEIDVLMPGYTHLQRAQPIRWSHWLLSYAWMLQRDLERYDELAKRTAVLPLGSGALAGNPFGVDREFLAKELDMLNVSGNSLDAVSDRDFIVEFLFVSSLLSTHLSRWAEDLILYCTKEFNFVALSDAYSTGSSLMPQKKNADSLELIRGKSGRMFGNCSGFMMTLKGVPSTYNKDFQEDKTAMFDTYETLSGILKVATGVLSTLTIHPEAMRAALSPDMLATDLAYYLVRKGVPFREAHGLAGGCVALAEKKGCAMSDLTVDDFKSIHALFDSDVTQVWNYENSVNQYNAIGGTGKQSVVQQIEKLEKWI 461          
BLAST of Argininosuccinate lyase vs. TrEMBL
Match: A0A1S3HB96 (argininosuccinate lyase OS=Lingula unguis OX=7574 GN=LOC106153743 PE=3 SV=1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 272/452 (60.18%), Postives = 346/452 (76.55%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            LWGGRF+GK DP+ME FNASI +DKRLW+ DI GS+AY  A+ +  L++ EE+  +  GL+++  EW  D+F+L   DEDIHTANERRLKELIG   GKLHTGRSRNDQVATD RLW R+ +      +   I+VI TRA  ++ ILMPGYTHLQ+AQPIRWSHWL+SYA  L+RD  R   LM R+++ PLG GALAGNPF +DR+ LA+ELNF  V++NSLDG S RD++ E    A++ +++LS+ AEDLIIYSTKEFSFV ++DAYSTGSSLMPQKKNPDSLELIRGK GR+ G+     +TLKG PSTYNKD QEDKE +FD+CDTMT ++++A GV++TL+V++  C  ALSPDMLATD+AY+LV KGVPFR+AH +SG+CVAL+EK  C +S L++    S+   F+  V K+W+YENSVEQY  +GGTS  SV+ QI  +  W+
Sbjct:   11 LWGGRFTGKTDPVMEQFNASISYDKRLWKADIQGSQAYVKALEQAGLVSPEERLAIHHGLEKVAIEWSEDRFVLQPSDEDIHTANERRLKELIGSAAGKLHTGRSRNDQVATDMRLWLREQLQILRSFMVQLIQVICTRAQQDIHILMPGYTHLQRAQPIRWSHWLLSYAFMLQRDVQRLDQLMDRVNVLPLGCGALAGNPFNVDRQLLARELNFPAVALNSLDGTSDRDFVAEFLFWASMTSVHLSKWAEDLIIYSTKEFSFVLLADAYSTGSSLMPQKKNPDSLELIRGKSGRMYGRCTSLMMTLKGLPSTYNKDLQEDKEGMFDVCDTMTGVLQVAIGVISTLKVNQEACLAALSPDMLATDLAYFLVNKGVPFREAHSLSGECVALAEKKQCKLSELSVRDFESVSASFDASVTKVWDYENSVEQYRSIGGTSRASVQQQIARLQVWL 462          
BLAST of Argininosuccinate lyase vs. TrEMBL
Match: A0A2T7PHM6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08361 PE=3 SV=1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 272/452 (60.18%), Postives = 347/452 (76.77%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            LWGGRF+G  DP+MEAFNASI +DKR+W+ DI+GS+AY  ++ KV ++T EE   +I GLD++KEEW N  F +  QDEDIHTANERRLKEL+G  GGKLHTGRSRNDQVATD RLW    VL     +   + V+  RA +E+++LMPGYTHLQ+AQPIRWSHWLMSYA  + RD  R   L +R+   PLGSGALAGNPF +DR+ L +EL  + VS NSLD VS RD++VE    A++ +I+LSR AEDL++YSTKEF+F+ +SDAYSTGSSLMPQKKN DSLELIRGK GRI G   GF ++LKG PSTYNKD QEDKE++FD  DT+  ++++ATGVL+TL++ +    +ALSPDMLATD+AYYLV+KG PFRDAH I+G+CVAL+EK GC +S L+L  + ++ +LFE+DV  +WNY +SV+QYS  GGT+  SV+ QI  +  W+
Sbjct:   11 LWGGRFTGATDPVMEAFNASIGYDKRMWKADIEGSQAYVKSLQKVGIVTAEECQTIIQGLDKVKEEWMNGCFEIKPQDEDIHTANERRLKELVGVVGGKLHTGRSRNDQVATDMRLWLGDAVLSLRGHLVSLLSVMCRRAEAELDVLMPGYTHLQRAQPIRWSHWLMSYAWMVHRDVQRLDQLRERVLTLPLGSGALAGNPFNVDRQFLRQELGMSSVSQNSLDAVSDRDFVVEFLFWASLLSIHLSRWAEDLVLYSTKEFAFITLSDAYSTGSSLMPQKKNSDSLELIRGKSGRIYGNCCGFMMSLKGIPSTYNKDLQEDKEAMFDTYDTLMGVLQVATGVLSTLKIDRKAMEEALSPDMLATDLAYYLVKKGKPFRDAHSIAGECVALAEKKGCILSDLSLEDMKTVNNLFEEDVASVWNYSHSVDQYSAEGGTAASSVKEQISALSAWL 462          
BLAST of Argininosuccinate lyase vs. TrEMBL
Match: R7TU56 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_159436 PE=3 SV=1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 274/440 (62.27%), Postives = 342/440 (77.73%), Query Frame = 2
Query:  155 MEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWVD 1474
            ME FNASI +DKR+WR DI GSKAY  AI+KV L+T +EK+ +IAGLDQ+ EEWE  KF+L   DEDIHTANERRLKE++G   GKLHTGRSRNDQVATD RLW R  V      ++  I V   RA  E+++L+PGYTHLQ+AQPIRWSHWL+SYA  LKRD  R ++L +R++I PLGSGALAGNPF +DR  LA+EL F  VS NSLD +S RD++VE+   A++ A +LSRLAEDLIIYSTKEF+F+ +SDAYSTGSSLMPQKKN DSLELIRGK GRI G+  GF ++LKG PSTYNKD QEDKE++FD CD++  L+++ TG L+TL V    C  ALSPDMLATD+AYYLVRKG+PFR+AHG+SG+CVA +E+  C+++ LT+  L +I   F DDV+K+W+YE SVEQY   GGTS  SV+ QI+++  W++
Sbjct:    1 MEEFNASISYDKRMWRADIMGSKAYVAAIHKVGLVTEKEKSAIIAGLDQVAEEWEAGKFVLKAGDEDIHTANERRLKEIVGAPAGKLHTGRSRNDQVATDMRLWLRDEVQVLEGHLRSLIAVFVNRAIMEIDVLLPGYTHLQRAQPIRWSHWLLSYAWMLKRDMQRLHELKQRLNILPLGSGALAGNPFNVDRNFLAQELGFDGVSGNSLDAISDRDFVVEILMWASLNATHLSRLAEDLIIYSTKEFAFISLSDAYSTGSSLMPQKKNADSLELIRGKSGRIFGRCAGFMMSLKGLPSTYNKDLQEDKEAMFDACDSLGRLLQVTTGTLSTLTVHAEVCKQALSPDMLATDLAYYLVRKGIPFREAHGLSGQCVAFAEEKKCALNELTVQDLQTISGSFSDDVMKVWDYEYSVEQYQSAGGTSRASVQKQIEQLNAWLN 440          
BLAST of Argininosuccinate lyase vs. Ensembl Cavefish
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:103043433])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 256/452 (56.64%), Postives = 330/452 (73.01%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            LWGGRF G  DPIME FNASI +D+R+W  DI GSKAY  A+ K  L+T EE  ++++GLD++  EW N +F +   DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R  +     +    I  +  RA  E++IL PGYTH+Q+AQPIRWSHW++S+A +L RD  +  ++ +R+++ PLGSGA+AGNPF IDR+ L KELNF D+S+NS+D    RD++ E     ++C  +LS++AEDLI+YSTKEFSF+ +SDAYSTGSSLMPQKKN DSLELIR K GR+ G+  GF +TLKG PSTYNKD QEDKE++FD  DT  +++++ATGV++TL+V+      ALSPDMLATD+AYYLVRKGVPFR+AH  SGK V  +E     ++ LT+  L +   LF+ DV  +W+Y +SVEQYS  GGT+  SV  QI+ M  W+
Sbjct:    9 LWGGRFVGNTDPIMEKFNASIAYDQRMWDADIRGSKAYVKALQKAGLVTPEEMQQILSGLDKVFGEWSNGEFQIKPGDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDMRLWLRDAITTLKGNAIELINTMVERAAVEIDILFPGYTHMQRAQPIRWSHWILSHAVALSRDVEQVEEIRRRVNVLPLGSGAIAGNPFNIDRELLRKELNFDDISINSMDATGQRDFVAEFLFWGSMCLTHLSKMAEDLILYSTKEFSFISLSDAYSTGSSLMPQKKNADSLELIRSKAGRVFGRCAGFLMTLKGLPSTYNKDLQEDKEAMFDTYDTAHAVLQVATGVMSTLKVNPKSMEAALSPDMLATDLAYYLVRKGVPFREAHSCSGKAVYQAESKNVPLNQLTVEDLHTASPLFDSDVSSVWDYTSSVEQYSAPGGTAKSSVTAQIEHMRTWL 460          
BLAST of Argininosuccinate lyase vs. Ensembl Cavefish
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:103043433])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 251/447 (56.15%), Postives = 325/447 (72.71%), Query Frame = 2
Query:  131 FSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            F G  DPIME FNASI +D+R+W  DI GSKAY  A+ K  L+T EE  ++++GLD++  EW N +F +   DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R  +     +    I  +  RA  E++IL PGYTH+Q+AQPIRWSHW++S+A +L RD  +  ++ +R+++ PLGSGA+AGNPF IDR+ L KELNF D+S+NS+D    RD++ E     ++C  +LS++AEDLI+YSTKEFSF+ +SDAYSTGSSLMPQKKN DSLELIR K GR+ G+  GF +TLKG PSTYNKD QEDKE++FD  DT  +++++ATGV++TL+V+      ALSPDMLATD+AYYLVRKGVPFR+AH  SGK V  +E     ++ LT+  L +   LF+ DV  +W+Y +SVEQYS  GGT+  SV  QI+ M  W+
Sbjct:    2 FVGNTDPIMEKFNASIAYDQRMWDADIRGSKAYVKALQKAGLVTPEEMQQILSGLDKVFGEWSNGEFQIKPGDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDMRLWLRDAITTLKGNAIELINTMVERAAVEIDILFPGYTHMQRAQPIRWSHWILSHAVALSRDVEQVEEIRRRVNVLPLGSGAIAGNPFNIDRELLRKELNFDDISINSMDATGQRDFVAEFLFWGSMCLTHLSKMAEDLILYSTKEFSFISLSDAYSTGSSLMPQKKNADSLELIRSKAGRVFGRCAGFLMTLKGLPSTYNKDLQEDKEAMFDTYDTAHAVLQVATGVMSTLKVNPKSMEAALSPDMLATDLAYYLVRKGVPFREAHSCSGKAVYQAESKNVPLNQLTVEDLHTASPLFDSDVSSVWDYTSSVEQYSAPGGTAKSSVTAQIEHMRTWL 448          
BLAST of Argininosuccinate lyase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000439.1 (pep scaffold:Pmarinus_7.0:GL480960:172212:183976:1 gene:ENSPMAG00000000373.1 transcript:ENSPMAT00000000439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 490.73 bits (1262), Expect = 2.988e-172
Identity = 229/388 (59.02%), Postives = 296/388 (76.29%), Query Frame = 2
Query:  299 QIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEML 1462
            QI++EWE  KF + E DEDIHTANERRLKELIG  GGKLHTGRSRNDQV TD R+W R+ +   L  +   ++ IA RA++EM++L PGYTHLQ+AQPIRWSHWL+S+A++L RD  R      R ++ PLGSGA+AGNP  IDR+ L KELNF  +S+NS+D  S RD+IV     A++   +LSR+AEDL++YS+KEF FV +SDAYSTGSSLMPQK+NPDSLELIRGK G + G+  G  +T+KG P+ YNKD QEDKE++FD+ DT++++++IATGV++TL V+K     ALSPDMLATD+AYYLVRKGV FRDAH ++G+ VA SE  GCS+  L++ +L +I  LF  DV  +W+YE+SVEQYS  GGT+  SV  QI+ +L
Sbjct:    3 QIEKEWEQGKFEVKENDEDIHTANERRLKELIGEAGGKLHTGRSRNDQVVTDVRIWLRESLSHLLALLHTLVRSIAQRAHAEMDVLCPGYTHLQRAQPIRWSHWLLSHATALLRDAERLAQARARTNVLPLGSGAIAGNPLNIDREVLRKELNFDSISLNSMDATSDRDFIVCDMVAASLTMTHLSRMAEDLVLYSSKEFGFVSLSDAYSTGSSLMPQKRNPDSLELIRGKTGTVFGRCAGLMMTMKGLPTAYNKDLQEDKEAMFDVYDTLSAVVQIATGVISTLTVNKAAMRAALSPDMLATDLAYYLVRKGVAFRDAHNLAGRAVAESEAKGCSLKDLSVDELQTISPLFGSDVCAVWDYESSVEQYSAPGGTARASVAQQIEAIL 390          
BLAST of Argininosuccinate lyase vs. Ensembl Yeast
Match: ARG4 (Argininosuccinate lyase; catalyzes the final step in the arginine biosynthesis pathway [Source:SGD;Acc:S000001060])

HSP 1 Score: 493.041 bits (1268), Expect = 3.186e-172
Identity = 246/451 (54.55%), Postives = 321/451 (71.18%), Query Frame = 2
Query:  116 LWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIG-PTGGKLHTGRSRNDQVATDTRLWCRQWVLKFL-EDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCS-ISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEM 1459
            LWGGRF+G+ DP+M  +NAS+ +D ++++ D++G+K Y   + K+ LLT  E  K+  GL +IK+EW+ DKF+ +  DEDIHTANERRL ELIG    GK+HTGRSRNDQV TD R++CR  V   L   +K  ++V+  RA  E+++LMPGYTHLQ+AQPIRWSHWL SYA+    DY R   ++ R++  PLG+GALAG+P+ IDR+ LA+ L F  V  NSL  VS RD+IVEL    T+   ++SR AEDLIIY T EF F+++SDAYSTGSSLMPQKKN DSLEL+RGK GR+ G + GF ++LKG PSTY+KD QEDKE LFD   T+   + IATGV++TL V+K K   AL+ DMLATD+A YLVRKGVPFR+ H ISG+CVA +E+LG S I  LTL Q   I   F  D+ + +N+E SVE+    GGT+  +V  Q+  +
Sbjct:    8 LWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTAGLQKLGLLTETELAKIHEGLAEIKKEWDADKFVRHPNDEDIHTANERRLGELIGRDIAGKVHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKGLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSPLGAGALAGHPYGIDREFLAEGLGFNSVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDLIIYCTAEFGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLTGFLMSLKGIPSTYDKDMQEDKEPLFDCLTTVEHSMLIATGVISTLTVNKEKMEAALTMDMLATDLADYLVRKGVPFRETHHISGECVATAERLGLSGIDKLTLEQYQKIDSRFGQDLFETFNFEQSVERRDATGGTAKSAVLKQLDNL 458          
BLAST of Argininosuccinate lyase vs. Ensembl Nematostella
Match: EDO35208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM51])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 264/442 (59.73%), Postives = 336/442 (76.02%), Query Frame = 2
Query:  155 MEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATD---TRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            MEAFNASI FDKR+W+ED+ GS+AY  AI KV L+T  E  +++ G+ +I+EEW++ KF +   DEDIHTANERRLKEL+G   GKLHTGRSRNDQV  D   + LW R  +    + +   I VI  RA+SE+E+L+PGYTHLQ+AQPIRWSHWL+SYA SLKRD  R  +L +R++I PLGSGALAGNPF +DR+ LA+EL F+DV+ NSLD VS RDYI E     ++ A +LSR AEDL++YST+EF FV++SDAYSTGSSLMPQKKN DSLELIRGK GRI G+  GF +TLKG PSTYNKD QEDKE LFD+CDT+  L+++ATGV+AT+ +   +    LSPDMLATD+AYYLVRKGVPFR+AH +SG  V L+E+ GC+++ LT   L  +  LFE++V  +WNY NSVEQY+  GGTS  +V+ Q+ ++  W+
Sbjct:    1 MEAFNASISFDKRMWKEDLKGSEAYVKAIEKVGLVTAAEMKQILDGIQKIREEWQSCKFQVICGDEDIHTANERRLKELVGSVAGKLHTGRSRNDQVMPDLMPSLLWLRGEIQVQRKLLTEFIDVIVKRASSEIEVLLPGYTHLQRAQPIRWSHWLLSYAWSLKRDVERLDELTERVNILPLGSGALAGNPFGVDRRFLAQELGFSDVTGNSLDAVSDRDYIAEFLFWGSLLATHLSRWAEDLLLYSTQEFGFVKLSDAYSTGSSLMPQKKNADSLELIRGKAGRIFGRCSGFLMTLKGLPSTYNKDLQEDKEPLFDVCDTLRGLLQVATGVIATITIDSERMLSCLSPDMLATDLAYYLVRKGVPFREAHALSGSAVHLAEQKGCALNELTAHDLQQVSTLFEENVKTVWNYGNSVEQYTAEGGTSKSAVQDQVTKLECWL 442          
BLAST of Argininosuccinate lyase vs. Ensembl Nematostella
Match: EDO31211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYK1])

HSP 1 Score: 54.299 bits (129), Expect = 7.380e-8
Identity = 52/220 (23.64%), Postives = 91/220 (41.36%), Query Frame = 2
Query:  425 RSRNDQVATDTRLWCRQWVL-KFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALA---GNPFKIDRKSLAKELNFTDVSM----NSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKE---FSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIG--FAITLKGT 1045
            +S ND   T   + C   V  + L  +K     +  +A    +I+  G TH Q A P+        Y   ++   +R    M R+    +G  A+            K  AK   +T +      N  +G+++ D +VEL     + A +L ++A D+    +        +++ +    GSS+MP K NP   E I      +A Q+IG   A+++ G+
Sbjct:  173 QSSNDTFPTAMHVACAIEVHERLLPGLKKLHGALDAKAKEFKDIIKIGRTHTQDATPLTLGQEFSGYVKQIENGIARVQVCMPRVYELAIGGTAVGTGLNTRIGFAEKVSAKIAEYTKLPFTSNPNKFEGLAAHDAMVELHGALNVIACSLMKIANDVRFLGSGPRCGLGELQLPE-NEPGSSIMPGKVNPTQCEAIT----MVAAQVIGNQTAVSVGGS 387          
BLAST of Argininosuccinate lyase vs. Ensembl Medaka
Match: asl (argininosuccinate lyase [Source:NCBI gene;Acc:101156598])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 253/454 (55.73%), Postives = 333/454 (73.35%), Query Frame = 2
Query:  110 HSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWV 1471
            + LWGGRF G  DPIME FNASI +D+R+W  DI GSKAY  A+ K  L++ EEK +++ G+DQI EEW    F++   DEDIHTANERRLKELIG   GKLHTGRSRNDQV TD RLW R  +    E+    I  +  RA+ E+E+L PGYTH+Q+AQPIRWSHW++S++ +L RD  R  ++ KR+++ PLGSGA+AG P  IDR+ L KEL F  +S+NS+D    RD++VE    A++C  +LS++AEDL++YSTKEFSFV +SDAYSTGSSLMPQKKN DSLELIR K GR+ G+  GF +TLKG PSTYNKD QEDKE++F+  DT+ +++++ TGV++TL++++     ALSPDMLATD+AYYLVRKGVPFR+AHG+SGK V  +E    +++ LT   L  +  LF  DV  +W+Y +SVEQYS  GGT+  SV  Q++ +  W+
Sbjct:    7 NKLWGGRFVGDTDPIMEKFNASIGYDQRMWDADIRGSKAYVKALEKAQLVSSEEKEQILRGMDQISEEWSKGNFVIRPGDEDIHTANERRLKELIGAPAGKLHTGRSRNDQVVTDMRLWMRDAITTLTENSLQLISTMVERASVEIEVLFPGYTHMQRAQPIRWSHWILSHSVALSRDVDRLLEIKKRVNVLPLGSGAIAGTPLDIDRELLRKELGFDAISLNSMDATGQRDFVVEFLFWASLCLTHLSKMAEDLMLYSTKEFSFVTLSDAYSTGSSLMPQKKNADSLELIRSKAGRVFGRCAGFMMTLKGLPSTYNKDLQEDKEAMFECFDTVQAVLQVTTGVMSTLKINQNVMEAALSPDMLATDLAYYLVRKGVPFREAHGLSGKAVFKAESKNIALNRLTAEDLSDVSPLFGSDVSSVWDYSSSVEQYSAPGGTAKTSVVAQVEHLRNWL 460          
BLAST of Argininosuccinate lyase vs. Planmine SMEST
Match: SMESG000039074.1 (SMESG000039074.1)

HSP 1 Score: 951.044 bits (2457), Expect = 0.000e+0
Identity = 458/458 (100.00%), Postives = 458/458 (100.00%), Query Frame = 2
Query:  101 MTEHSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWVD 1474
            MTEHSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWVD
Sbjct:    1 MTEHSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKVNLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGPTGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEMEILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSGALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAINLSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGRIAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLATLEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLGCSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQIKEMLKWVD 458          
The following BLAST results are available for this feature:
BLAST of Argininosuccinate lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASL0.000e+057.59argininosuccinate lyase [Source:HGNC Symbol;Acc:HG... [more]
ASL0.000e+057.59argininosuccinate lyase [Source:HGNC Symbol;Acc:HG... [more]
ASL0.000e+054.69argininosuccinate lyase [Source:HGNC Symbol;Acc:HG... [more]
ASL0.000e+054.91argininosuccinate lyase [Source:HGNC Symbol;Acc:HG... [more]
ASL0.000e+054.91argininosuccinate lyase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fum-15.061e-621.03Probable fumarate hydratase, mitochondrial [Sourc... [more]
fum-15.061e-621.03Probable fumarate hydratase, mitochondrial [Sourc... [more]
fum-15.061e-621.03Probable fumarate hydratase, mitochondrial [Sourc... [more]
fum-15.061e-621.03Probable fumarate hydratase, mitochondrial [Sourc... [more]
fum-15.061e-621.03Probable fumarate hydratase, mitochondrial [Sourc... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Argl1.023e-15246.46gene:FBgn0032076 transcript:FBtr0100481[more]
Argl1.023e-15246.46gene:FBgn0032076 transcript:FBtr0299780[more]
Argl1.023e-15246.46gene:FBgn0032076 transcript:FBtr0340263[more]
Fum41.025e-723.11gene:FBgn0051874 transcript:FBtr0079964[more]
Fum11.887e-625.34gene:FBgn0286222 transcript:FBtr0070954[more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asl0.000e+056.17argininosuccinate lyase [Source:ZFIN;Acc:ZDB-GENE-... [more]
asl0.000e+056.17argininosuccinate lyase [Source:ZFIN;Acc:ZDB-GENE-... [more]
asl6.874e-9555.56argininosuccinate lyase [Source:ZFIN;Acc:ZDB-GENE-... [more]
CABZ01084963.14.648e-722.48fumarate hydratase, mitochondrial-like [Source:NCB... [more]
fh3.556e-622.02fumarate hydratase [Source:NCBI gene;Acc:393938][more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asl0.000e+057.52argininosuccinate lyase [Source:NCBI gene;Acc:1001... [more]
asl0.000e+055.26argininosuccinate lyase [Source:NCBI gene;Acc:1001... [more]
asl0.000e+054.86argininosuccinate lyase [Source:NCBI gene;Acc:1001... [more]
asl0.000e+054.92argininosuccinate lyase [Source:NCBI gene;Acc:1001... [more]
asl0.000e+055.53argininosuccinate lyase [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asl0.000e+057.59argininosuccinate lyase [Source:MGI Symbol;Acc:MGI... [more]
Asl0.000e+057.59argininosuccinate lyase [Source:MGI Symbol;Acc:MGI... [more]
Asl0.000e+057.59argininosuccinate lyase [Source:MGI Symbol;Acc:MGI... [more]
Asl1.678e-10355.29argininosuccinate lyase [Source:MGI Symbol;Acc:MGI... [more]
Asl3.495e-10256.42argininosuccinate lyase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Argininosuccinate lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91YI0|ARLY_MOUSE0.000e+057.59Argininosuccinate lyase OS=Mus musculus OX=10090 G... [more]
sp|P51464|ARLY_LITCT0.000e+057.96Argininosuccinate lyase OS=Lithobates catesbeianus... [more]
sp|P04424|ARLY_HUMAN0.000e+057.59Argininosuccinate lyase OS=Homo sapiens OX=9606 GN... [more]
sp|P20673|ARLY_RAT0.000e+056.92Argininosuccinate lyase OS=Rattus norvegicus OX=10... [more]
sp|Q3SZJ0|ARLY_BOVIN0.000e+057.14Argininosuccinate lyase OS=Bos taurus OX=9913 GN=A... [more]
back to top
BLAST of Argininosuccinate lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q8430.000e+062.14Argininosuccinate lyase OS=Mizuhopecten yessoensis... [more]
V4B2410.000e+062.20Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HB960.000e+060.18argininosuccinate lyase OS=Lingula unguis OX=7574 ... [more]
A0A2T7PHM60.000e+060.18Uncharacterized protein OS=Pomacea canaliculata OX... [more]
R7TU560.000e+062.27Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asl0.000e+056.64argininosuccinate lyase [Source:NCBI gene;Acc:1030... [more]
asl0.000e+056.15argininosuccinate lyase [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000439.12.988e-17259.02pep scaffold:Pmarinus_7.0:GL480960:172212:183976:1... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ARG43.186e-17254.55Argininosuccinate lyase; catalyzes the final step ... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO352080.000e+059.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312117.380e-823.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Argininosuccinate lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asl0.000e+055.73argininosuccinate lyase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Argininosuccinate lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000039074.10.000e+0100.00SMESG000039074.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030034 ID=SMED30030034|Name=Argininosuccinate lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=1597bp
GAATATTTTGTTGACCTTGAATTCAATGTTGTTTTAAATAACAGTTTATA
AGATTCATCAAAATGGCAAATTTTGATTTCTTTTTTCTCTAAATAATTTA
ATGACTGAGCATTCTTTGTGGGGTGGCCGATTTTCTGGAAAGGTAGATCC
GATAATGGAGGCATTTAATGCTTCGATTAAGTTCGACAAGAGATTATGGA
GAGAAGATATTGATGGTAGCAAGGCTTACGCAAATGCAATTTATAAAGTG
AATCTATTGACTGTTGAAGAGAAAAATAAAATGATCGCCGGTCTCGATCA
AATAAAAGAAGAATGGGAAAACGATAAGTTCATTCTCAATGAACAGGATG
AAGATATCCACACAGCCAACGAACGACGTTTGAAAGAACTTATTGGCCCA
ACTGGTGGAAAGCTTCATACCGGAAGAAGTCGGAATGACCAAGTTGCTAC
AGATACAAGGTTATGGTGTCGTCAATGGGTTCTAAAGTTTCTAGAAGATA
TTAAATTATGTATAAAAGTAATTGCGACTCGTGCAAATAGCGAAATGGAA
ATCTTGATGCCGGGATATACGCACCTTCAACAAGCTCAACCGATTCGATG
GAGCCATTGGTTAATGAGCTATGCAAGTTCTTTGAAACGAGATTATTCTC
GTTTTTATGATCTCATGAAACGGATTGATATTTGCCCTTTAGGGAGTGGT
GCCCTAGCAGGCAATCCGTTTAAAATTGACAGAAAATCTTTAGCTAAAGA
ACTGAATTTTACCGATGTCAGCATGAATAGTTTGGACGGAGTCAGTTCTC
GAGATTATATAGTTGAGCTGCAATCTTGTGCGACAATTTGCGCAATAAAT
CTCAGCAGATTGGCAGAAGATTTAATTATTTATAGCACCAAAGAATTTTC
TTTCGTTCGTATATCCGATGCATACAGTACCGGAAGTAGTCTAATGCCCC
AAAAAAAGAATCCAGACAGTTTGGAGCTAATTCGTGGAAAATGCGGACGA
ATAGCTGGTCAGATGATCGGCTTCGCAATTACACTGAAAGGAACACCAAG
TACGTATAACAAGGACTTTCAAGAGGATAAAGAGAGTTTATTTGATATTT
GTGATACCATGACATCATTGATTAAAATTGCAACAGGAGTATTAGCAACT
CTTGAAGTAAGCAAAACTAAATGTTATGATGCTCTTAGTCCGGATATGTT
GGCAACCGATATTGCGTATTACTTAGTTCGCAAAGGAGTTCCGTTTAGAG
ATGCTCATGGAATTTCCGGTAAATGTGTAGCATTGTCTGAGAAACTCGGC
TGTTCTATTTCTAGCCTAACATTAGGGCAATTGGGATCAATTTGTCATTT
ATTTGAGGATGACGTTCTGAAAATGTGGAATTATGAGAATAGCGTTGAGC
AATACTCTGTGCTTGGGGGAACCAGTTTTGAAAGTGTTGAATATCAAATT
AAAGAAATGCTAAAATGGGTTGATTAAAAATTAATATTTTATGATTTTAC
TAGTAACTTTTGTAATTTGTCTTTGTTTAATGTTTCATTTATGTTAGTTT
TAATTTGATAATATAGTGGATTATTTATTTTGTTATTTTACTTTTAG
back to top

protein sequence of SMED30030034-orf-1

>SMED30030034-orf-1 ID=SMED30030034-orf-1|Name=SMED30030034-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=459bp
MTEHSLWGGRFSGKVDPIMEAFNASIKFDKRLWREDIDGSKAYANAIYKV
NLLTVEEKNKMIAGLDQIKEEWENDKFILNEQDEDIHTANERRLKELIGP
TGGKLHTGRSRNDQVATDTRLWCRQWVLKFLEDIKLCIKVIATRANSEME
ILMPGYTHLQQAQPIRWSHWLMSYASSLKRDYSRFYDLMKRIDICPLGSG
ALAGNPFKIDRKSLAKELNFTDVSMNSLDGVSSRDYIVELQSCATICAIN
LSRLAEDLIIYSTKEFSFVRISDAYSTGSSLMPQKKNPDSLELIRGKCGR
IAGQMIGFAITLKGTPSTYNKDFQEDKESLFDICDTMTSLIKIATGVLAT
LEVSKTKCYDALSPDMLATDIAYYLVRKGVPFRDAHGISGKCVALSEKLG
CSISSLTLGQLGSICHLFEDDVLKMWNYENSVEQYSVLGGTSFESVEYQI
KEMLKWVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009049Argininosuccinate_lyase
IPR000362Fumarate_lyase_fam
IPR029419Arg_succ_lyase_C
IPR024083Fumarase/histidase_N
IPR022761Fumarate_lyase_N
IPR020557Fumarate_lyase_CS
IPR008948L-Aspartase-like
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004056argininosuccinate lyase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0000050urea cycle
GO:0006526arginine biosynthetic process
GO:0008652cellular amino acid biosynthetic process
GO:0042450arginine biosynthetic process via ornithine
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 55..75
NoneNo IPR availablePRINTSPR00145ARGSUCLYASEcoord: 278..294
score: 81.62
coord: 196..212
score: 62.79
coord: 104..126
score: 71.61
coord: 313..332
score: 67.97
coord: 145..165
score: 56.53
coord: 234..258
score: 44.29
NoneNo IPR availableGENE3DG3DSA:1.20.200.10coord: 122..450
e-value: 2.9E-182
score: 608.2
NoneNo IPR availableGENE3DG3DSA:1.10.40.30coord: 363..434
e-value: 2.9E-182
score: 608.2
NoneNo IPR availablePANTHERPTHR43814:SF1ARGININOSUCCINATE LYASEcoord: 3..455
IPR000362Fumarate lyase familyPRINTSPR00149FUMRATELYASEcoord: 105..123
score: 39.31
coord: 234..261
score: 29.27
coord: 150..168
score: 42.07
coord: 278..294
score: 61.46
IPR029419Argininosuccinate lyase, C-terminalPFAMPF14698ASL_C2coord: 366..433
e-value: 1.5E-20
score: 73.7
IPR022761Fumarate lyase, N-terminalPFAMPF00206Lyase_1coord: 9..303
e-value: 1.8E-96
score: 323.2
IPR024083Fumarase/histidase, N-terminalGENE3DG3DSA:1.10.275.10coord: 28..232
e-value: 2.9E-182
score: 608.2
IPR009049Argininosuccinate lyaseTIGRFAMTIGR00838TIGR00838coord: 6..453
e-value: 5.3E-178
score: 590.6
IPR009049Argininosuccinate lyasePANTHERPTHR43814FAMILY NOT NAMEDcoord: 3..455
IPR009049Argininosuccinate lyaseCDDcd01359Argininosuccinate_lyasecoord: 25..457
e-value: 0.0
score: 644.215
IPR020557Fumarate lyase, conserved sitePROSITEPS00163FUMARATE_LYASEScoord: 278..287
IPR008948L-Aspartase-likeSUPERFAMILYSSF48557L-aspartase-likecoord: 9..457