Ast8 protein

Overview
NameAst8 protein (CCW36846.1)
Smed IDSMED30030027
Length (bp)1031
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ast8 protein (SMED30030027) t-SNE clustered cells

Violin plots show distribution of expression levels for Ast8 protein (SMED30030027) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ast8 protein (SMED30030027) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ast8 protein (SMED30030027) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030027

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30030027h1SMcG0012530 SmedASXL_010499SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30030027h1SMcG0012530 SmedASXL_010499SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30030027h1SMcG0012530 SmedASXL_010499SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30030027h1SMcG0012530 dd_Smed_v4_254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030027h1SMcG0012530 dd_Smed_v6_254_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30030027h1SMcG0012530 OX_Smed_1.0.03368ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
gutSMED30030027h1SMcG0012530 dd_Smed_v4_254_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
gastrodermal cellSMED30030027h1SMcG0012530 DN293863smed_ncbi_20240424PMID:16890156
Guo et al., 2006
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ast8 protein vs. Ensembl Human
Match: MEP1A (meprin A subunit alpha [Source:HGNC Symbol;Acc:HGNC:7015])

HSP 1 Score: 101.293 bits (251), Expect = 7.125e-23
Identity = 81/269 (30.11%), Postives = 125/269 (46.47%), Query Frame = 1
Query:   37 IFVFLVIYFIQ-DLLNAKEFHPNDFESSNDI-----PLKFSTFMAE----------RDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCN------DHC 777
            I  FL IYF Q   L  +  H  DF    DI           F  +          RD N RW    I Y I+  +   +    +L A ++++ ++C+ F+P  +  + S II +   GC + +G D+  G Q +++G GC +  +  HE+ H +G +HE    DRD  V++ WD +    +  F+T     ++    PYD +S+MHY  ++F K      S+ TI AK PEF   +      D S  D++R+N MY C       DHC
Sbjct:   41 IIHFLYIYFFQIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDILLQKSRNGLRDPNTRW-TFPIPY-ILADNLGLNAKGAILYAFEMFRLKSCVDFKP--YEGESSYIIFQQFDGCWSEVG-DQHVG-QNISIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKN----ASVPTITAKIPEFNSIIGQ--RLDFSAIDLERLNRMYNCTTTHTLLDHC 297          
BLAST of Ast8 protein vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 98.9821 bits (245), Expect = 4.570e-22
Identity = 63/204 (30.88%), Postives = 95/204 (46.57%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTII-------AKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W +  I + ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH +G  HEH  PDRD  VS+  +N+ P  +  F  +   +V   G  YD  S+MHY +  F++    G  L TI+        K P  QR         LS GD+ +   +YKC
Sbjct:  130 WPDGVIPF-VIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSR----GIFLDTIVPKYEVNGVKPPIGQR-------TRLSKGDIAQARKLYKC 319          
BLAST of Ast8 protein vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 98.5969 bits (244), Expect = 5.032e-22
Identity = 63/204 (30.88%), Postives = 95/204 (46.57%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTII-------AKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W +  I + ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH +G  HEH  PDRD  VS+  +N+ P  +  F  +   +V   G  YD  S+MHY +  F++    G  L TI+        K P  QR         LS GD+ +   +YKC
Sbjct:  130 WPDGVIPF-VIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSR----GIFLDTIVPKYEVNGVKPPIGQR-------TRLSKGDIAQARKLYKC 319          
BLAST of Ast8 protein vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 98.5969 bits (244), Expect = 5.032e-22
Identity = 63/204 (30.88%), Postives = 95/204 (46.57%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTII-------AKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W +  I + ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH +G  HEH  PDRD  VS+  +N+ P  +  F  +   +V   G  YD  S+MHY +  F++    G  L TI+        K P  QR         LS GD+ +   +YKC
Sbjct:  130 WPDGVIPF-VIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSR----GIFLDTIVPKYEVNGVKPPIGQR-------TRLSKGDIAQARKLYKC 319          
BLAST of Ast8 protein vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 98.5969 bits (244), Expect = 5.838e-22
Identity = 63/204 (30.88%), Postives = 95/204 (46.57%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTII-------AKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W +  I + ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH +G  HEH  PDRD  VS+  +N+ P  +  F  +   +V   G  YD  S+MHY +  F++    G  L TI+        K P  QR         LS GD+ +   +YKC
Sbjct:  130 WPDGVIPF-VIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSR----GIFLDTIVPKYEVNGVKPPIGQR-------TRLSKGDIAQARKLYKC 319          
BLAST of Ast8 protein vs. Ensembl Celegans
Match: nas-29 (Zinc metalloproteinase nas-29 [Source:UniProtKB/Swiss-Prot;Acc:Q20958])

HSP 1 Score: 120.553 bits (301), Expect = 3.538e-30
Identity = 78/240 (32.50%), Postives = 121/240 (50.42%), Query Frame = 1
Query:  175 WENAT-IVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFI-TKDCK-CETKQNFANRRCYDIFNS 885
            W+N    ++   LT   K  I   L A+  + +ETC++F P  F  +Y + I     GC + +G+D  +G Q V++G GC  +G+  HEL H +G+ HE    DRD  V      V+  +   F  IS   +S +G+PYD+ SVMHY    F    +N  S+ T+ A +   Q+ +    ++  SF DV  +N  Y+C + CP   PC +  GF  +++CK C+    F    C  I +S
Sbjct:  147 WKNGVAFMFHESLTPIAKTAI---LKAVHFWYRETCIEFHPRTFQKEYLLFIG-NDDGCWSTVGRDASQGKQVVSIGNGCEHFGVTSHELAHALGIFHEQSRFDRDESVVFNPRVVERDLLFNFAKISPRQMSTYGLPYDIGSVMHYTPTEF----SNIPSIPTLAAIDTNLQQTM--GQLEGPSFVDVHIMNQHYQCQEKCPTQAPC-QNGGFTNSRNCKVCKCPTGFGGAYCQLIASS 375          
BLAST of Ast8 protein vs. Ensembl Celegans
Match: nas-6 (Zinc metalloproteinase nas-6 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3S9])

HSP 1 Score: 111.694 bits (278), Expect = 7.011e-28
Identity = 72/214 (33.64%), Postives = 112/214 (52.34%), Query Frame = 1
Query:  124 IPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            +P     F A +++   WE   I Y++  T F  +EI  L  A D Y++ TC++F   +    Y  I++    GC + +G  R  G Q ++LG GC ++ + +HEL H++G  HEH   DRD  + + WDN+ P MK  F+ IS     + G  YD +S+MHY   AF++   NG++  TI      F + +      DLS  D+ +IN +Y C
Sbjct:   64 LPEGPVLFNALKNKQLTWEGGVIPYEMD-TAFSPNEIKILEKAFDSYRRTTCIRFEKREGQTDYLNIVK--GYGCYSQVG--RTGGKQEISLGRGCFFHEIIVHELMHSVGFWHEHSRADRDDHIKINWDNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDSTAFSR---NGRN--TIETVENGFTQVIGTAM--DLSPLDIVKINKLYSC 265          
BLAST of Ast8 protein vs. Ensembl Celegans
Match: nas-14 (Zinc metalloproteinase nas-14 [Source:UniProtKB/Swiss-Prot;Acc:Q19269])

HSP 1 Score: 108.997 bits (271), Expect = 4.203e-26
Identity = 72/208 (34.62%), Postives = 106/208 (50.96%), Query Frame = 1
Query:  166 NKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSD-QYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEF---QRYLYYVWMKDLSFGDVKRINLMYKCNDH 774
            +K W    + Y ++      D+   +  A D Y+ +TC++F P    D  Y  + R  + GC++ +G  R  G QTV+L +  C   G+  HEL H +G  HEH   DRD  V +  DN+ P M   F    R  +   G+PYD +SVMHY + AF++   NGK   TII K+ E    QRY        LS  D K++N +Y+C ++
Sbjct:  122 DKLWPEGQVPY-MLEEGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCSSYVG--RAGGNQTVSLEVDKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAFSR---NGK--PTIIPKDNEADVGQRY-------KLSEMDSKKVNKLYQCGEY 314          
BLAST of Ast8 protein vs. Ensembl Celegans
Match: nas-13 (Zinc metalloproteinase nas-13 [Source:UniProtKB/Swiss-Prot;Acc:Q20191])

HSP 1 Score: 108.227 bits (269), Expect = 5.305e-26
Identity = 74/220 (33.64%), Postives = 105/220 (47.73%), Query Frame = 1
Query:  121 DIPLKFSTFMAERDENK----RWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSD-QYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            D PL F  F  +R+  +    +WE A I Y I            +  A++ Y+K+TC+ F P    D  Y  I+     GC +++G  R  G Q V+LG GC   G+ +HEL H +G  HE    DRD  V + W NV+  ++  F+  S + +   G  YD  SVMHY   AF+K   NGK     I KN E  +          S  D+ +IN++Y C
Sbjct:   98 DSPL-FGIFGVQRNAVRQTYLKWEQARIPYTISSQYSSYSRSK-IAEAIEEYRKKTCIDFSPKSAGDLDYIHIVP--DDGCYSLVG--RIGGKQPVSLGDGCIQKGIIIHELMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYSLNMIDHLGTKYDYGSVMHYAPTAFSK---NGKPTIEPIEKNVEIGQ------RAGFSENDIYKINMLYNC 302          
BLAST of Ast8 protein vs. Ensembl Celegans
Match: nas-1 (Zinc metalloproteinase nas-1 [Source:UniProtKB/Swiss-Prot;Acc:O62243])

HSP 1 Score: 102.449 bits (254), Expect = 4.133e-25
Identity = 74/222 (33.33%), Postives = 108/222 (48.65%), Query Frame = 1
Query:  118 NDIPLKFSTF-----MAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCN 768
            +D+ + F  F     +A   E  +W N  + Y I+   +   +   L  A D Y K TC++F P   +D+  ++I++   GC A     R  G Q V+L   C  Y   +HEL H IG  HEHQ  DRD  VS+ + NV       F+ +S   +S +G  YD  S+MHY     ++   NGK+  TI AKN  F   +      D S  D++R+N  YKC+
Sbjct:   56 HDMRIPFQRFKRGGGVAVAAEKDKWPNGRVPY-ILSAAYTSAQRAVLARAFDTYAKRTCIRFVPKSPADKDYIVIQK-LDGCYADFS--RVGGRQQVSLADECIDYATIIHELMHVIGFIHEHQREDRDSYVSILYQNVIQGANTDFDKLSNLGLSYYGEHYDYSSIMHYEANEGSR---NGKN--TIEAKNSHFTAIMGKA--SDFSTSDLRRVNRAYKCS 266          
BLAST of Ast8 protein vs. Ensembl Fly
Match: CG7631 (gene:FBgn0028945 transcript:FBtr0080754)

HSP 1 Score: 110.923 bits (276), Expect = 3.458e-28
Identity = 69/210 (32.86%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTV-----NLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
             +  E +RW NAT+ Y+I   +F    ++ +   M   +  +C++F PA   ++  + +   + GC++ +G   + G +TV     +L  GC   G   HEL HT+G HH+   P+RD  V +  +N+    +  F     D+V  F  PYD  S++HY   AF+    NG++  TI+A NPE Q  +    M  +S  DVKR+N MYKC
Sbjct:   51 GQLSETRRWPNATVPYRIS-EEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVG--YQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFS---INGEA--TIVALNPEGQEQMGQRLM--MSDTDVKRLNTMYKC 250          
BLAST of Ast8 protein vs. Ensembl Fly
Match: CG6696 (gene:FBgn0030947 transcript:FBtr0074611)

HSP 1 Score: 108.612 bits (270), Expect = 8.374e-27
Identity = 68/202 (33.66%), Postives = 106/202 (52.48%), Query Frame = 1
Query:  160 DENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIG-CRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYK 762
            +E   W  A + + I   DF  ++   +L A   Y   TC++FRP +  D++ ++I+    GC + +G  R+ G Q +NL    C  +G+ +HEL H +G +H+    +RD  V + W+N+       FN  +R  ++ FGV YD QSVMHY   AF+K   NGK+  TI   +P    Y      + LS  DV ++N MY+
Sbjct:  100 NERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVG--RRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK---NGKA--TIEPLDP----YASLGQRRGLSDKDVSKLNEMYE 290          
BLAST of Ast8 protein vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084690)

HSP 1 Score: 107.842 bits (268), Expect = 2.944e-25
Identity = 79/241 (32.78%), Postives = 118/241 (48.96%), Query Frame = 1
Query:   70 DLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKR-WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKF--RPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIA------KNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            DLL A+        S ++ PL+     A   + +R W+   I Y+I   +F          AM  ++  TC+KF  R  +    Y V   R S GC + +G+ R  G Q +++G  C  +G+ +HELGH +G  HEH  PDR+  V ++ +N+       FN +S D+V   G+ YD  S+MHY +  F+K    G  L TI+       K PE  + L       LS GD+ + NL+YKC
Sbjct:  500 DLLKAET-------SKDEEPLRHRVARAVTAKKERIWDYGVIPYEID-GNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVR-SCGCCSFVGK-RGNGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSK----GTYLDTILPIEMKGRKRPEIGQRL------RLSQGDIAQANLLYKC 720          
BLAST of Ast8 protein vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0339252)

HSP 1 Score: 107.842 bits (268), Expect = 2.944e-25
Identity = 79/241 (32.78%), Postives = 118/241 (48.96%), Query Frame = 1
Query:   70 DLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKR-WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKF--RPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIA------KNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            DLL A+        S ++ PL+     A   + +R W+   I Y+I   +F          AM  ++  TC+KF  R  +    Y V   R S GC + +G+ R  G Q +++G  C  +G+ +HELGH +G  HEH  PDR+  V ++ +N+       FN +S D+V   G+ YD  S+MHY +  F+K    G  L TI+       K PE  + L       LS GD+ + NL+YKC
Sbjct:  500 DLLKAET-------SKDEEPLRHRVARAVTAKKERIWDYGVIPYEID-GNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVR-SCGCCSFVGK-RGNGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSK----GTYLDTILPIEMKGRKRPEIGQRL------RLSQGDIAQANLLYKC 720          
BLAST of Ast8 protein vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084689)

HSP 1 Score: 107.842 bits (268), Expect = 2.944e-25
Identity = 79/241 (32.78%), Postives = 118/241 (48.96%), Query Frame = 1
Query:   70 DLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKR-WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKF--RPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIA------KNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            DLL A+        S ++ PL+     A   + +R W+   I Y+I   +F          AM  ++  TC+KF  R  +    Y V   R S GC + +G+ R  G Q +++G  C  +G+ +HELGH +G  HEH  PDR+  V ++ +N+       FN +S D+V   G+ YD  S+MHY +  F+K    G  L TI+       K PE  + L       LS GD+ + NL+YKC
Sbjct:  500 DLLKAET-------SKDEEPLRHRVARAVTAKKERIWDYGVIPYEID-GNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVR-SCGCCSFVGK-RGNGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSK----GTYLDTILPIEMKGRKRPEIGQRL------RLSQGDIAQANLLYKC 720          
BLAST of Ast8 protein vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 107.071 bits (266), Expect = 5.071e-25
Identity = 67/218 (30.73%), Postives = 103/218 (47.25%), Query Frame = 1
Query:  112 SSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            S+ ++  +       R E K W    I Y ++  +F   +   L  AM  ++K+TC+ F      + Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V++  DN+ P  +  F  +   DV+  G PYD  S+MHY +  F++    G  L TI+    E            LS GD+ +   +Y+C
Sbjct:  146 SARNVKSRVPRAATSRAE-KIWPGGVIPY-VIGGNFTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYV--GRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSR----GMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRC 355          
BLAST of Ast8 protein vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 107.071 bits (266), Expect = 5.071e-25
Identity = 67/218 (30.73%), Postives = 103/218 (47.25%), Query Frame = 1
Query:  112 SSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            S+ ++  +       R E K W    I Y ++  +F   +   L  AM  ++K+TC+ F      + Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V++  DN+ P  +  F  +   DV+  G PYD  S+MHY +  F++    G  L TI+    E            LS GD+ +   +Y+C
Sbjct:  146 SARNVKSRVPRAATSRAE-KIWPGGVIPY-VIGGNFTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYV--GRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSR----GMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRC 355          
BLAST of Ast8 protein vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 107.071 bits (266), Expect = 5.071e-25
Identity = 67/218 (30.73%), Postives = 103/218 (47.25%), Query Frame = 1
Query:  112 SSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            S+ ++  +       R E K W    I Y ++  +F   +   L  AM  ++K+TC+ F      + Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V++  DN+ P  +  F  +   DV+  G PYD  S+MHY +  F++    G  L TI+    E            LS GD+ +   +Y+C
Sbjct:  146 SARNVKSRVPRAATSRAE-KIWPGGVIPY-VIGGNFTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYV--GRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSR----GMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRC 355          
BLAST of Ast8 protein vs. Ensembl Zebrafish
Match: bmp1b (bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB-GENE-060818-2])

HSP 1 Score: 100.908 bits (250), Expect = 7.151e-23
Identity = 66/204 (32.35%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-------NPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W N  I Y I+  +F   +      AM  ++K TC+ F      + Y V   R  G C + +G+ R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V +  +N+ P  +  F  +  DDV   G  YD  S+MHY +  F++    G  L T++ K        P  QR         LS GD+ +   +Y+C
Sbjct:  113 WPNGIIPY-IISGNFTGSQRAIFKQAMRHWEKHTCVTFVERSVEESYIVFTLRPCG-CCSFVGR-RGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVDIFRENIQPGQEYNFIKMEPDDVDSLGEVYDFDSIMHYARNTFSR----GIYLDTMLPKYDVDGVRPPIGQR-------TRLSKGDIAQARKLYRC 302          
BLAST of Ast8 protein vs. Ensembl Zebrafish
Match: bmp1b (bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB-GENE-060818-2])

HSP 1 Score: 100.908 bits (250), Expect = 7.228e-23
Identity = 66/204 (32.35%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-------NPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W N  I Y I+  +F   +      AM  ++K TC+ F      + Y V   R  G C + +G+ R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V +  +N+ P  +  F  +  DDV   G  YD  S+MHY +  F++    G  L T++ K        P  QR         LS GD+ +   +Y+C
Sbjct:  113 WPNGIIPY-IISGNFTGSQRAIFKQAMRHWEKHTCVTFVERSVEESYIVFTLRPCG-CCSFVGR-RGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVDIFRENIQPGQEYNFIKMEPDDVDSLGEVYDFDSIMHYARNTFSR----GIYLDTMLPKYDVDGVRPPIGQR-------TRLSKGDIAQARKLYRC 302          
BLAST of Ast8 protein vs. Ensembl Xenopus
Match: asb14 (ankyrin repeat and SOCS box containing 14 [Source:Xenbase;Acc:XB-GENE-6465005])

HSP 1 Score: 103.99 bits (258), Expect = 9.610e-24
Identity = 71/224 (31.70%), Postives = 104/224 (46.43%), Query Frame = 1
Query:  115 SNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-------NPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            SN  P + +T   ER     W +  I Y ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  VS+  +N+ P  +  F  +  ++V   G  YD  S+MHY +  F++    G  L TI+ K        P  QR         LS GD+ +   +YKC
Sbjct:   49 SNRYPKRAATSRPER----VWPDGVIPY-VISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFLKMEPEEVESLGETYDFDSIMHYARNTFSR----GIFLDTILPKYDVNGVRPPIGQR-------TRLSSGDIAQARKLYKC 254          
BLAST of Ast8 protein vs. Ensembl Xenopus
Match: asb14 (ankyrin repeat and SOCS box containing 14 [Source:Xenbase;Acc:XB-GENE-6465005])

HSP 1 Score: 101.293 bits (251), Expect = 6.547e-23
Identity = 67/215 (31.16%), Postives = 99/215 (46.05%), Query Frame = 1
Query:  142 TFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-------NPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            T  A     + W +  I Y ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  VS+  +N+ P  +  F  +  ++V   G  YD  S+MHY +  F++    G  L TI+ K        P  QR         LS GD+ +   +YKC
Sbjct:   46 TEAATSRPERVWPDGVIPY-VISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFLKMEPEEVESLGETYDFDSIMHYARNTFSR----GIFLDTILPKYDVNGVRPPIGQR-------TRLSSGDIAQARKLYKC 246          
BLAST of Ast8 protein vs. Ensembl Xenopus
Match: asb14 (ankyrin repeat and SOCS box containing 14 [Source:Xenbase;Acc:XB-GENE-6465005])

HSP 1 Score: 100.908 bits (250), Expect = 8.218e-23
Identity = 66/212 (31.13%), Postives = 98/212 (46.23%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-------NPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            A     + W +  I Y ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  VS+  +N+ P  +  F  +  ++V   G  YD  S+MHY +  F++    G  L TI+ K        P  QR         LS GD+ +   +YKC
Sbjct:   78 ATSRPERVWPDGVIPY-VISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFLKMEPEEVESLGETYDFDSIMHYARNTFSR----GIFLDTILPKYDVNGVRPPIGQR-------TRLSSGDIAQARKLYKC 275          
BLAST of Ast8 protein vs. Ensembl Xenopus
Match: asb14 (ankyrin repeat and SOCS box containing 14 [Source:Xenbase;Acc:XB-GENE-6465005])

HSP 1 Score: 100.908 bits (250), Expect = 8.452e-23
Identity = 66/212 (31.13%), Postives = 98/212 (46.23%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-------NPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            A     + W +  I Y ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  VS+  +N+ P  +  F  +  ++V   G  YD  S+MHY +  F++    G  L TI+ K        P  QR         LS GD+ +   +YKC
Sbjct:   14 ATSRPERVWPDGVIPY-VISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFLKMEPEEVESLGETYDFDSIMHYARNTFSR----GIFLDTILPKYDVNGVRPPIGQR-------TRLSSGDIAQARKLYKC 211          
BLAST of Ast8 protein vs. Ensembl Xenopus
Match: asb14 (ankyrin repeat and SOCS box containing 14 [Source:Xenbase;Acc:XB-GENE-6465005])

HSP 1 Score: 100.908 bits (250), Expect = 8.916e-23
Identity = 66/212 (31.13%), Postives = 98/212 (46.23%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-------NPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            A     + W +  I Y ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  VS+  +N+ P  +  F  +  ++V   G  YD  S+MHY +  F++    G  L TI+ K        P  QR         LS GD+ +   +YKC
Sbjct:   76 ATSRPERVWPDGVIPY-VISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFLKMEPEEVESLGETYDFDSIMHYARNTFSR----GIFLDTILPKYDVNGVRPPIGQR-------TRLSSGDIAQARKLYKC 273          
BLAST of Ast8 protein vs. Ensembl Mouse
Match: Mep1a (meprin 1 alpha [Source:MGI Symbol;Acc:MGI:96963])

HSP 1 Score: 105.916 bits (263), Expect = 1.306e-24
Identity = 68/215 (31.63%), Postives = 114/215 (53.02%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCN------DHC 777
            A RD + RW+   I Y I+  +   +    +L+A ++++ ++C+ F+P  +  + S II +   GC +++G D++ G Q +++G GC +     HE+ H +G  HE    DRD  V++ WD +    +  FNT   + ++    PYD +S+MHYG ++F K +    S+ TI  K PEF   +    + D S  D+ R+N MY C       DHC
Sbjct:   79 AMRDPSSRWK-LPIPY-ILADNLELNAKGAILHAFEMFRLKSCVDFKP--YEGESSYIIFQKLSGCWSMIG-DQQVG-QNISIGEGCDFKATIEHEILHALGFFHEQSRTDRDDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSFNKNE----SIPTITTKIPEFNTIIGQ--LPDFSAIDLIRLNRMYNCTATHTLLDHC 281          
BLAST of Ast8 protein vs. Ensembl Mouse
Match: Mep1a (meprin 1 alpha [Source:MGI Symbol;Acc:MGI:96963])

HSP 1 Score: 105.916 bits (263), Expect = 1.434e-24
Identity = 68/215 (31.63%), Postives = 114/215 (53.02%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCN------DHC 777
            A RD + RW+   I Y I+  +   +    +L+A ++++ ++C+ F+P  +  + S II +   GC +++G D++ G Q +++G GC +     HE+ H +G  HE    DRD  V++ WD +    +  FNT   + ++    PYD +S+MHYG ++F K +    S+ TI  K PEF   +    + D S  D+ R+N MY C       DHC
Sbjct:   66 AMRDPSSRWK-LPIPY-ILADNLELNAKGAILHAFEMFRLKSCVDFKP--YEGESSYIIFQKLSGCWSMIG-DQQVG-QNISIGEGCDFKATIEHEILHALGFFHEQSRTDRDDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSFNKNE----SIPTITTKIPEFNTIIGQ--LPDFSAIDLIRLNRMYNCTATHTLLDHC 268          
BLAST of Ast8 protein vs. Ensembl Mouse
Match: Bmp1 (bone morphogenetic protein 1 [Source:MGI Symbol;Acc:MGI:88176])

HSP 1 Score: 98.9821 bits (245), Expect = 3.580e-22
Identity = 61/197 (30.96%), Postives = 92/197 (46.70%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W +  I + ++  +F   +      AM  ++K TC+ F      D Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  VS+  +N+ P  +  F  +   +V   G  YD  S+MHY +  F++    G  L TI+ K               LS GD+ +   +YKC
Sbjct:  135 WPDGVIPF-VIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSR----GIFLDTIVPKYEVNGVKPSIGQRTRLSKGDIAQARKLYKC 324          
BLAST of Ast8 protein vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 97.0561 bits (240), Expect = 1.427e-21
Identity = 70/236 (29.66%), Postives = 111/236 (47.03%), Query Frame = 1
Query:   67 QDLLNAKEFHPNDFESSNDIPLKFSTFM--AERDENKR-WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            +D  +A  F PN   +SN     FS  +  A     +R W    I Y ++  +F   +      AM  ++K TC+ F      + + V   R + GC + +G+ R  G Q +++G  C  +G+  HELGH +G  HEH  PDRD  V++  +N+ P  +  F  +   +VS  G  YD  S+MHY +  F++    G  L TI+ +  +            LS GD+ +   +YKC
Sbjct:  118 KDGKDATTFLPNP-GTSNTTAKTFSARVRRATTSRTERIWPGGVIPY-VIGGNFTGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIVFSYR-TCGCCSYVGR-RGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSR----GVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKC 345          
BLAST of Ast8 protein vs. Ensembl Mouse
Match: Tll1 (tolloid-like [Source:MGI Symbol;Acc:MGI:106923])

HSP 1 Score: 96.6709 bits (239), Expect = 2.089e-21
Identity = 64/232 (27.59%), Postives = 103/232 (44.40%), Query Frame = 1
Query:  106 FESSNDIPLKFSTFMAERDENKR------------WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
             E +N +  K    ++E+ E  R            W    I Y ++  +F   +      AM  ++K TC+ F      + Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V++  +N+ P  +  F  +   +V+  G  YD  S+MHY +  F++    G  L TI+    +            LS GD+ +   +Y+C
Sbjct:  122 LEQNNTMKGKAPPKLSEQSEKNRVPRAATSRTERIWPGGVIPY-VIGGNFTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYV--GRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSR----GMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRC 346          
BLAST of Ast8 protein vs. UniProt/SwissProt
Match: sp|Q20958|NAS29_CAEEL (Zinc metalloproteinase nas-29 OS=Caenorhabditis elegans OX=6239 GN=nas-29 PE=2 SV=4)

HSP 1 Score: 120.553 bits (301), Expect = 4.500e-29
Identity = 78/240 (32.50%), Postives = 121/240 (50.42%), Query Frame = 1
Query:  175 WENAT-IVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFI-TKDCK-CETKQNFANRRCYDIFNS 885
            W+N    ++   LT   K  I   L A+  + +ETC++F P  F  +Y + I     GC + +G+D  +G Q V++G GC  +G+  HEL H +G+ HE    DRD  V      V+  +   F  IS   +S +G+PYD+ SVMHY    F    +N  S+ T+ A +   Q+ +    ++  SF DV  +N  Y+C + CP   PC +  GF  +++CK C+    F    C  I +S
Sbjct:  147 WKNGVAFMFHESLTPIAKTAI---LKAVHFWYRETCIEFHPRTFQKEYLLFIG-NDDGCWSTVGRDASQGKQVVSIGNGCEHFGVTSHELAHALGIFHEQSRFDRDESVVFNPRVVERDLLFNFAKISPRQMSTYGLPYDIGSVMHYTPTEF----SNIPSIPTLAAIDTNLQQTM--GQLEGPSFVDVHIMNQHYQCQEKCPTQAPC-QNGGFTNSRNCKVCKCPTGFGGAYCQLIASS 375          
BLAST of Ast8 protein vs. UniProt/SwissProt
Match: sp|Q9U3S9|NAS6_CAEEL (Zinc metalloproteinase nas-6 OS=Caenorhabditis elegans OX=6239 GN=nas-6 PE=2 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 8.919e-27
Identity = 72/214 (33.64%), Postives = 112/214 (52.34%), Query Frame = 1
Query:  124 IPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            +P     F A +++   WE   I Y++  T F  +EI  L  A D Y++ TC++F   +    Y  I++    GC + +G  R  G Q ++LG GC ++ + +HEL H++G  HEH   DRD  + + WDN+ P MK  F+ IS     + G  YD +S+MHY   AF++   NG++  TI      F + +      DLS  D+ +IN +Y C
Sbjct:   64 LPEGPVLFNALKNKQLTWEGGVIPYEMD-TAFSPNEIKILEKAFDSYRRTTCIRFEKREGQTDYLNIVK--GYGCYSQVG--RTGGKQEISLGRGCFFHEIIVHELMHSVGFWHEHSRADRDDHIKINWDNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDSTAFSR---NGRN--TIETVENGFTQVIGTAM--DLSPLDIVKINKLYSC 265          
BLAST of Ast8 protein vs. UniProt/SwissProt
Match: sp|Q19269|NAS14_CAEEL (Zinc metalloproteinase nas-14 OS=Caenorhabditis elegans OX=6239 GN=nas-14 PE=2 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 5.346e-25
Identity = 72/208 (34.62%), Postives = 106/208 (50.96%), Query Frame = 1
Query:  166 NKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSD-QYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEF---QRYLYYVWMKDLSFGDVKRINLMYKCNDH 774
            +K W    + Y ++      D+   +  A D Y+ +TC++F P    D  Y  + R  + GC++ +G  R  G QTV+L +  C   G+  HEL H +G  HEH   DRD  V +  DN+ P M   F    R  +   G+PYD +SVMHY + AF++   NGK   TII K+ E    QRY        LS  D K++N +Y+C ++
Sbjct:  122 DKLWPEGQVPY-MLEEGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCSSYVG--RAGGNQTVSLEVDKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAFSR---NGK--PTIIPKDNEADVGQRY-------KLSEMDSKKVNKLYQCGEY 314          
BLAST of Ast8 protein vs. UniProt/SwissProt
Match: sp|Q20191|NAS13_CAEEL (Zinc metalloproteinase nas-13 OS=Caenorhabditis elegans OX=6239 GN=nas-13 PE=2 SV=5)

HSP 1 Score: 108.227 bits (269), Expect = 6.749e-25
Identity = 74/220 (33.64%), Postives = 105/220 (47.73%), Query Frame = 1
Query:  121 DIPLKFSTFMAERDENK----RWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSD-QYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            D PL F  F  +R+  +    +WE A I Y I            +  A++ Y+K+TC+ F P    D  Y  I+     GC +++G  R  G Q V+LG GC   G+ +HEL H +G  HE    DRD  V + W NV+  ++  F+  S + +   G  YD  SVMHY   AF+K   NGK     I KN E  +          S  D+ +IN++Y C
Sbjct:   98 DSPL-FGIFGVQRNAVRQTYLKWEQARIPYTISSQYSSYSRSK-IAEAIEEYRKKTCIDFSPKSAGDLDYIHIVP--DDGCYSLVG--RIGGKQPVSLGDGCIQKGIIIHELMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYSLNMIDHLGTKYDYGSVMHYAPTAFSK---NGKPTIEPIEKNVEIGQ------RAGFSENDIYKINMLYNC 302          
BLAST of Ast8 protein vs. UniProt/SwissProt
Match: sp|P42674|BP10_PARLI (Blastula protease 10 OS=Paracentrotus lividus OX=7656 GN=BP10 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.635e-25
Identity = 77/261 (29.50%), Postives = 125/261 (47.89%), Query Frame = 1
Query:  163 ENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSV------IIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCND--HCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRLKADCDK 921
            E++RW    I Y I  +   +  +  + NAMD +++ TCL+F P   S    +         RGSG C + +G+    G Q +++G GC ++G  +HE+GH IG HHE   PDRD  ++V + N+    +  F   +   V+   V YD+ S+MHYG + F+   +NG+   TI  ++P     L       LS  D++  NL+Y+C+D   C     C    G+   +C C     +    C D   ++     + DC +
Sbjct:   98 ESQRWPYKVIPYVISPSSSGQSSL--IRNAMDHWEQNTCLRFEPRTSSHSRQLGHNAYLSFFRGSG-CWSYVGK-AFNGEQQISIGNGCAYFGTIVHEIGHAIGFHHEQSRPDRDDYINVLYQNIQSGRQHNFAKYTWGRVTSRNVEYDVGSIMHYGGYGFS---SNGRP--TITTRDPRLNSRLGQRIA--LSPADIELANLIYECDDIEDCAGANECL-NGGYHDTECNCVCPSGYNGDLCEDAVTTT-----RPDCSE 341          
BLAST of Ast8 protein vs. TrEMBL
Match: A0A060Q6V2 (Metalloendopeptidase OS=Schmidtea mediterranea OX=79327 GN=Ast8 PE=2 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 320/321 (99.69%), Postives = 321/321 (100.00%), Query Frame = 1
Query:   31 MKIFVFLVIYFIQDLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCYEAI 993
            MKIFVFLVIYFIQDLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYD+FNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCYEAI
Sbjct:    1 MKIFVFLVIYFIQDLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDVFNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCYEAI 321          
BLAST of Ast8 protein vs. TrEMBL
Match: A0A481SPQ1 (Metalloendopeptidase OS=Colubraria reticulata OX=604273 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 3.003e-56
Identity = 115/278 (41.37%), Postives = 162/278 (58.27%), Query Frame = 1
Query:  172 RWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNL-GIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKC-----ETKQNFANRRCYDIFNSSECQ--RLKADCDKTGTYEQYYVFTNCRKTCRKC 981
            RW + TI Y+ + + F  DEI  +  AM  +Q+ TCLKFRPA  +D+  +  + G G CN+ LG     GTQ +NL   GCR+ GL+LHE+GH IGL HEHQ PDRD  + V +DNV PSM+VWFN  S  DV+ +GVPY+  SVMHYG  AF+K      S  TI A++   ++ +  V++K LSF D+K +N MY CN HC K+  C E   ++ K CKC     +         C ++++  +C       +CDK       ++  NC+K+C+ C
Sbjct:  115 RWTDKTIPYEFIASHFSVDEIYYIKAAMARWQETTCLKFRPATRADKNRIRFQNGRG-CNSHLGM--TGGTQPINLEARGCRYSGLYLHEVGHAIGLVHEHQLPDRDQYIYVIYDNVAPSMRVWFNKYSTKDVNQYGVPYEYSSVMHYGVTAFSKDG----SAQTIRARDRSKEKEIGRVYLKGLSFSDIKVVNKMYDCNKHCAKDDNCKE-PAYLDKKCKCVRPDGDITTTTKPGSCTNVWDDGQCDGWSQSGECDK----NPLWMKENCKKSCKVC 380          
BLAST of Ast8 protein vs. TrEMBL
Match: A0A1S3H5F6 (Metalloendopeptidase OS=Lingula unguis OX=7574 GN=LOC106152365 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.240e-53
Identity = 117/291 (40.21%), Postives = 170/291 (58.42%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNL-GIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFAN-RRCYDIF---NSSECQRLKAD--C-----DKTGTYEQYYVFTNCRKTCRKCYE 987
            A  D   +W NAT+ Y I+ +DF ++EI  +  AM  ++  TC KFRPA   D   V+ + G G CN+ +G     G Q +NL   GCRW GL+LHE+GH +G  HEHQ PDRD  + + ++NV P M+ WF+   R++V+ +G  YD+ S+MHYG  AFA   A+GKS  TI AK+   +  +  VW K+L+F D++ +N MY C  HCPK + C + +GF+ K CKC  K   +N +R   I    ++S C+ +K D  C     D        ++  NCRK+C KC++
Sbjct:   90 ATSDLTLKWTNATMPYDIITSDFSENEIKIIHIAMREWEHHTCFKFRPAGPLDFNKVVFKNGIG-CNSQVGM--VGGPQELNLEAPGCRWKGLYLHEIGHAMGFFHEHQMPDRDNYIEINYNNVAPVMRQWFDKYPRNEVNTYGTSYDLSSIMHYGITAFA---ADGKS-QTIRAKDRSKEHTIGKVWQKELAFSDIRVVNEMYHCAAHCPKTVRCVD-EGFLDKHCKCVCKDGTSNCQRGTPITTGPDNSNCKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFD 372          
BLAST of Ast8 protein vs. TrEMBL
Match: A0A0R3ST61 (Metalloendopeptidase OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8554 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 3.020e-53
Identity = 107/273 (39.19%), Postives = 155/273 (56.78%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRL--KADCDKTGTYEQYYVFTNCRKTCRKCY 984
            W N  I Y I    F  DE+  L +A+D++  ETC+ F P +  D+  + I  G+   +  +G     G Q +     GCR+YGL+LHELGH IGL HEH   +RD  + V    V  ++K +F   +++ +  F  PYD+QSVMHYGQ +F+ T A+    T I  K+ + +  L  V++KD+SF DV+ +NL Y C D C  + P  E  GFI K+CKC+T   FA RRC D + +S C +L  K +C +  +    ++  NCRKTC+ CY
Sbjct:   39 WPNGRIPYTISKAYFSMDELRDLQSAIDVWNSETCVHFVPYRRGDKSWISITDGTSCYSQYMGYKGMPGEQAIMFSKNGCRFYGLYLHELGHAIGLDHEHVRAERDEYLKVDTAGVPDNLKSFFTKKTKNQLLTFDSPYDLQSVMHYGQSSFS-TFADK---TPINVKDAKLRPLLKDVYIKDVSFWDVRAVNLNYDCKDRCRGSKPKCEFPGFIDKNCKCQTPAGFAKRRCVDSYGTSNCAKLADKLECYRNAS----FMTANCRKTCKFCY 303          
BLAST of Ast8 protein vs. TrEMBL
Match: A0A0R3TZ58 (Metalloendopeptidase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS13131 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.008e-50
Identity = 109/274 (39.78%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRLKADCDKTGTYE-QYYVFTNCRKTCRKCYEA 990
            W    I Y I    F K+E+  L +++D++  ETC+ F P +  D+  V I  G+   +  +G     G Q V L   GCR+YGL+LHELGH IGL HEH   DRD  ++V  D V   MK +F   +++ +  F  PYD+QS+MHYGQ +F+         T I  K+P+ +  L  V+ KD+SF DV+ +NL Y C + C  + P  E  GFI K+CKC+T + F+ RRC D + +S C RL    D+   Y    ++  NCRKTC  CY A
Sbjct:   39 WSYNRIPYIIDKLYFSKNELRDLQSSIDVWNSETCVNFVPYRRGDKSWVRITDGTSCYSQYMGFKGAPGEQIVTLSRNGCRFYGLYLHELGHVIGLDHEHVRADRDEYLNVDTDGVPDDMKSFFTRKTKNQLLAFDSPYDLQSIMHYGQSSFSVF----ADKTPIDVKDPKLRPLLKDVYEKDISFWDVRAVNLNYNCKEQCRGSKPKCEFPGFIDKNCKCQTLEGFSKRRCIDSYGASNCARLA---DQLECYRNSSFMTANCRKTCGFCYVA 305          
BLAST of Ast8 protein vs. Ensembl Cavefish
Match: ENSAMXT00000033223.1 (high choriolytic enzyme 1-like [Source:NCBI gene;Acc:111197481])

HSP 1 Score: 107.071 bits (266), Expect = 8.295e-27
Identity = 65/188 (34.57%), Postives = 97/188 (51.60%), Query Frame = 1
Query:  205 VLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            V  DF   +   +  AM  +  +TC++F        Y  I  R   GC + LG  R  G Q V+L   GC ++G+  HEL H +G +HEH   DRD  V++ W N+DP+M+  FN   +++ +    PYD  SVMHYG+ AF     N  ++T I   + +  + +      DLS  D++RIN +Y C
Sbjct:   83 VSADFSSTDRAVIAGAMATFHSKTCIRFVDRSTEIDYLSIENRD--GCYSSLG--RTGGKQVVSLSTRGCVYHGIVQHELNHALGFYHEHTRSDRDRYVTINWQNIDPTMQYNFN---KENTNNLNTPYDYSSVMHYGKTAFTINGLN--TITPIPDASVQIGQRV------DLSVIDIQRINTLYNC 255          
BLAST of Ast8 protein vs. Ensembl Cavefish
Match: ENSAMXT00000056363.1 (high choriolytic enzyme 1-like [Source:NCBI gene;Acc:111197481])

HSP 1 Score: 107.071 bits (266), Expect = 8.295e-27
Identity = 65/188 (34.57%), Postives = 97/188 (51.60%), Query Frame = 1
Query:  205 VLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            V  DF   +   +  AM  +  +TC++F        Y  I  R   GC + LG  R  G Q V+L   GC ++G+  HEL H +G +HEH   DRD  V++ W N+DP+M+  FN   +++ +    PYD  SVMHYG+ AF     N  ++T I   + +  + +      DLS  D++RIN +Y C
Sbjct:   83 VSADFSSTDRAVIAGAMATFHSKTCIRFVDRSTEIDYLSIENRD--GCYSSLG--RTGGKQVVSLSTRGCVYHGIVQHELNHALGFYHEHTRSDRDRYVTINWQNIDPTMQYNFN---KENTNNLNTPYDYSSVMHYGKTAFTINGLN--TITPIPDASVQIGQRV------DLSVIDIQRINTLYNC 255          
BLAST of Ast8 protein vs. Ensembl Cavefish
Match: ENSAMXT00000044782.1 (high choriolytic enzyme 1-like [Source:NCBI gene;Acc:111197481])

HSP 1 Score: 107.071 bits (266), Expect = 8.295e-27
Identity = 65/188 (34.57%), Postives = 97/188 (51.60%), Query Frame = 1
Query:  205 VLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            V  DF   +   +  AM  +  +TC++F        Y  I  R   GC + LG  R  G Q V+L   GC ++G+  HEL H +G +HEH   DRD  V++ W N+DP+M+  FN   +++ +    PYD  SVMHYG+ AF     N  ++T I   + +  + +      DLS  D++RIN +Y C
Sbjct:   83 VSADFSSTDRAVIAGAMATFHSKTCIRFVDRSTEIDYLSIENRD--GCYSSLG--RTGGKQVVSLSTRGCVYHGIVQHELNHALGFYHEHTRSDRDRYVTINWQNIDPTMQYNFN---KENTNNLNTPYDYSSVMHYGKTAFTINGLN--TITPIPDASVQIGQRV------DLSVIDIQRINTLYNC 255          
BLAST of Ast8 protein vs. Ensembl Cavefish
Match: ENSAMXT00000031294.1 (high choriolytic enzyme 1-like [Source:NCBI gene;Acc:111191931])

HSP 1 Score: 106.301 bits (264), Expect = 2.047e-26
Identity = 65/188 (34.57%), Postives = 96/188 (51.06%), Query Frame = 1
Query:  205 VLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            V  DF   +   +  AM  +  +TC++F        Y  I  R   GC + LG  R  G Q V+L   GC ++G+  HEL H +G +HEH   DRD  V++ W N+DP+M+  FN   +++ +    PYD  SVMHYG+ AF     N  ++T I   + +  + +      DLS  D+ RIN +Y C
Sbjct:   83 VSADFSSTDRAVIAGAMATFHSKTCIRFVDRSTEIDYLSIENRD--GCYSSLG--RTGGKQVVSLSTRGCVYHGIVQHELNHALGFYHEHTRSDRDRYVTINWQNIDPTMQYNFN---KENTNNLNTPYDYSSVMHYGKTAFTINGLN--TITPIPDASVQIGQRV------DLSIIDILRINTLYNC 255          
BLAST of Ast8 protein vs. Ensembl Cavefish
Match: ENSAMXT00000035014.1 (high choriolytic enzyme 1-like [Source:NCBI gene;Acc:111197481])

HSP 1 Score: 103.605 bits (257), Expect = 1.518e-25
Identity = 64/188 (34.04%), Postives = 96/188 (51.06%), Query Frame = 1
Query:  205 VLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            V  DF   +   +  AM  +  +TC++F        Y  I  R   GC + LG  R  G Q V+L   GC ++G+  HEL H +G +HEH   DRD  V++ W N+DP+M+  FN   +++ +     YD  SVMHYG+ AF     N  ++T I   + +  + +      DLS  D++RIN +Y C
Sbjct:   75 VSADFSSTDRAVIAGAMATFHSKTCIRFVDRSTEIDYLSIENRD--GCYSSLG--RTGGKQVVSLSTRGCVYHGIVQHELNHALGFYHEHTRSDRDRYVTINWQNIDPTMQYNFN---KENTNNLNTLYDYSSVMHYGKTAFTINGLN--TITPIPDASVQIGQRV------DLSVIDIQRINTLYNC 247          
BLAST of Ast8 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007253.1 (pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1 gene:ENSPMAG00000006538.1 transcript:ENSPMAT00000007253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 4.991e-22
Identity = 60/197 (30.46%), Postives = 91/197 (46.19%), Query Frame = 1
Query:  175 WENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            W    I Y IV  +F   +      AM  ++K TC+ F      + Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V++   N+ P  +  F  +   +V   G  YD  S+MHY +  F++    G  L TI+ +  +            LS GD+ +   +Y+C
Sbjct:   22 WPGGVIPY-IVGGNFTGSQKAMFRQAMRHWEKHTCVTFIERTDEESYIVFTYRPCGCCSYV--GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIKANIQPGQEYNFLKMEPGEVDSLGESYDFDSIMHYARNTFSR----GIFLDTILPRPDDSGVRPAIGQRTRLSQGDIAQARKLYRC 211          
BLAST of Ast8 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004913.1 (pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 gene:ENSPMAG00000004462.1 transcript:ENSPMAT00000004913.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 3.882e-14
Identity = 36/78 (46.15%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  379 GTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHY 612
            G Q V++G GC   G   HELGH +G  HE   PDRD  +SV   NV       F   S  D    GVPYD++SVMHY
Sbjct:   11 GEQVVSIGRGCEGVGTVAHELGHAVGYVHEQSRPDRDAFISVLEGNVQDGQLPQFAVYSATDPR--GVPYDLKSVMHY 86          
BLAST of Ast8 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001798.1 (pep scaffold:Pmarinus_7.0:GL485204:1983:11197:1 gene:ENSPMAG00000001629.1 transcript:ENSPMAT00000001798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 5.173e-11
Identity = 49/206 (23.79%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  151 AERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCN 768
            A RD+  RW      Y  +  D     +  ++ A ++Y+ +TC+ F+P     +Y  +I+    GC + +G +   G Q +++G  C    +    L H +  +         + V+  +  +    +  F+    D   +  VPYD  S+MHYG  AF K +       TI+ + P+F + +      D S  D++++N +Y C 
Sbjct:    5 AVRDDRYRWPKTIPYYLDISLDVNAKGV--IMQAFEMYRLKTCIDFKPWAGEREYIQVIK--GSGCWSYVG-NLHYGKQELSIGANCDRLLVVPFNLAHLMDSYLHITTSMLVLFVAGHFTVLALGREGNFDKYEDDVTDLQNVPYDYSSMMHYGASAFQKAEE-----PTIVTRIPDFMQVI--GQRSDFSKYDLQKLNRLYNCT 198          
BLAST of Ast8 protein vs. Ensembl Nematostella
Match: EDO43132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN5])

HSP 1 Score: 129.798 bits (325), Expect = 1.924e-35
Identity = 83/267 (31.09%), Postives = 134/267 (50.19%), Query Frame = 1
Query:  241 LLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAK-NPEFQRYLYYVWMKDLSFGDVKRINLMYKCN----------------DHCP---KNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKC 981
            +   ++ Y K TCL+F        Y  +++  SG CN+++G     G Q +N+G GC++ GL LHE GH IG  HEH  PDRD  ++V WDNV P  K  F      + +  G+PYD+ S+MHY   AFAK    G   TTI  K +P ++  +  V++++ S  D+K+IN++Y C                 D CP    +  CS  + +++ +C    +       C D +   +C    +  + +  ++  ++  NC+K+CR C
Sbjct:   15 IYKGIEHYHKYTCLRFVKRTTEKDYIRVMKPQSG-CNSMVGV--MGGEQILNMGDGCQYVGLVLHEFGHAIGYFHEHNRPDRDNTINVLWDNVQPWFKDAFKKYQFSEANTQGLPYDLTSIMHYENTAFAKA---GFCKTTITVKSDPTYE--ISPVYLREFSPQDIKKINMLYGCTTNQLPPVACVCEDKYKDRCPGWASSGECSNNNAWMSNNCPKSCRTCGDPNLCEDKY--PKCSSWASTGECSANFQ--WMHQNCKKSCRVC 269          
BLAST of Ast8 protein vs. Ensembl Nematostella
Match: EDO42421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1T1])

HSP 1 Score: 116.701 bits (291), Expect = 2.243e-31
Identity = 74/202 (36.63%), Postives = 107/202 (52.97%), Query Frame = 1
Query:  166 NKRWENATIVYQIVLTDFRKDE-IDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCN 768
             K W    +VY++     R    ++ L  A+  Y+K TC++FR    +D   V I+   GGC + +G  RK G Q ++L  GC   G  +HELGH +G  HE   PDRD  V++ ++N+   M   F   S  +V   G PYD  S+MHYG   F+   ANGK   TI+AK P  +    +     LS  D+K++NL+YKC+
Sbjct:    9 QKLWPGGVVVYELDPRFERSSRAMEKLTQAISDYEKYTCIRFRKKTANDNDYVYIKD-RGGCRSHVG--RKGGKQYLSLSSGCWHKGTIIHELGHALGFFHEQTRPDRDDYVTILFENIRLGMASNFMKHSAGEVDSLGTPYDYGSIMHYGPKIFS---ANGKP--TIVAKKPGVK----FGQRDGLSPIDIKQVNLLYKCS 198          
BLAST of Ast8 protein vs. Ensembl Nematostella
Match: EDO37770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEU5])

HSP 1 Score: 116.316 bits (290), Expect = 4.639e-30
Identity = 72/215 (33.49%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  163 ENKRWENATIVYQIVLTDFRKDEIDGLL-NAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSER 804
             +K+W NA + Y+I  +D +    +G++ NAM  ++ +TC++F+       Y    +    GC + +G    +G Q ++LG GC   G   HE+GH +G +HE   PDRD  V+V WDN+    K  FN  S D ++ FG PYD  S+MHYG   F+    NG++  T      +  +  Y   + DL   DV ++NL Y C +H      C  R
Sbjct:   60 HDKKWPNAILPYEI-RSDLKGTPAEGVIQNAMREWESKTCVRFQKRTTQKNYVYFFK--GDGCWSYVGM-LDRGAQAISLGSGCWHKGTAAHEIGHALGFYHEQSRPDRDNYVTVHWDNIKTDSKHNFNKYSADRINTFGTPYDFGSLMHYGTNYFS---VNGRATITPKKSGAKIGQRDY---LSDL---DVHQMNLRYGCPNHYKVEYGCLWR 261          
BLAST of Ast8 protein vs. Ensembl Nematostella
Match: EDO41420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I5])

HSP 1 Score: 113.62 bits (283), Expect = 6.963e-30
Identity = 65/199 (32.66%), Postives = 107/199 (53.77%), Query Frame = 1
Query:  172 RWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCN 768
            RW    + Y I  +      ++ +   M ++   TC++F+       Y+   R    GC++++G+  ++  Q ++L  GC + G   HE+GH +G +HE   PDRD  V++ W+N+ P+MK  FN   R  +   G PYD +SVMHY   AF+   +NG++  TI AK    Q  +     + LS  D++++NLMYKC+
Sbjct:   40 RWPEGVMAYTIDRS-LSNRAMNAIRAGMKMWTDNTCIRFKERTNEYAYARFWR--GRGCSSMVGRTGRR--QDISLAGGCWYPGTVAHEIGHALGFYHEQSRPDRDNYVTIHWNNISPNMKFNFNMYPRSTIDSLGTPYDYRSVMHYQGNAFS---SNGRA--TITAK----QSGVTLGNRRQLSKVDIQQMNLMYKCS 224          
BLAST of Ast8 protein vs. Ensembl Nematostella
Match: EDO47591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE7])

HSP 1 Score: 108.997 bits (271), Expect = 9.165e-29
Identity = 62/175 (35.43%), Postives = 88/175 (50.29%), Query Frame = 1
Query:  241 LLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            +  A  + ++ TC+KF   K    Y       SG C + +G  R +G QTV+LG GCR  G   HEL HT+G +HEH  PDRD  V + WDN+ P  +  F   S    +  G  YD +S+MHY +  F+K   N    T    +NP+ +       +  LS  D+ +IN +Y C
Sbjct:    1 IRKASSVIERYTCIKFEERKHQRDYVEFYMDKSGICESDIG--RIRGRQTVSLGQGCRNPGHVTHELMHTLGFYHEHTRPDRDKFVRILWDNIKPGNRPQFEIRSESKATTLGQQYDFRSIMHYRKTEFSKNGQN----TIEAVQNPDME----LGSVNSLSAVDIMQINRLYNC 165          
BLAST of Ast8 protein vs. Ensembl Medaka
Match: ENSORLT00000042892.1 (pep primary_assembly:ASM223467v1:16:21889441:21899077:-1 gene:ENSORLG00000026331.1 transcript:ENSORLT00000042892.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.556e-25
Identity = 66/198 (33.33%), Postives = 110/198 (55.56%), Query Frame = 1
Query:  241 LLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKC 834
            +L A+D ++ ++C+ F+  + +++Y + I++   GC + +G+    G Q ++LG+GC +     HE+ H +G +HE    DRD  V + WDN+    +  FN   RD  +  G PYD  SVMHY + AF  T+ NG   +TII  +P+FQ  +      ++S  DV  +NL+YKCN     N+ C   +G + +  +C
Sbjct:   19 ILRALDQFRLKSCIDFK-LRDAEEYYLSIQK-LDGCFSSIGRAVANG-QVLSLGVGCEYVHTVEHEILHALGFYHEQSRYDRDDYVRIVWDNILKGKEHNFNKFPRDVSTTHGTPYDYWSVMHYSKDAF--TNGNG---STIITLDPKFQNVIGQTL--EMSHYDVLELNLLYKCNSTVAFNMYCGFSNGTLCEMDRC 206          
BLAST of Ast8 protein vs. Ensembl Medaka
Match: ENSORLT00000031948.1 (pep primary_assembly:ASM223467v1:16:21892110:21899077:-1 gene:ENSORLG00000026331.1 transcript:ENSORLT00000031948.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.723e-25
Identity = 66/198 (33.33%), Postives = 110/198 (55.56%), Query Frame = 1
Query:  241 LLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKC 834
            +L A+D ++ ++C+ F+  + +++Y + I++   GC + +G+    G Q ++LG+GC +     HE+ H +G +HE    DRD  V + WDN+    +  FN   RD  +  G PYD  SVMHY + AF  T+ NG   +TII  +P+FQ  +      ++S  DV  +NL+YKCN     N+ C   +G + +  +C
Sbjct:   17 ILRALDQFRLKSCIDFK-LRDAEEYYLSIQK-LDGCFSSIGRAVANG-QVLSLGVGCEYVHTVEHEILHALGFYHEQSRYDRDDYVRIVWDNILKGKEHNFNKFPRDVSTTHGTPYDYWSVMHYSKDAF--TNGNG---STIITLDPKFQNVIGQTL--EMSHYDVLELNLLYKCNSTVAFNMYCGFSNGTLCEMDRC 204          
BLAST of Ast8 protein vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 103.99 bits (258), Expect = 4.999e-24
Identity = 67/214 (31.31%), Postives = 102/214 (47.66%), Query Frame = 1
Query:  124 IPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            IP + +T  AER     W    I Y ++  +F   +      AM  ++K+TC+ F      + Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V++  DN+ P  +  F  +   +V+  G PYD  S+MHY +  F++    G  L TI+    E            LS GD+ +   +Y+C
Sbjct:   56 IP-RAATSRAER----IWPGGVIPY-VIGGNFTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYV--GRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSR----GMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYRC 257          
BLAST of Ast8 protein vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 103.605 bits (257), Expect = 7.525e-24
Identity = 67/214 (31.31%), Postives = 102/214 (47.66%), Query Frame = 1
Query:  124 IPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            IP + +T  AER     W    I Y ++  +F   +      AM  ++K+TC+ F      + Y V   R  G C+ +    R  G Q +++G  C  +G+ +HELGH IG  HEH  PDRD  V++  DN+ P  +  F  +   +V+  G PYD  S+MHY +  F++    G  L TI+    E            LS GD+ +   +Y+C
Sbjct:  155 IP-RAATSRAER----IWPGGVIPY-VIGGNFTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYV--GRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSR----GMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYRC 356          
BLAST of Ast8 protein vs. Ensembl Medaka
Match: hce (Oryzias latipes protease (hce), mRNA. [Source:RefSeq mRNA;Acc:NM_001201498])

HSP 1 Score: 97.8265 bits (242), Expect = 3.261e-23
Identity = 68/204 (33.33%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  169 KRWENATIVYQIVLT-DFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQ--TVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGK-SLTTIIAKN-PEFQRYLYYVWMKDLSFGDVKRINLMYKC 765
            K+  N  +V   V++ ++   E+  +  AM  +  +TC++F   + +++Y  I      GC + LG  RK G Q  ++N G GC + G+  HEL H +G  HE    DRD  V + W+N+ P+    FN   + D +    PYD  S+MHYG+ AF+   A G+ S+T I   N P  QR     W       D+ RIN++Y C
Sbjct:   92 KKASNGLVVIPYVISSEYSGGEVATIEGAMRAFNGKTCIRF--VRRTNEYDFISVVSKTGCYSELG--RKGGLQELSINRG-GCMYSGIIQHELNHALGFQHEQTRSDRDSYVRINWENIIPASAYNFN---KHDTNNLNTPYDYSSIMHYGRDAFSI--AYGRDSITPIPNPNVPIGQRNGMSRW-------DITRINVLYNC 278          
BLAST of Ast8 protein vs. Planmine SMEST
Match: SMESG000073667.1 (SMESG000073667.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 320/321 (99.69%), Postives = 321/321 (100.00%), Query Frame = 1
Query:   31 MKIFVFLVIYFIQDLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCYEAI 993
            MKIFVFLVIYFIQDLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYD+FNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCYEAI
Sbjct:    1 MKIFVFLVIYFIQDLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDVFNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCYEAI 321          
BLAST of Ast8 protein vs. Planmine SMEST
Match: SMESG000074521.1 (SMESG000074521.1)

HSP 1 Score: 171.014 bits (432), Expect = 3.550e-50
Identity = 106/275 (38.55%), Postives = 148/275 (53.82%), Query Frame = 1
Query:  172 RWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSEC--QRLKADCDKTGTYEQYYVFTNCRKTCRKCYE 987
            +W +  I Y I    F ++E+  L +A++ +  ETC+ FR  + SD+  V I  G   C +I+G D     Q VNL   GCR YGL+LHELGH IGL HEH    RD  + +  +N+       F   ++ D   F +P+D+QS+MHYG  +F     N K   +I   N      L  V  KDLSF D K +NL YKC D C +N+ CS   G+I + C+C T ++F +RRC D  + S C  Q+ K  C+    Y  +    NCRKTC KC++
Sbjct:   39 QWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKIT-GGQNCYSIVGMDYF-AEQEVNLASPGCRHYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF----INEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSA-GGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSF----NCRKTCEKCFK 302          
BLAST of Ast8 protein vs. Planmine SMEST
Match: SMESG000074510.1 (SMESG000074510.1)

HSP 1 Score: 174.866 bits (442), Expect = 1.350e-49
Identity = 102/275 (37.09%), Postives = 153/275 (55.64%), Query Frame = 1
Query:  172 RWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGI-GCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSEC--QRLKADCDKTGTYEQYYVFTNCRKTCRKCYE 987
            +W N TI Y I  + F  +E+  L +A+D +  ETC++FR  K +D  + +   G   C++ +G + ++G Q+++L    CR+YG +LHELGH +GL HEH  P R+  + V  D +    + ++N     +++ + +PYD+QSVMHYG  +F+  D       TI  KN      L  V  KDLSF DVK INL YKC D C + + C   +G++ K C+C   + F NRRC +      C  Q+   +C+    Y   Y+  NCRKTC KCY+
Sbjct:   39 KWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFR-KKVNDDINWVKITGGTQCHSFVGMN-EEGEQSLSLASPDCRFYGTYLHELGHVLGLLHEHTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQ----PTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCP-LNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCE----YNSKYMSVNCRKTCDKCYK 302          
BLAST of Ast8 protein vs. Planmine SMEST
Match: SMESG000013804.1 (SMESG000013804.1)

HSP 1 Score: 135.191 bits (339), Expect = 8.469e-35
Identity = 93/273 (34.07%), Postives = 136/273 (49.82%), Query Frame = 1
Query:  166 NKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCY 984
            NK W    I Y I    F   +   L  A++ YQ ETCLKF   + +   + +       C + +G  +  G Q + L   CR YG+ +HELGHTIGL HE   PDR+  +    +N+    K+ F  I  +   +F  P+D QS+M Y  +AF+K   NG      +  N   +  ++ +  KDLSF DVK IN +Y+C  +C  N  CS  + ++ K+C C+T + F+NRRC D  N+ +   L A        E       CRKTC +C+
Sbjct:   34 NKLWTGNIIPY-ITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGM-QNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENIQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSK---NG--FPVWLKMNASDRTPIFDISEKDLSFWDVKAINDLYQCGKNC-SNTQCSSGN-YVDKNCACQTPEMFSNRRCVDDTNNMK-NCLNASETNICYNEPISASVMCRKTCGRCF 295          
BLAST of Ast8 protein vs. Planmine SMEST
Match: SMESG000005882.1 (SMESG000005882.1)

HSP 1 Score: 104.76 bits (260), Expect = 2.386e-24
Identity = 60/200 (30.00%), Postives = 94/200 (47.00%), Query Frame = 1
Query:  169 KRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEF-QRYLYYVWMKDLSFGDVKRINLMYKC 765
            + W +  I Y I   +F  +    ++ AM  ++  TCL F P + SD+  +I    + GC + +G+  +   Q +++G  C   G+ +HELGH IG  HEH  PDRD  V +  +NV       F  +   +V      YD QS+MHY +  F+K +             P   QR +       LS GD+++ N +Y C
Sbjct:  175 RTWTHGIIPYYI-QANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIM-------LSPGDIRQTNKLYNC 366          
The following BLAST results are available for this feature:
BLAST of Ast8 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEP1A7.125e-2330.11meprin A subunit alpha [Source:HGNC Symbol;Acc:HGN... [more]
BMP14.570e-2230.88bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
BMP15.032e-2230.88bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
BMP15.032e-2230.88bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
BMP15.838e-2230.88bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nas-293.538e-3032.50Zinc metalloproteinase nas-29 [Source:UniProtKB/S... [more]
nas-67.011e-2833.64Zinc metalloproteinase nas-6 [Source:UniProtKB/Sw... [more]
nas-144.203e-2634.62Zinc metalloproteinase nas-14 [Source:UniProtKB/S... [more]
nas-135.305e-2633.64Zinc metalloproteinase nas-13 [Source:UniProtKB/S... [more]
nas-14.133e-2533.33Zinc metalloproteinase nas-1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG76313.458e-2832.86gene:FBgn0028945 transcript:FBtr0080754[more]
CG66968.374e-2733.66gene:FBgn0030947 transcript:FBtr0074611[more]
tok2.944e-2532.78gene:FBgn0004885 transcript:FBtr0084690[more]
tok2.944e-2532.78gene:FBgn0004885 transcript:FBtr0339252[more]
tok2.944e-2532.78gene:FBgn0004885 transcript:FBtr0084689[more]
back to top
BLAST of Ast8 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll15.071e-2530.73tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll15.071e-2530.73tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll15.071e-2530.73tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
bmp1b7.151e-2332.35bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB... [more]
bmp1b7.228e-2332.35bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asb149.610e-2431.70ankyrin repeat and SOCS box containing 14 [Source:... [more]
asb146.547e-2331.16ankyrin repeat and SOCS box containing 14 [Source:... [more]
asb148.218e-2331.13ankyrin repeat and SOCS box containing 14 [Source:... [more]
asb148.452e-2331.13ankyrin repeat and SOCS box containing 14 [Source:... [more]
asb148.916e-2331.13ankyrin repeat and SOCS box containing 14 [Source:... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mep1a1.306e-2431.63meprin 1 alpha [Source:MGI Symbol;Acc:MGI:96963][more]
Mep1a1.434e-2431.63meprin 1 alpha [Source:MGI Symbol;Acc:MGI:96963][more]
Bmp13.580e-2230.96bone morphogenetic protein 1 [Source:MGI Symbol;Ac... [more]
Tll21.427e-2129.66tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Tll12.089e-2127.59tolloid-like [Source:MGI Symbol;Acc:MGI:106923][more]
back to top
BLAST of Ast8 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q20958|NAS29_CAEEL4.500e-2932.50Zinc metalloproteinase nas-29 OS=Caenorhabditis el... [more]
sp|Q9U3S9|NAS6_CAEEL8.919e-2733.64Zinc metalloproteinase nas-6 OS=Caenorhabditis ele... [more]
sp|Q19269|NAS14_CAEEL5.346e-2534.62Zinc metalloproteinase nas-14 OS=Caenorhabditis el... [more]
sp|Q20191|NAS13_CAEEL6.749e-2533.64Zinc metalloproteinase nas-13 OS=Caenorhabditis el... [more]
sp|P42674|BP10_PARLI7.635e-2529.50Blastula protease 10 OS=Paracentrotus lividus OX=7... [more]
back to top
BLAST of Ast8 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A060Q6V20.000e+099.69Metalloendopeptidase OS=Schmidtea mediterranea OX=... [more]
A0A481SPQ13.003e-5641.37Metalloendopeptidase OS=Colubraria reticulata OX=6... [more]
A0A1S3H5F61.240e-5340.21Metalloendopeptidase OS=Lingula unguis OX=7574 GN=... [more]
A0A0R3ST613.020e-5339.19Metalloendopeptidase OS=Hymenolepis diminuta OX=62... [more]
A0A0R3TZ581.008e-5039.78Metalloendopeptidase OS=Rodentolepis nana OX=10228... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033223.18.295e-2734.57high choriolytic enzyme 1-like [Source:NCBI gene;A... [more]
ENSAMXT00000056363.18.295e-2734.57high choriolytic enzyme 1-like [Source:NCBI gene;A... [more]
ENSAMXT00000044782.18.295e-2734.57high choriolytic enzyme 1-like [Source:NCBI gene;A... [more]
ENSAMXT00000031294.12.047e-2634.57high choriolytic enzyme 1-like [Source:NCBI gene;A... [more]
ENSAMXT00000035014.11.518e-2534.04high choriolytic enzyme 1-like [Source:NCBI gene;A... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007253.14.991e-2230.46pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1... [more]
ENSPMAT00000004913.13.882e-1446.15pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 g... [more]
ENSPMAT00000001798.15.173e-1123.79pep scaffold:Pmarinus_7.0:GL485204:1983:11197:1 ge... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ast8 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO431321.924e-3531.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424212.243e-3136.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377704.639e-3033.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414206.963e-3032.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475919.165e-2935.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ast8 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042892.11.556e-2533.33pep primary_assembly:ASM223467v1:16:21889441:21899... [more]
ENSORLT00000031948.11.723e-2533.33pep primary_assembly:ASM223467v1:16:21892110:21899... [more]
tll14.999e-2431.31tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
tll17.525e-2431.31tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
hce3.261e-2333.33Oryzias latipes protease (hce), mRNA. [Source:RefS... [more]
back to top
BLAST of Ast8 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073667.10.000e+099.69SMESG000073667.1[more]
SMESG000074521.13.550e-5038.55SMESG000074521.1[more]
SMESG000074510.11.350e-4937.09SMESG000074510.1[more]
SMESG000013804.18.469e-3534.07SMESG000013804.1[more]
SMESG000005882.12.386e-2430.00SMESG000005882.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030027
GenBankCCW36846.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030027 ID=SMED30030027|Name=Ast8 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1031bp
CCCCAGAGCCCCGCCAAATAATAAGAAAATATGAAGATATTTGTATTTCT
GGTTATATATTTTATTCAAGACTTACTGAATGCCAAAGAATTTCATCCCA
ATGACTTCGAATCTTCAAATGATATTCCCTTGAAATTTTCAACTTTTATG
GCTGAACGTGATGAGAATAAAAGATGGGAAAATGCAACAATTGTTTATCA
AATTGTATTGACTGATTTCAGAAAAGACGAAATTGATGGATTATTAAATG
CTATGGATATCTATCAAAAAGAAACTTGCCTAAAGTTCAGACCTGCAAAG
TTTTCTGACCAATATTCGGTGATTATTCGACGGGGCTCTGGAGGATGCAA
TGCTATATTGGGACAAGACCGAAAAAAAGGTACGCAAACTGTAAATCTTG
GAATTGGTTGTAGATGGTATGGTTTGTTTCTTCATGAATTAGGACACACA
ATTGGATTACATCATGAACATCAACATCCTGATAGGGATATTGGGGTCTC
AGTTCAATGGGACAACGTTGACCCATCAATGAAGGTGTGGTTTAATACAA
TAAGCAGAGACGATGTTAGTATGTTCGGAGTTCCATATGACATGCAATCA
GTAATGCACTATGGACAATGGGCCTTTGCTAAAACAGATGCTAATGGAAA
ATCTCTTACTACAATTATTGCAAAAAATCCAGAATTTCAAAGATATTTGT
ATTATGTGTGGATGAAAGATTTATCTTTTGGAGATGTTAAGCGAATTAAT
TTAATGTACAAATGCAATGATCACTGTCCAAAAAATATACCATGTTCAGA
AAGAGATGGATTTATAACCAAAGATTGCAAATGTGAGACAAAGCAAAATT
TCGCAAATAGAAGATGTTATGACATTTTCAATTCTTCCGAGTGTCAGCGT
TTAAAAGCCGATTGCGACAAAACGGGCACATATGAGCAATACTATGTTTT
CACAAACTGTCGAAAAACTTGTAGAAAATGTTATGAAGCAATTTAATTTA
ATTGAATAAATTAATTGAATTTAAAAAAAAA
back to top

protein sequence of SMED30030027-orf-1

>SMED30030027-orf-1 ID=SMED30030027-orf-1|Name=SMED30030027-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MKIFVFLVIYFIQDLLNAKEFHPNDFESSNDIPLKFSTFMAERDENKRWE
NATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIR
RGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHP
DRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFA
KTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCP
KNIPCSERDGFITKDCKCETKQNFANRRCYDIFNSSECQRLKADCDKTGT
YEQYYVFTNCRKTCRKCYEAI*
back to top
Aliases
The feature 'Ast8 protein' has the following synonyms
Synonym
Ast8
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002075pigment cell
PLANA:0003108gastrodermal cell
Vocabulary: INTERPRO
TermDefinition
IPR034035Astacin-like_dom
IPR001506Peptidase_M12A
IPR006026Peptidase_Metallo
IPR024079MetalloPept_cat_dom_sf
IPR003582ShKT_dom
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008270zinc ion binding
GO:0008237metallopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001506Peptidase M12APRINTSPR00480ASTACINcoord: 185..200
score: 49.9
coord: 146..163
score: 39.54
coord: 71..89
score: 31.49
coord: 127..145
score: 43.16
coord: 231..244
score: 42.38
IPR001506Peptidase M12APFAMPF01400Astacincoord: 47..246
e-value: 1.1E-45
score: 155.6
IPR006026Peptidase, metallopeptidaseSMARTSM00235col_5coord: 45..190
e-value: 5.3E-17
score: 72.5
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 16..248
e-value: 1.3E-57
score: 196.9
NoneNo IPR availablePANTHERPTHR10127DISCOIDIN, CUB, EGF, LAMININ , AND ZINC METALLOPROTEASE DOMAIN CONTAININGcoord: 28..299
NoneNo IPR availablePROSITEPS51864ASTACINcoord: 40..246
score: 50.342
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.649
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 45..246
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 279..317
score: 8.307
IPR034035Astacin-like metallopeptidase domainCDDcd04280ZnMc_astacin_likecoord: 51..243
e-value: 1.98069E-54
score: 173.911