SMED30030020

Overview
NameSMED30030020
Smed IDSMED30030020
Length (bp)3609
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30030020 (SMED30030020) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30030020 (SMED30030020) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030020 (SMED30030020) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030020 (SMED30030020) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030020

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30030020h1SMcG0014146 dd_Smed_v4_8896_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30030020 vs. Ensembl Human
Match: PGBD4 (piggyBac transposable element derived 4 [Source:HGNC Symbol;Acc:HGNC:19401])

HSP 1 Score: 78.9518 bits (193), Expect = 3.320e-14
Identity = 72/244 (29.51%), Postives = 109/244 (44.67%), Query Frame = -2
Query:  441 YKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLS-----KDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAK---AKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKN-----KKLVPETVTYYNSTKYGVDVLDQIARKY-SVKPSSLRWPLQVFYNILDLAAINAWILYKE 1130
            Y P  NI +DE L   K      QY+P K  +FG+K ++  + +S Y+ N   +       KD   G     S  +V  L    LG        NF  S  L ++L   +T  VGT R NRK++P   K   AK   + +F  +L   + C          K+V++LST H +  IE N     K   P  +  YN     VD  DQ+   Y S +     W  + F+++L +  +N++IL+K+
Sbjct:  241 YTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLK---SSRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCD--------GKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKK 473          
BLAST of SMED30030020 vs. Ensembl Human
Match: PGBD1 (piggyBac transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:19398])

HSP 1 Score: 54.299 bits (129), Expect = 1.380e-6
Identity = 61/232 (26.29%), Postives = 99/232 (42.67%), Query Frame = -2
Query:  444 QYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSK---------DET*GSNIPL--SEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKE-LPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIE----------KNKKL----VPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1061
            Q++  KP + G K W  +  +  YLV   PY  +         D   G N+ +  ++ ++ +   PY  C       +FFTS+ L   L  K     GTIR NR E  P +      K+ + +      EN  + + +   +  +SL S     + IE           N+++     P  V  Y+  K GV  +DQI  KY V+  S +W   +   ++D+A  NAW L++
Sbjct:  557 QFLNGKPIRIGYKIWCGTTTQG-YLVWFEPYQEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLC-----FDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPLMNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNA---VGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHR 779          
BLAST of SMED30030020 vs. Ensembl Zebrafish
Match: CABZ01072083.2 (dual specificity phosphatase 26 [Source:NCBI gene;Acc:570815])

HSP 1 Score: 121.324 bits (303), Expect = 7.139e-28
Identity = 106/397 (26.70%), Postives = 180/397 (45.34%), Query Frame = -2
Query:  441 RSPIYTIFKDVSGPTAYAKWHIMLGSASSAYNLIIDEGMMAYIKSCTELEARQVLNNKE*SVTKSQLWAFVAILFAREAYEAKI*SAHICGLRSGVRLFRPDNV*R*IYRHT-SVHTF**EKRTQ*KTEDRQTCLDFQNMGKNSQA--------------------FYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKE 1568
            R P +       GPT++A  +       S + L   + +   +   + LE ++V       +  + L AF+ IL     Y +K     +  L  GV L RP      I+R T +++TF        K+  R  C   ++     ++                     Y PG N+T+D+ L P + RC F  YM  KP K+GI+ W   D +S Y  N   +  K     +    +  VV  +     G   N T    FTS +L ++LL +  T++GT R +  ELP    + K +     +K   ++  TL  Y  + NK V ++ST H++     +++  P+ +  YNST+ GVD  D++   Y+ +  +L WP+ +F+N+LD++A NA++L+ +
Sbjct:  101 RFPSHLFENMTPGPTSFACSNAQ--DIKSTFELFFPDEIKEMLMQISNLEGKRVYGAAWKDLDWTDLQAFIGILILIGVYRSK--HESVDSLWDGV-LGRP------IFRATMALYTF--------KSWSRVICFRKRDPEPGQKSGDKLAPILNVWDKWVERLPLMYNPGQNLTVDKCLVPFRGRCPFKIYMQCKPAKYGIQIWAVCDSKSSYAWNMQIHTGKPADGKAEEDQAMRVVLDMTSALEG--HNITCDQSFTSYALGEELLRRNITMIGTTRLSNPELPPALLSVKGRAINS-SKFAFTDTHTLVSYHPRKNKNVLVMSTLHRDDAENSDEQSKPQMILDYNSTRGGVDNFDKLTSTYTCQRKTLHWPMVIFFNMLDVSAYNAFVLWMD 475          
BLAST of SMED30030020 vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 104.76 bits (260), Expect = 1.916e-22
Identity = 83/263 (31.56%), Postives = 130/263 (49.43%), Query Frame = -2
Query:  417 FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHK----NITIEKNKK----------LVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEK 1163
            + N+    +AFY PG NI+IDE++  +KAR    QYM NKP K+G K ++ +D +  Y    F Y  K  +  + +   E V+  + E YLG        NF+TS  L + LL+K+    GTIR NR   PK+A  K  +     +  +  E+  L   + K  ++V + ST HK    +I   K+K            +P  V  YN    GVD+ D +   Y V   + +W    FY+ +D+A +NA+IL+++  +   E+
Sbjct:  343 YDNIRDACRAFYHPGQNISIDERMVASKARSGLKQYMKNKPTKWGYKLFVLADSQCGYTSEFFVYEGKRMSSPNGLSY-ESVMALIDEKYLGTGYKLYVDNFYTSPKLFRDLLSKRIYACGTIRPNRIGFPKMATNKLPQDAPRGSMRWIRED-DLLFVEWKDTREVLMCSTFHKAYGGDIVERKSKDNDGQWSTVHVPIPGAVLDYNRFMGGVDLSDALICYYKVLHKTRKWYRTFFYHFVDIAVVNAFILHQKLARAKKER 603          
BLAST of SMED30030020 vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 83.5741 bits (205), Expect = 7.386e-16
Identity = 76/252 (30.16%), Postives = 122/252 (48.41%), Query Frame = -2
Query:  441 QAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDE-T*GSNIPLSEFVVTKLAEP-YLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTK--LYRSENCTLTIYKSKPNKKVSLLSTKHKNI---TIEKN-----------KKLV-PETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKE 1139
            ++ ++P   I IDE++  TKA+    QYM  KP K+G+K ++ +D  + Y  +   Y  K   T    +P    VV+ L +P +LG   +    NF+TS  L + L A      GT + +RK    + + K++ +T    +  +       L   K    ++VS+ ST HK     T+ +N           K +  P  V  YN    GVD+ DQ+ + YSV   S RW   + Y+ +D+AA N++IL+KE
Sbjct:  258 KSMWQPRKQIAIDERMVATKAKIALKQYMKAKPIKWGVKLFVLADSSNGYTSDFTIYTGKSRFTSSQGLPYD--VVSNLIDPSFLGRGYHLYVDNFYTSPKLFRDLYASGFVACGTFKDSRKN---VRETKQNALTSRSPRGSIRWIRQNKLLFVKWMDTREVSVCSTIHKAFDGDTVTRNVHDKETGSWQIKNIASPRCVVDYNKYMGGVDLSDQLLQYYSVHKRSNRWYRTLLYHFIDIAATNSYILHKE 504          
BLAST of SMED30030020 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 80.4925 bits (197), Expect = 7.555e-15
Identity = 75/263 (28.52%), Postives = 125/263 (47.53%), Query Frame = -2
Query:  417 FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNIT---IEKNKKL-----------VPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEK 1163
            +Q++    +A + P  NI+IDE++  +KAR    QY+ ++P K+G K ++ +D    Y  + F Y  K +T        + V+  + E  LG        NF+TS +L + LL+KK    GTIR NR    +    + +       + +R +      +K K  + V + ST HK      I++N K            VP  V  YN    GVDV D +   Y+V   + +W    FY+ +D+A +NA+IL+++  +   +K
Sbjct:  276 YQDIRDACKASFHPHQNISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEGKVKTEQRKGISYDSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNRINHTETEAPRGN------IRWFREDGLLFVEWKDK--RDVLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKHMGGVDVSDALIGYYTVLHKTKKWYRSFFYHFVDIAVVNAFILHQQMAKSKNQK 529          
BLAST of SMED30030020 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 76.6406 bits (187), Expect = 1.205e-13
Identity = 74/263 (28.14%), Postives = 125/263 (47.53%), Query Frame = -2
Query:  417 FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNIT---IEKNKKL-----------VPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEK 1163
            +Q++    +A + P  NI+IDE++  +KAR    QY+ ++P K+G K ++ +D    Y  + F Y  K +T        + V+  + E  LG        NF+TS +L + LL+KK    GTIR NR    +    + +       + +R +      +K K  + V + ST HK      I++N K            VP  V  YN  K G DV + +   Y+V   + +W    FY+ +D+A +NA+IL+++  +   +K
Sbjct:  276 YQDIRDACKASFHPHQNISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEGKVKTEQRKGISYDSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNRINHTETEAPRGN------IRWFREDGLLFVEWKDK--RDVLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKYKGGEDVSNALIGYYTVFRQTKKWYRSFFYHFVDIAIVNAFILHQQMAKSKNQK 529          
BLAST of SMED30030020 vs. Ensembl Xenopus
Match: npffr2 (neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-GENE-994428])

HSP 1 Score: 234.187 bits (596), Expect = 7.975e-69
Identity = 125/238 (52.52%), Postives = 164/238 (68.91%), Query Frame = -2
Query:  435 KNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETT 1148
            KN    + PG ++TIDEQLFPTK RC FTQY+  KPDKFGIKFW+A D+ +KY+ N  PYL KD +      L+E VV  L EP+L   RN TT NFFTS+S   +LL  KTTL+GT+   R+ELP++AK    +   F T + RS + +LTIY  K N  V +L++ H+++TI  N+K  P T+T YN  K GVDVLDQ+AR YSV+ ++ RWP+ V+YN+LDLAA+NA+ILYK  T
Sbjct:   77 KNCAESFTPGEHMTIDEQLFPTKVRCPFTQYVATKPDKFGIKFWMARDLETKYVCNASPYLGKDPSRQKGERLAENVVMNLMEPFLDEGRNVTTDNFFTSLS--HRLLQHKTTLLGTVNKVRRELPQLAKDTAQREV-FSTSVLRSGSVSLTIYAPKKNLTVCVLNSMHQDVTIGDNRKRKPNTITDYNHMKCGVDVLDQMARMYSVRAATRRWPVAVYYNMLDLAAVNAYILYKACT 311          

HSP 2 Score: 49.2914 bits (116), Expect = 7.975e-69
Identity = 22/38 (57.89%), Postives = 30/38 (78.95%), Query Frame = -3
Query: 1154 QTMSRDKFIDILRFIRFDKKNERSERLKTDKLALISKI 1267
            +TM RD+FI I++ +RFD K+ R+ER+KTDK A IS I
Sbjct:   34 ETMPRDRFISIMQHLRFDDKDTRAERVKTDKFAAISDI 71          
BLAST of SMED30030020 vs. Ensembl Xenopus
Match: slc39a9 (solute carrier family 39 member 9 [Source:Xenbase;Acc:XB-GENE-943772])

HSP 1 Score: 76.2554 bits (186), Expect = 6.627e-14
Identity = 72/247 (29.15%), Postives = 110/247 (44.53%), Query Frame = -2
Query:  444 SQAF---YKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*G-----SNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNK------KLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1142
            SQ F   Y P  N+ +DE L   K R +F QY+P+K  ++GIKF+   +  + Y      Y  KD         +++  S  +V +L  P LG   +    NF+T I L + L +  T   GT+  NRK LP+    KK K  +      RS    L   K    K V +L+T H    I +++      K  P     Y+    GVD  DQI   Y+    +  W  +    ++ +A  N++++YK
Sbjct:   43 SQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTGIPLFRALNSLDTPACGTVHRNRKGLPRELLDKKLKRGEVHA--LRSNE--LLAIKYSDTKVVLMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYK 285          
BLAST of SMED30030020 vs. Ensembl Xenopus
Match: dnah8 (dynein, axonemal, heavy chain 8 [Source:Xenbase;Acc:XB-GENE-6032736])

HSP 1 Score: 75.8702 bits (185), Expect = 7.356e-14
Identity = 70/247 (28.34%), Postives = 111/247 (44.94%), Query Frame = -2
Query:  444 SQAF---YKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*G-----SNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNK------KLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1142
            SQ F   Y P  N+ +DE L   K R +F QY+P+K  ++GIKF+   +  + Y      Y  KD         +++  S  +V +L  P LG   +    NF+T I L + L +  T   GT+  NRK LP+    KK K  +    ++   +  L   K    K V +L+T H    I +++      K  P     Y+    GVD  DQI   Y+    +  W  +    ++ +A  N++++YK
Sbjct:   70 SQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTGIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGE----VHALRSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYK 312          
BLAST of SMED30030020 vs. Ensembl Xenopus
Match: ENSXETT00000022905.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:63138140:63139328:-1 gene:ENSXETG00000016674.1 transcript:ENSXETT00000022905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 1.049e-13
Identity = 72/247 (29.15%), Postives = 110/247 (44.53%), Query Frame = -2
Query:  444 SQAF---YKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*G-----SNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNK------KLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1142
            SQ F   Y P  N+ +DE L   K R +F QY+P+K  ++GIKF+   +  + Y      Y  KD         +++  S  +V +L  P LG   +    NF+T I L + L +  T   GT+  NRK LP+    KK K  +      RS    L   K    K V +L+T H    I +++      K  P     Y+    GVD  DQI   Y+    +  W  +    ++ +A  N++++YK
Sbjct:   70 SQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTGIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHA--LRSNE--LLAIKYSDTKVVLMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYK 312          
BLAST of SMED30030020 vs. Ensembl Xenopus
Match: ENSXETT00000019041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:47398238:47399566:-1 gene:ENSXETG00000007669.1 transcript:ENSXETT00000019041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 1.071e-13
Identity = 72/247 (29.15%), Postives = 111/247 (44.94%), Query Frame = -2
Query:  444 SQAF---YKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*G-----SNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNK------KLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1142
            SQ F   Y P  N+ +DE L   K R +F QY+P+K  ++G+KF+   +  + Y      Y  KD         +++  S  +V +L  P LG   +    NF+TSI L + L +  T   GT+  NRK LP+    KK K  +      RS    L   K    K V +L+T H    I +++      K  P     Y+    GVD  DQI   Y+    +  W  +    ++ +A  N++++YK
Sbjct:   43 SQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHA--LRSNE--LLAIKYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYK 285          
BLAST of SMED30030020 vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 1.594e-13
Identity = 72/244 (29.51%), Postives = 109/244 (44.67%), Query Frame = -2
Query:  441 YKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLS-----KDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAK---AKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKN-----KKLVPETVTYYNSTKYGVDVLDQIARKY-SVKPSSLRWPLQVFYNILDLAAINAWILYKE 1130
            Y P  NI +DE L   K      QY+P K  +FG+K ++  + +S Y+ N   +       KD   G     S  +V  L    LG        NF  S  L ++L   +T  VGT R NRK++P   K   AK   + +F  +L   + C          K+V++LST H +  IE N     K   P  +  YN     VD  DQ+   Y S +     W  + F+++L +  +N++IL+K+
Sbjct:  241 YTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLK---SSRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCD--------GKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKK 473          
BLAST of SMED30030020 vs. UniProt/SwissProt
Match: sp|Q96JS3|PGBD1_HUMAN (PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 6.629e-6
Identity = 61/232 (26.29%), Postives = 99/232 (42.67%), Query Frame = -2
Query:  444 QYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSK---------DET*GSNIPL--SEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKE-LPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIE----------KNKKL----VPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1061
            Q++  KP + G K W  +  +  YLV   PY  +         D   G N+ +  ++ ++ +   PY  C       +FFTS+ L   L  K     GTIR NR E  P +      K+ + +      EN  + + +   +  +SL S     + IE           N+++     P  V  Y+  K GV  +DQI  KY V+  S +W   +   ++D+A  NAW L++
Sbjct:  557 QFLNGKPIRIGYKIWCGTTTQG-YLVWFEPYQEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLC-----FDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPLMNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNA---VGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHR 779          
BLAST of SMED30030020 vs. TrEMBL
Match: H9IWL2 (HTH La-type RNA-binding domain-containing protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 2.282e-121
Identity = 249/466 (53.43%), Postives = 310/466 (66.52%), Query Frame = -2
Query:  414 SDSETDSEDKVFRYT------APSKKRGRVI---SDSETENDLVAIDTSSDKKISAEKVADGTLWETFNEGRNVGRSPIYTIFKDVSGPTAYAKWHIMLGSASSAYNLIIDEGMMAYIKSCTELEARQVLNNKE*SVTKSQLWAFVAILFAREAYEAK-I*SAHICGLRSGVRLFRPDNV*R*---IYRHTSVHTF**EKRTQ*KTEDRQTCLD--FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKK 1766
            SD E   ED + + +       P+K+  R +   S SE E      D S+      E  ADGT+W    EG  VGR PI++ FKDV GPTA+AK +IM G+ SSA+ L+ID  ++ +I+ CTELEA +VL  K  ++T+ +L AF+AIL+AR AYE   +   ++   + G   F      R    I R+         +R+Q    D+   +   +    +NSQ  +KPGA IT+DEQLFPTKARCRFTQYMPNKP KFGIKFWLASDV +KY+VNGFPYL KDET  ++ PLSEFVV KL EPY    R  TT NFFTSI LA KL +K T+L+GTIRAN++ELPKI K KKD + +F T LY+S  CTLT+YKSKPNKKV LLSTKHKNI I+K  K +PETV +YN TK+GVDV DQ+ARKY+VK    RWPLQVF+NILDLA IN+WILYK TT  NI +K
Sbjct:  383 SDEEVLDEDNINQSSDSDCENMPNKRTRRCMRFPSSSEDE------DGSNVPNQQTEIAADGTIWTRIEEGGVVGRLPIHSAFKDVHGPTAHAKRNIMKGNLSSAFLLLIDNHILEHIRICTELEASRVLG-KTWTITQEKLKAFLAILYARGAYEGNTLRLQYLWNKKWGPSFFSSTMSRRDFTDILRYIRFDKR--NQRSQRLQTDKFALVSPVWDKFIENSQNCFKPGAYITVDEQLFPTKARCRFTQYMPNKPHKFGIKFWLASDVETKYVVNGFPYLGKDETRNASTPLSEFVVMKLLEPYTMKGRTVTTDNFFTSIPLALKLRSKSTSLLGTIRANKRELPKICKLKKDSMARFSTLLYQSNGCTLTVYKSKPNKKVLLLSTKHKNIKIDKAAKKIPETVLFYNKTKFGVDVTDQMARKYTVKSGCRRWPLQVFFNILDLAGINSWILYKNTTGENISRK 839          

HSP 2 Score: 72.0182 bits (175), Expect = 1.587e-11
Identity = 29/46 (63.04%), Postives = 39/46 (84.78%), Query Frame = -3
Query: 1139 FFAQTMSRDKFIDILRFIRFDKKNERSERLKTDKLALISKIWEKIV 1276
            FF+ TMSR  F DILR+IRFDK+N+RS+RL+TDK AL+S +W+K +
Sbjct:  549 FFSSTMSRRDFTDILRYIRFDKRNQRSQRLQTDKFALVSPVWDKFI 594          

HSP 3 Score: 28.8758 bits (63), Expect = 1.587e-11
Identity = 9/18 (50.00%), Postives = 12/18 (66.67%), Query Frame = -1
Query: 1273 GKNLKCSYLWSAKWCPAF 1326
            G  L+  YLW+ KW P+F
Sbjct:  532 GNTLRLQYLWNKKWGPSF 549          
BLAST of SMED30030020 vs. TrEMBL
Match: A0A1A9US35 (DDE_Tnp_1_7 domain-containing protein OS=Glossina austeni OX=7395 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 5.436e-121
Identity = 232/446 (52.02%), Postives = 292/446 (65.47%), Query Frame = -2
Query:  435 DSETDSEDKVFRYTAPSKKRGRVISDSETENDLVAIDTSSDKKISAEKVADGTLWETFNEGRNVGRSPIYTIFKDVSGPTAYAKWHIMLGSASSAYNLIIDEGMM--AYIKSCTELEARQVLNNKE*SVTKSQLWAFVAILFAREAYEAK-I*SAHICGLRSGVRLFRPDNV*R*IYRHTSVHTF**EKRTQ*KTEDRQTCLDFQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETT 1763
            DS+TD E+ +       +KR R I  SE+EN+         K+I  E V DGT+W+   EG N G++ IY IFK+V GPT YAK +I+     SA++LIID  +M   +++  TE EA  VL  K  ++   +L+AF+ +L+AR AYEAK I  +++   + G   F                           T  R     +    +NSQ  YKPGA + IDEQLFPTKARCR +QYMPNKPDKF IKFWLASDV SKY+VNGFPYL KDE   S+IPL EFV +KLA+PY G  RN T  NFFTS S+A KLLAK+TTLVGTIR N++ELPK+A+  KD + +F T LY+SE+  LTIYK+KPNKKV +LS+ H ++ IE N   +PET+ +YNSTK+ VDV DQIARKYSVK    RWPLQVF+NILDLA INAWIL+KETT
Sbjct:   44 DSDTDEENIL--NIRRGQKRKRFIVSSESENE---------KEI--ETVMDGTVWKKIKEGSNSGKTLIYNIFKEVLGPTGYAKRNIIKSRVKSAFSLIIDHKIMYNEHVREFTESEAFGVLKTKW-NLFVVKLYAFIGLLYARGAYEAKNINLSYLWNTKWGPSFFST-------------------------TMSRNDFEVWYKFIENSQNCYKPGAYLAIDEQLFPTKARCRLSQYMPNKPDKFSIKFWLASDVSSKYIVNGFPYLGKDEGRESSIPLGEFVTSKLAQPYTGHGRNITVDNFFTSASVASKLLAKRTTLVGTIRRNKRELPKLARQAKDSMVRFSTILYKSEDFILTIYKAKPNKKVLILSSMHSSVQIETNDIRIPETIRFYNSTKFIVDVTDQIARKYSVKSKCQRWPLQVFFNILDLAGINAWILHKETT 450          
BLAST of SMED30030020 vs. TrEMBL
Match: A0A2R7VV36 (DDE_Tnp_1_7 domain-containing protein OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS002403 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 6.393e-92
Identity = 163/244 (66.80%), Postives = 191/244 (78.28%), Query Frame = -2
Query:  414 NSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKK 1145
            NSQ  YKP  NI+IDEQLFPTKARC+FTQYMP KP K GIKFWLA DV+SKY++NGFPYL KDE   ++ PL+EFVV KLAEPYL   RN TT NFFTSI LA+KL AK T+LVGTIRAN++ELPK AK KKDK+  + +  Y+S    LTIYKSK N KV LLSTKH  I ++ N K  P+T+TYYN TK+GVDV+DQ+ARKY+ K +S RW LQVF+NILDLAAINAWILYKE T   + +K
Sbjct:   12 NSQCCYKPHENISIDEQLFPTKARCKFTQYMPKKPQKLGIKFWLAVDVQSKYVINGFPYLGKDEM-RTSTPLAEFVVLKLAEPYLHQGRNITTDNFFTSIPLAEKLAAKSTSLVGTIRANKRELPKPAKIKKDKMKMYSSLHYKSGKSILTIYKSKRNLKVLLLSTKHTYIKLKDNNKHTPQTITYYNDTKFGVDVVDQMARKYTTKAASFRWTLQVFFNILDLAAINAWILYKECTGSKLSRK 254          
BLAST of SMED30030020 vs. TrEMBL
Match: A0A3B3SZ47 (DDE_Tnp_1_7 domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.964e-91
Identity = 191/420 (45.48%), Postives = 253/420 (60.24%), Query Frame = -2
Query:  414 EKVADGTLWETFNEGRNVGRSPIYTIFKDVSGPTAYAKWHIMLGSASSAYNLIIDEGMMAYIKSCTELEARQVLNNKE*SVTKSQLWAFVAILFAREAYEAKI*SAHICGLRS---GVRLFRPD---NV*R*IYRHTSVHTF**EKRTQ*KTEDRQTCLD----------FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKK 1625
            E   DGT+W     G N GR     +  +VSGPTA+AK +I    A SA+  +ID+ M+ +I+ CT  EA +V  +    +T  +L AF+A+++ R A   K     +    S   G   F+     N  + I R               K E R+T +           ++   +NS A YKPG +IT+DEQLFPTK RC F QY+ +KPDKFGIKFWLA+DV +KY++NG PYL KDET      L + VV K+ EPYLG  RN TT +FFTS+ LAK L AKKT+LVGTI  +R+ELP   K ++   + F T+  +SEN TLT+Y+ K  K V +LST H +++I   +K  PETVTYYN TK GVDVLDQ+ RKYSVK  + RWP+ VFYN+LDLAAINA IL+KE T   + ++
Sbjct:  107 ETAKDGTVWTIIETGENSGRRQSQNVMTEVSGPTAHAKRNIE--DALSAFLCLIDDVMLKHIRDCTVAEAHRVNEDSSWDITVDELKAFIALVYVRGAQGGK--GMDLVSFWSDDWGCAFFKETMSRNRFQEIMRFLRFD----------KKETRRTRIQDNKFALVSEIWERFVQNSIACYKPGVDITVDEQLFPTKTRCSFIQYIASKPDKFGIKFWLAADVGTKYMLNGAPYLGKDETRRPGQRLGDSVVLKMVEPYLGKGRNITTDSFFTSLKLAKALQAKKTSLVGTINKSRRELPPCVKVQR---SLFTTQALKSENATLTVYQCKARKNVCILSTVHTSVSITSGQKSKPETVTYYNRTKVGVDVLDQMVRKYSVKAPTRRWPVTVFYNMLDLAAINASILFKECTHEKVSRR 509          
BLAST of SMED30030020 vs. TrEMBL
Match: A0A2P2I8I0 (PiggyBac transposable element-derived protein 4-like (Fragment) OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.675e-87
Identity = 180/408 (44.12%), Postives = 250/408 (61.27%), Query Frame = -2
Query:  414 DGTLWETF-NEGRNVGRSPIYTIFKDVSGPTAYAKWHIMLGSASSAYNLIIDEGMMAYIKSCTELEARQVLNNKE*SVTKSQLWAFVAILFAREAYEAKI*SAHICGLRSGVRLFRPDNV*R*IYRHTSVHTF**EKRTQ*KTEDRQTCLDFQNMGK-------NSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKK 1613
            DGT WE    +    GR     I ++  GPT+  K  I+ G   SA++L+ID+ ++ +I+ CTE EAR  L  +   ++  +++A + I+FAR          H+     G   FR   + R  ++          + T+    DR     F  + +       N    Y+P  +I +DEQLFPTK RC F QY+ +KPDKFGIKFWLA DV+S YL+NGFPYL KD    ++ PLSE+VV +L EPY+G  RN TT NFFTS+ LA+KL AK T+LVGT+   R+E+P+  K  ++   ++ T + ++++ TLT+Y+ KP+K V LLST H  + I +  K +PETV+YYNSTKY VDV+DQ+AR YS K  S RWP+QVFYNILDLAAINA ILY+E T  NI ++
Sbjct:  100 DGTRWEVIEQDNSGAGRRGKQNILRESPGPTSLPKHQIVEGRVLSAFSLLIDDFIIKHIQKCTESEARTKLKCESWVISYEEIYAVIGIMFARGVLAKGQSVDHLWSKTWGPPFFRK-TMSRDRFKEIMKFLRFDIRSTR---SDRLKTDKFALVSQVWDRFIGNCIVSYRPNEDIAVDEQLFPTKTRCPFIQYIASKPDKFGIKFWLAVDVKSNYLLNGFPYLGKDVDRPTSQPLSEYVVLRLVEPYMGKGRNVTTDNFFTSVKLAEKLKAKNTSLVGTVNRARREIPQCVKQSRED--RYKTHILKNKDSTLTVYQGKPSKNVLLLSTVHSTVGIGEGTKQIPETVSYYNSTKYSVDVVDQMARLYSTKARSRRWPVQVFYNILDLAAINAAILYREVTGQNIARR 501          

HSP 2 Score: 61.6178 bits (148), Expect = 1.642e-7
Identity = 25/46 (54.35%), Postives = 40/46 (86.96%), Query Frame = -3
Query: 1139 FFAQTMSRDKFIDILRFIRFDKKNERSERLKTDKLALISKIWEKIV 1276
            FF +TMSRD+F +I++F+RFD ++ RS+RLKTDK AL+S++W++ +
Sbjct:  213 FFRKTMSRDRFKEIMKFLRFDIRSTRSDRLKTDKFALVSQVWDRFI 258          

HSP 3 Score: 25.7942 bits (55), Expect = 1.642e-7
Identity = 8/22 (36.36%), Postives = 10/22 (45.45%), Query Frame = -1
Query: 1273 RSI*GKNLKCSYLWSAKWCPAF 1338
            R +  K     +LWS  W P F
Sbjct:  192 RGVLAKGQSVDHLWSKTWGPPF 213          
BLAST of SMED30030020 vs. Ensembl Cavefish
Match: ENSAMXT00000039501.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:21564630:21575712:1 gene:ENSAMXG00000031759.1 transcript:ENSAMXT00000039501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.432 bits (620), Expect = 1.666e-68
Identity = 165/427 (38.64%), Postives = 245/427 (57.38%), Query Frame = -2
Query:  414 SAEKVADGTLWETFNEGRN-VGRSPI-YTIFKDVSGPTAYAKWHIMLGSASSAYNLIIDEGMMAYIKSCTELEARQVLNNKE*SVTKSQLWAFVAILFAREAYEAKI*------SAHICG-----------LRSGVRLFRPDNV*R*IYRHTSVHTF**EKRTQ*KTEDRQTCLD--FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKK 1631
            S+++  DGT+W   + G   VG   + + + ++  GPT YA   I   S  S+   +IDE M   I+  T+ E  +  +     +T ++L AFVA+ + R     K        S+ +              R  +R  R D+      RH +               D+   +   F    +NS A Y PG NIT+ EQLFPTKARCRF QY+ NK DKFG+KFW+A+D  +KY++N FPYL KDE   S   + + VVT+L EP+L   RN TT  FF S++LA  LL  KTT+VGTIR +++E P+  + + +    F TK+ R+ N TLTIY++KP + V +LST H+ ++++ +++ +P ++++Y +TK+ VDVLD++A  Y+VK  + RWP+ VFYNILDLAAINA ILYK  T+  I ++
Sbjct:  519 SSQEARDGTVWVEQSAGEPWVGAWNVEFGVLRETPGPTKYAMDKIT--SPLSSLMCLIDEEMWEMIQKHTQAEIDRS-DTDGFKLTAAELKAFVALTYMRGITGGKTMKLDDYWSSDLGNPIFLKTLTRQRFRDIMRHLRFDDKNTRAARHET---------------DKFAMISELFYKFVQNSIASYVPGENITVGEQLFPTKARCRFAQYVLNK-DKFGLKFWVAADADTKYVLNIFPYLGKDEGKLSGQRVKDSVVTRLVEPFLDKGRNITTSGFFPSLALASHLLVNKTTVVGTIRKSKQETPQCTQTQSE---IFNTKVLRTGNTTLTIYQAKPKENVCVLSTMHQTVSVDNSEQKLPNSISHYYNTKFTVDVLDRMAHLYTVKNGTRRWPVAVFYNILDLAAINAHILYKRCTKAKISRR 923          

HSP 2 Score: 38.1206 bits (87), Expect = 1.666e-68
Identity = 17/41 (41.46%), Postives = 23/41 (56.10%), Query Frame = -1
Query:  244 RKNCQVQQSCKRNRCTNHCAKCNRNICEKCVSKTEFICKKC 366
            RK CQ+ + C +N+  N C KC R +C KC   T  +C  C
Sbjct:  959 RKQCQIGK-CSKNKTFNMCEKCRRFVCGKCSKWTPKLCFDC 998          
BLAST of SMED30030020 vs. Ensembl Cavefish
Match: ENSAMXT00000014953.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001957.1:155693:158756:-1 gene:ENSAMXG00000014528.2 transcript:ENSAMXT00000014953.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 7.087e-23
Identity = 81/256 (31.64%), Postives = 122/256 (47.66%), Query Frame = -2
Query:  417 QAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPK-IAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKH--------------KNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEK 1139
            +A+Y+P  N++IDE++  TKAR R  QYM +KP K+G K ++ +D  S Y  +   Y  K      N    + VV+ L  P LG        NF+TS  L + L        GTIR  R   PK  A A   K  +   +  R  +  L   K +  + V++ ST H              KN T    +  VPE V  YN    GVD+ D + + YSV   + RW +++F + +D+A +N++I++KE      +K
Sbjct:  222 KAYYQPHQNLSIDERMVATKARIRMKQYMKDKPTKWGYKLFILADSCSGYTCDFSVYEGKARKPTGNGLSFDAVVSLLHVPSLGTGYTVYVDNFYTSSMLFRHLHRIGFGACGTIRETRIGFPKTTANALPKKADRGEMRWIR--DGPLLFVKWRVTRDVTMCSTVHKAYSGQSVQRRVRSKNGTWSTQQISVPEPVKAYNKFMGGVDLSDALIKYYSVTQKTRRWYVKLFLHFVDIAVVNSFIIHKERALARQQK 475          
BLAST of SMED30030020 vs. Ensembl Cavefish
Match: ENSAMXT00000030524.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:5821371:5823572:-1 gene:ENSAMXG00000031777.1 transcript:ENSAMXT00000030524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 1.388e-22
Identity = 84/260 (32.31%), Postives = 127/260 (48.85%), Query Frame = -2
Query:  441 QAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIP----LSEFVVTKLAEP-YLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKP--------NKKVSLLSTKHKNITIEKNKKLV--------------PETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKE 1139
            +AFY P   + +DE++  +KA+   TQYM +KP K+G K ++ +D R+ Y V+   Y  K     S+IP    LS  VV  L +P YLG   +    NF++S  L + L   K +  GT R NRK  P+             TK  RSE  ++   +  P         + VS+ ST H   + E  ++ V              P  V  YN    GVD+ DQ+ + YS +  ++RW  ++FY+ LD+A  N++IL+KE
Sbjct:  317 KAFYHPHKELAVDERMVASKAKTGMTQYMKSKPTKWGFKLFVLADSRNGYTVDFSVYTGK-----SDIPSGHGLSYDVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRENRKGCPQTD-------VNALTK--RSERGSIRWIRDGPIVYVKWMDTRAVSMCSTIHPAHSGETVQRRVKREDGSWTKTSVPCPTPVAEYNKHMGGVDLSDQLIQCYSAQHKTMRWYRKLFYHFLDIATTNSFILHKE 562          
BLAST of SMED30030020 vs. Ensembl Cavefish
Match: ENSAMXT00000025849.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20558813:20568326:-1 gene:ENSAMXG00000025123.2 transcript:ENSAMXT00000025849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 9.302e-22
Identity = 82/260 (31.54%), Postives = 126/260 (48.46%), Query Frame = -2
Query:  441 QAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIP----LSEFVVTKLAEP-YLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKP--------NKKVSLLSTKHKNITIEKNKKLV--------------PETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKE 1139
            ++FY P  N+ +DE++  +KA+   TQYM  KP K+G K ++ +D R+ Y V+   Y  K     S+IP    LS  VV  L +P YLG   +    NF++S  L + L   K +  GT R NRK  P+         T       RSE  ++   +  P         ++VS+ ST H   + E  +  +              P  V  YN    GVD+ DQ+ + YS +  ++RW  ++FY+ LD+A  N++IL+KE
Sbjct:  209 KSFYHPHKNLAVDERMVASKAKNVMTQYMKAKPIKWGFKLFVLADSRNGYTVDFSVYTGK-----SDIPSGHGLSYDVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRDNRKGCPQ---------TDVNALTKRSERGSIRWIRDGPIVYVKWMDTREVSVCSTIHPAHSGEIAQSRMKQDDGSWAKVSIPCPTPVKQYNQHMGGVDLSDQLIQYYSAQHKTMRWYRKMFYHFLDIATTNSFILHKE 454          
BLAST of SMED30030020 vs. Ensembl Cavefish
Match: ENSAMXT00000057483.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:107197084])

HSP 1 Score: 98.2117 bits (243), Expect = 1.925e-20
Identity = 78/256 (30.47%), Postives = 117/256 (45.70%), Query Frame = -2
Query:  417 QAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKI-AKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHK--------------NITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEK 1139
            +A+Y+P  N++IDE++  TKAR    QYM NKP K+G   ++ +D  S Y  N   Y  K           + VV+ L  P LG        NF+TS  L   L        GTIR  R   PK    A      +   +  R  + +L   K +  + V++ ST HK              N T    +  VPE V  YN    GVD+ D + + YSV   + RW +++F + +D+A +N++I++KE      +K
Sbjct:  285 RAYYQPHQNLSIDERMVATKARIGMKQYMKNKPTKWGYMLFVLADSSSGYTCNFSVYEGKARKPSGKGLSFDAVVSLLHVPSLGTGYTVYVDNFYTSSLLFHHLHRIGFGACGTIRETRIGFPKTTVNALPKDANRGDMRWIR--DGSLLFVKWRDTRDVTVCSTVHKAYSGQSVQRRIRIKNGTWSTQQIPVPEPVKAYNKFMGGVDLSDALIKYYSVTQKTRRWYVKLFLHFVDIAVVNSFIIHKEMALARKQK 538          
BLAST of SMED30030020 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 7.375e-16
Identity = 65/249 (26.10%), Postives = 113/249 (45.38%), Query Frame = -2
Query:  432 NSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEF---VVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXX-LVGTIRANRKELPKIAKAKKDKITQ-----FFTKLYRSENCTLTIYKSKPNKKVSLLSTKH--KNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQ 1145
            N    Y P   +++DE + P K R  F Q+MP KP K+G+K W   + ++ Y +N   Y  +     +    +     VV  L   Y     +     +F+S +L + L ++  T   GT+  +R+ LP  A+     +       FF K        L++++ K  + V+ LST    + +       + P  V +YN    GVD  DQ    Y+V  +S +W   + + +L+L+ +N W+LY+E+  
Sbjct:   90 NFSRHYSPRRELSVDEGMIPFKGRLFFKQHMPAKPTKWGVKVWELCEAQTGYCLNFDIYTGRSAYGAATTAAAALGYRVVMSLTRSYWHRNHHLYFDRYFSSPALLEDLRSRCGTYACGTVSLSRRGLPPPAREVASLLRHRGDFAFFQK----GGLVLSVWRDK--RVVATLSTNQDPRMVRPVDEGPIKPAPVVHYNRFMGGVDRSDQYRSYYAVGRASKKWWRYIVWFLLNLSIVNGWLLYRESPH 332          
BLAST of SMED30030020 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.531e-11
Identity = 69/273 (25.27%), Postives = 120/273 (43.96%), Query Frame = -2
Query:  366 QAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANR---KELPKIAKAK--KDKI------TQFFTKLYRSENCTL--TIYKSKPNKKVSLLSTKHKNIT--IEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKKSRTLPFQ*QKFMLLTH 1139
            +A Y P   +++DE     K R  F  Y P KP+K+GIKF++ ++ ++ Y+ N   Y+  +++  +       +V  L  P L         N++ S+ L ++L        GT+R +R   K+L  +AK K  +D I        F      +   TL   I+ +  +  V    T+ ++ T  + + +   P  +  Y     GV   DQ+ + Y     + +W  ++    L +A  NA++LYK+ +    EKK   L F    F  L H
Sbjct:  143 KALYAPNRELSLDEATLEWKGRLPFKVYNPQKPEKYGIKFYILAEAQTGYVFNFDIYVGIEKSIRN-------IVFGLMGPLLDKGYQLYMDNYYNSVKLTEELYEHGVHTCGTLRLSRGAPKDLQALAKMKIPRDSIHFRRKGNTFVICWMNTRLVTLITNIHNADTHNFVRQQKTRKRDGTALLSRIELQRPNAIADYMDHMRGVVHFDQMIQYYHFTRKTHKWTKKIVLYFLQMALHNAYVLYKKYS--TDEKKLTLLAFHEVLFNALIH 406          
BLAST of SMED30030020 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001816.1 (pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-1 gene:ENSPMAG00000001650.1 transcript:ENSPMAT00000001816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 4.598e-6
Identity = 53/258 (20.54%), Postives = 103/258 (39.92%), Query Frame = -2
Query:  444 MGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYL-------------VNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKK--------DKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1154
            +G  S+ F  P  ++ +DE L   K R      +P  P + G+K ++ S   + Y+             V G  +  ++++     PL      +L E   G   +   G  F S  L    L + T   G +R N +  PK  +  +         +  Q    ++++    + I  S    +   +  +  N  +E ++K  P  +  YN     VD+  Q+   + +     +W   +F+ +L+ A +N++ILY+
Sbjct:  153 LGAFSRHFV-PFRDMRLDEVLSKFKDRHDALPCVPANPIRCGVKVFICSCASTGYVHSLLVHAGGHDIVVAGGLWRRRNKS----FPLGYRAAMRLTERLHGVHHHVYFGKLFGSARLLSDFLQRGTYGCGLVRPNSRGFPKELRDSRLQPGDTKFRQSGQLVACIHKANTENMAIIASNSRPESERMQRRFHNYDVEGSQK--PHPLLNYNMCMGKVDIASQLQTWFELGREGRKWWKYMFFFLLNTAVVNSYILYR 403          
BLAST of SMED30030020 vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 167.548 bits (423), Expect = 4.942e-43
Identity = 133/434 (30.65%), Postives = 213/434 (49.08%), Query Frame = -2
Query:  432 AIDTSSDKKISAEKVA---------DGTLWETFNEGRNVGRSPIYTIFKDVSGPTAYAKWHIMLGSASSAYNLIIDEGMMAYIKSCTELEARQVLNNKE*SVTKSQLWAFVAILFAREAYEAKI*SAHICGLRSGVRLFRPDNV*R*IYRHT-SVHTF**EKRTQ*KTEDRQTCLDFQNMGKNSQA-------------FYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYR-SENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQ 1661
            A+ + SD+ +  E+ +         DG +  + +  ++ GR     I K   GPT +A   +      SA+ L I + +   I   T LE R+V   K  S+ ++ L A++ IL     Y +K          +   L+  +N  R I+R T S+ TF    R   + ++R T +  +   K +                Y PG ++T+DE+L P + RC F QYMPNKP K+GIK W A D +S Y      Y  K             VV +++E   G   N T  NFFTS  L ++L  +K T++GT+R N+ ELP  ++  K +     + ++  +E  T+  Y  K NK V ++ST H + ++     + P+ +  YNSTK GVD LD++   YS +  + RWP+ +F+NI+D++A NA++L+ E  Q
Sbjct:   57 AVVSPSDENLGMEQSSSTEGTWASKDGNIKWSTSPHQSRGRLSSSNIIKMTPGPTRFAVTRV--DDIQSAFQLFISQPIERIILDMTNLEGRRVFQEKWKSLDQTDLNAYIGILILAGVYRSK--------GEATSSLWNEENG-RPIFRATMSLETFHMISRVI-RFDNRDTRVGRRESDKLAAIRDVWDKWVEILPLLYNPGPHVTVDERLVPFRGRCPFRQYMPNKPAKYGIKIWAACDAKSSYAWKMQVYTGKSPGGAPEKNQGMRVVLEMSEGLQG--HNITCDNFFTSYRLGEELQKRKLTMLGTVRRNKPELP--SEILKIQGRPMHSSIFAFTEKATVVSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQ 474          
BLAST of SMED30030020 vs. Ensembl Medaka
Match: ENSORLT00000027888.1 (pep primary_assembly:ASM223467v1:17:9217998:9219211:-1 gene:ENSORLG00000025878.1 transcript:ENSORLT00000027888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 1.513e-40
Identity = 88/239 (36.82%), Postives = 129/239 (53.97%), Query Frame = -2
Query:  432 FYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPK-----IAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQ 1133
             Y PG ++T+DE+L P + RC F QYMPNKP K+GIK W A D +S Y      Y  K             VV +++E   G   N T  NFFTS  L ++L  +K  ++GT+R N+ ELP        +     I  F      +E  T+  Y  K NK V ++ST H + ++     + P+ +  YNSTK GVD LD++   YS +  + RWP+ +F+NI+D++A NA++L+ E  Q
Sbjct:   47 LYNPGPHVTVDERLVPFRGRCPFQQYMPNKPAKYGIKIWAACDAKSNYAWKMQVYTGKLPGGAPEKNQGMRVVLEMSEGLQG--HNITCDNFFTSYRLGEELQKRKLIMLGTVRRNKPELPSEILNIQGRPMHSSIFAF------TEKATVVSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQ 277          

HSP 2 Score: 36.965 bits (84), Expect = 1.513e-40
Identity = 19/45 (42.22%), Postives = 27/45 (60.00%), Query Frame = -3
Query: 1127 MSRDKFIDILRFIRFDKKNERSERLKTDKLALISKIWEKIVRLFT 1261
            MS + F  I R IRFD ++ R  R ++DKLA I  +W+K V +  
Sbjct:    1 MSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDLWDKWVEILP 45          
BLAST of SMED30030020 vs. Ensembl Medaka
Match: ENSORLT00000029842.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101157644])

HSP 1 Score: 149.443 bits (376), Expect = 4.502e-40
Identity = 90/234 (38.46%), Postives = 138/234 (58.97%), Query Frame = -2
Query:  441 FYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKEL-PKIAKAKKDKITQFFTKLYRSENCTLTI-YKSKPNKKVSLLSTKHKNITI-EKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKE 1133
             Y  G  +T+DE++ P K RC F QY+P+KP K+G+K W+A D R+ Y     PY+ K  +      L+  VV+ L        RN T  NFFTS +LA +LL +  TL+GTI++N+ EL P++A A+     +  +  +   +C   + Y  K NK V LLSTKH  + I  + +   PE +  YN TK GVD LD++   YS +  + RWPL +F+N++D++A NA+++++E
Sbjct:  495 LYDIGPEVTVDERMVPFKGRCSFRQYIPSKPTKYGLKLWVACDARTSYAWRVQPYMGKLASGARETNLASRVVSDLTRGLEH--RNVTCDNFFTSYALATELLKRNITLLGTIKSNKPELPPELASARG---REALSSRFAFTDCAAALSYVPKKNKNVLLLSTKHSRVEICHERRDKKPEMILDYNKTKGGVDNLDKLLATYSCRRMTKRWPLAMFHNMIDMSAYNAYVIWRE 723          

HSP 2 Score: 36.965 bits (84), Expect = 4.502e-40
Identity = 21/71 (29.58%), Postives = 36/71 (50.70%), Query Frame = -3
Query: 1130 RQKFEVLIFV-VCEVVSGFFAQTMSRDKFIDILRFIRFDKKNERSERLKTDKLALISKIWE----KIVRLF 1327
            R + E L+ +   E     F  TMS   F      +RFD ++ R+ R  +D+LA + ++WE    ++ RL+
Sbjct:  426 RSRGEALVSLWEPECGRPIFGATMSLRSFYQRSATLRFDDRSTRASRSASDRLAAVREVWEEWCDRLPRLY 496          
BLAST of SMED30030020 vs. Ensembl Medaka
Match: ENSORLT00000038522.1 (pep primary_assembly:ASM223467v1:10:9345195:9347118:-1 gene:ENSORLG00000027882.1 transcript:ENSORLT00000038522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 9.043e-16
Identity = 78/266 (29.32%), Postives = 123/266 (46.24%), Query Frame = -2
Query:  393 GANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIP---LSEFVVTKLAEPYLGC*RNTTT-GNFFTSISXXXXXXXXXXXLVGTIRANRKELPKI-----AKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLST---KHKNITIE----KNKKLV----PETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKE---TTQVNIEKKSRTLPFQ 1121
            G  + +DEQ+ P K R R  QY+P KP K+G K  + +   S  + + F   +        +P    S  VV +LA+P     ++     N+FTS+ L   L  +     GT+R+NR  LP +     A+ K+     F  K       TL   K   N+ VSLLS     H    ++    K KK++    P  V  YN    GVD+LD +   Y  K  S +W  ++ ++ +D+  + AW+LYK    +T ++ E++ R   F+
Sbjct:  225 GEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAG--SDGVPHNFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNR--LPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIALYRTKIRSNKWYHRLMFHFIDMTTVTAWLLYKRDCSSTGMSKEEQIRLYTFK 486          
BLAST of SMED30030020 vs. Ensembl Medaka
Match: ENSORLT00000047092.1 (piggyBac transposable element-derived protein 2-like [Source:NCBI gene;Acc:111948922])

HSP 1 Score: 82.4185 bits (202), Expect = 1.135e-15
Identity = 78/266 (29.32%), Postives = 125/266 (46.99%), Query Frame = -2
Query:  393 GANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWL--ASD-VRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTT-GNFFTSISXXXXXXXXXXXLVGTIRANRKELPKI-----AKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLST---KHKNITIE----KNKKLV----PETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKE---TTQVNIEKKSRTLPFQ 1121
            G  + +DEQ+ P K R R  QY+P KP K+G K  +   SD V+  + +     +   E    ++  S  VV +LA+P     ++     N++TS+ L   L  +     GT+R+NR  LP +     A+ K+     F  K       TL   K   N+ VSLLS     H    ++    K KK++    P  V  YN    GVD+LD +   Y  K  S +W  ++ ++ +D+  + AW+LYK    +T ++ E++ R   F+
Sbjct:  225 GEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAGSDGVQHNFEIYTGRVVQPPEL--PDVGASGNVVLRLAQPIPKHQKHKLFFDNWYTSVPLILTLAQQGIHCAGTVRSNR--LPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIALYRTKIRSKKWYHRLMFHFIDMTTVTAWLLYKRDCSSTGMSKEEQIRLYTFK 486          
BLAST of SMED30030020 vs. Planmine SMEST
Match: SMESG000031831.1 (SMESG000031831.1)

HSP 1 Score: 172.555 bits (436), Expect = 3.722e-45
Identity = 89/132 (67.42%), Postives = 107/132 (81.06%), Query Frame = -2
Query:  411 VGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKKS 806
            +GTIR N++ LPKIAK K D + ++ TKLY+SEN  LTIYK+K  KKV LLS++HK++ IE N+KLVPETV +YN TK GV VLDQ+ARKYSVK  S RWPL+VFYNILDL AINAWILYKE T VNI +K+
Sbjct:   98 LGTIRGNKRNLPKIAKTKNDNMIRYSTKLYKSENYILTIYKTKTKKKVLLLSSRHKSVKIENNEKLVPETVAFYNKTKCGVYVLDQMARKYSVKTGSRRWPLKVFYNILDLEAINAWILYKEVTGVNISRKN 229          
BLAST of SMED30030020 vs. Planmine SMEST
Match: SMESG000035129.1 (SMESG000035129.1)

HSP 1 Score: 158.303 bits (399), Expect = 4.328e-42
Identity = 74/115 (64.35%), Postives = 92/115 (80.00%), Query Frame = -2
Query:  414 AKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKK 758
               D + +F T LY+S  CTLT+YKSKPNKKV LLST+HK+I I+K  K +PETV++YN+TK+GVDV DQ+A KY+VK  S RWPLQVF+NILDLAAIN+W+LYK TT  NI +K
Sbjct:  151 GSADSMARFSTMLYQSNGCTLTVYKSKPNKKVLLLSTRHKHIKIDKAAKKLPETVSFYNNTKFGVDVTDQMALKYTVKSGSRRWPLQVFFNILDLAAINSWVLYKNTTGENILRK 265          
BLAST of SMED30030020 vs. Planmine SMEST
Match: SMESG000018066.1 (SMESG000018066.1)

HSP 1 Score: 105.531 bits (262), Expect = 1.313e-41
Identity = 48/52 (92.31%), Postives = 49/52 (94.23%), Query Frame = -1
Query:  277 SKYREEVENTSIPMTEIHATDARKNCQVQQSCKRNRCTNHCAKCNRNICEKC 432
            SKYREE ENTSIPMTEIHATDARKNCQVQQSCKRNRCTNHCAKCNRN+C K 
Sbjct:   57 SKYREEFENTSIPMTEIHATDARKNCQVQQSCKRNRCTNHCAKCNRNVCGKM 108          

HSP 2 Score: 81.6481 bits (200), Expect = 1.313e-41
Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -2
Query:  414 IARKYSVKPSSLRWPLQVFYNILDLAAINAWILYKETTQVNIEKK 548
            + RKY+ K SS RWPLQVFYNILDLAAINAWILYKETTQVNI +K
Sbjct:    1 MTRKYNAKASSRRWPLQVFYNILDLAAINAWILYKETTQVNISRK 45          

HSP 3 Score: 24.2534 bits (51), Expect = 1.313e-41
Identity = 11/22 (50.00%), Postives = 16/22 (72.73%), Query Frame = -3
Query:  218 KMCFQNRVYM*KMFFMNFLIIK 283
            KMCF+NRVY  K+  +N+ I +
Sbjct:  107 KMCFKNRVY--KVVTVNWTITE 126          
BLAST of SMED30030020 vs. Planmine SMEST
Match: SMESG000081807.1 (SMESG000081807.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.595e-29
Identity = 81/241 (33.61%), Postives = 124/241 (51.45%), Query Frame = -2
Query:  450 FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPK--IAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKH-KNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWIL 1163
            F +   N Q  Y P   + +DE     +  C F  Y+P+KPD++GIK W   D  + Y+ N   YL K             VV +L  P     RN TT NFFTS  L + LL++  TL+GT+R +R E+P   ++K+++    +F +K   +++  L  Y    N+ V LLST H + +  +  +   P  V  YN TK  VD  DQ    YS    + +WP+++FY I+D + +NA++L
Sbjct:  110 FDHFVDNRQELYTPSPYLCVDETQVEFRGGCPFRVYIPSKPDRYGIKVWSLCDNGTHYVTNLQVYLGKKGQ-SPKHQQGTRVVKQLMLPLYNSGRNVTTDNFFTSYDLGQFLLSQNITLLGTMRKSRTEIPPEFLSKSRE----EFESKFAFTKDTALVSYAPPKNRTVVLLSTMHNRPVVFDDGRGRKPYMVLDYNMTKGAVDAFDQEVSFYSFAHKTRQWPMRLFYFIIDASCLNAFVL 345          

HSP 2 Score: 31.187 bits (69), Expect = 2.595e-29
Identity = 16/42 (38.10%), Postives = 25/42 (59.52%), Query Frame = -3
Query: 1139 TMSRDKFIDILRFIRFDKKNERSERLKTDKLALISKIWEKIV 1264
            T+  ++F   L   RFD K  R++R KTDK A I ++++  V
Sbjct:   73 TIPLNRFRIFLSSARFDDKTTRNDRQKTDKFAAIRELFDHFV 114          
BLAST of SMED30030020 vs. Planmine SMEST
Match: SMESG000070813.1 (SMESG000070813.1)

HSP 1 Score: 117.087 bits (292), Expect = 9.014e-28
Identity = 82/240 (34.17%), Postives = 122/240 (50.83%), Query Frame = -2
Query:  444 FQNMGKNSQAFYKPGANITIDEQLFPTKARCRFTQYMPNKPDKFGIKFWLASDVRSKYLVNGFPYLSKDET*GSNIPLSEFVVTKLAEPYLGC*RNTTTGNFFTSISXXXXXXXXXXXLVGTIRANRKELPKIAKAKKDKITQFFTKLYRSENCTLTIYKSKPNKKVSLLSTKHKNITIEKNKKLVPETVTYYNSTKYGVDVLDQIARKYSVKPSSLRWPLQVFYNILDLAAINAWILYK 1163
            F    +N Q  Y P + ITIDE L   + RC F  YM +KP ++GIK W+ +DV + Y+ N                          + Y G   + TT NFFTS+ LA KLL  K  L GT+R N++E+P   + +  + ++  +    + N TL  Y  K  K V+LL TK  N  I K +   P  + YYN TK  VD  D +  +YS+   + RW  ++F  ++D+AA NA++++K
Sbjct:   85 FDQFVENCQNAYIPKSVITIDECLATYRGRCPFRVYMKSKPGRYGIKIWIDADVETSYICN-------------------------LQVYTGF--SVTTDNFFTSVPLALKLLNNKIYLTGTLRTNKREIP--VQFQVSRRSELSSNFGYNINLTLVSYIPKKGKAVNLLITKFHNNEICKEENNKPRIILYYNKTKGAVDSGDMMTFEYSIVRVTRRWAFRLFMELIDIAAFNAYVVWK 295          
The following BLAST results are available for this feature:
BLAST of SMED30030020 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PGBD43.320e-1429.51piggyBac transposable element derived 4 [Source:HG... [more]
PGBD11.380e-626.29piggyBac transposable element derived 1 [Source:HG... [more]
back to top
BLAST of SMED30030020 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030020 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030020 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01072083.27.139e-2826.70dual specificity phosphatase 26 [Source:NCBI gene;... [more]
CABZ01069162.11.916e-2231.56pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
si:dkey-19f4.27.386e-1630.16si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
pgbd47.555e-1528.52piggyBac transposable element derived 4 [Source:ZF... [more]
pgbd41.205e-1328.14piggyBac transposable element derived 4 [Source:ZF... [more]
back to top
BLAST of SMED30030020 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr27.975e-6952.52neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-... [more]
slc39a96.627e-1429.15solute carrier family 39 member 9 [Source:Xenbase;... [more]
dnah87.356e-1428.34dynein, axonemal, heavy chain 8 [Source:Xenbase;Ac... [more]
ENSXETT00000022905.11.049e-1329.15pep primary_assembly:Xenopus_tropicalis_v9.1:4:631... [more]
ENSXETT00000019041.11.071e-1329.15pep primary_assembly:Xenopus_tropicalis_v9.1:7:473... [more]
back to top
BLAST of SMED30030020 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030020 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q96DM1|PGBD4_HUMAN1.594e-1329.51PiggyBac transposable element-derived protein 4 OS... [more]
sp|Q96JS3|PGBD1_HUMAN6.629e-626.29PiggyBac transposable element-derived protein 1 OS... [more]
back to top
BLAST of SMED30030020 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9IWL22.282e-12153.43HTH La-type RNA-binding domain-containing protein ... [more]
A0A1A9US355.436e-12152.02DDE_Tnp_1_7 domain-containing protein OS=Glossina ... [more]
A0A2R7VV366.393e-9266.80DDE_Tnp_1_7 domain-containing protein OS=Oncopeltu... [more]
A0A3B3SZ473.964e-9145.48DDE_Tnp_1_7 domain-containing protein OS=Paramormy... [more]
A0A2P2I8I01.675e-8744.12PiggyBac transposable element-derived protein 4-li... [more]
back to top
BLAST of SMED30030020 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039501.11.666e-6838.64pep primary_assembly:Astyanax_mexicanus-2.0:19:215... [more]
ENSAMXT00000014953.27.087e-2331.64pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030524.11.388e-2232.31pep primary_assembly:Astyanax_mexicanus-2.0:8:5821... [more]
ENSAMXT00000025849.29.302e-2231.54pep primary_assembly:Astyanax_mexicanus-2.0:6:2055... [more]
ENSAMXT00000057483.11.925e-2030.47piggyBac transposable element-derived protein 4-li... [more]
back to top
BLAST of SMED30030020 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007705.17.375e-1626.10pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000002004.12.531e-1125.27pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
ENSPMAT00000001816.14.598e-620.54pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-... [more]
back to top
BLAST of SMED30030020 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030020 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030020 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037833.14.942e-4330.65piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000027888.11.513e-4036.82pep primary_assembly:ASM223467v1:17:9217998:921921... [more]
ENSORLT00000029842.14.502e-4038.46piggyBac transposable element-derived protein 4 [S... [more]
ENSORLT00000038522.19.043e-1629.32pep primary_assembly:ASM223467v1:10:9345195:934711... [more]
ENSORLT00000047092.11.135e-1529.32piggyBac transposable element-derived protein 2-li... [more]
back to top
BLAST of SMED30030020 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031831.13.722e-4567.42SMESG000031831.1[more]
SMESG000035129.14.328e-4264.35SMESG000035129.1[more]
SMESG000018066.11.313e-4192.31SMESG000018066.1[more]
SMESG000081807.12.595e-2933.61SMESG000081807.1[more]
SMESG000070813.19.014e-2834.17SMESG000070813.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030020 ID=SMED30030020|Name=SMED30030020|organism=Schmidtea mediterranea sexual|type=transcript|length=3609bp
TGTAACGTTTAACTTGATTATGAATGAAAACTTAAAATTAATTGTTTTGG
GTTTTGATGCATTTTCATTCGCTTAAATTCAATAGAAATATATTTTAACA
CTAGATTTACGGATGTTGATTATATACCTATTTTTACTGAAGTGAGCCAA
TTTGACTCATACAAGAAAATTGAAGTTTTTTGCAAAGAAAATAGTTCCAA
ATCAATTTAAATGAAATTTTTATTATCAAAAAATTCATGAAAAACATTTT
TTACATATAAACTCGGTTTTGGAAACACATTTTTCGCAGATATTTCTATT
ACATTTAGCACAATGGTTTGTACATCTGTTTCTTTTACATGATTGTTGAA
CTTGACAATTCTTCCGTGCGTCAGTAGCATGAATTTCTGTCATTGGAATG
GAAGTGTTCTCGACTTCTTCTCTATATTTACTTGAGTCGTCTCTTTATAC
AGAATCCAAGCATTGATAGCTGCTAAATCTAAAATGTTGTAGAAAACTTG
TAGAGGCCATCTGAGTGAACTTGGTTTAACACTATATTTTCGGGCTATTT
GGTCAAGTACATCAACGCCATACTTAGTGCTATTATAATAGGTTACTGTT
TCTGGAACAAGTTTTTTATTTTTTTCAATTGTTATATTTTTATGTTTTGT
ACTTAGTAGTGAAACTTTTTTATTAGGCTTGCTTTTATAAATGGTCAGGG
TACAATTCTCAGATCTATACAGTTTTGTAAAAAACTGTGTTATTTTATCT
TTCTTGGCTTTCGCAATTTTAGGTAATTCTTTTCGGTTTGCACGTATAGT
GCCAACCAAAGTAGTTTTCTTTGCTAGTAACTTTTTTGCAAGTGAAATGC
TAGTAAAAAAATTACCTGTGGTAGTATTTCGTCAACAGCCTAAATATGGC
TCTGCAAGCTTAGTTACTACAAATTCGCTCAAGGGAATGTTTGATCCTCA
GGTTTCATCCTTGCTCAAGTACGGAAAACCGTTTACAAGATATTTGCTTC
TAACATCGGATGCCAGCCAAAATTTGATGCCGAATTTATCCGGCTTATTC
GGCATGTACTGCGTAAATCGGCATCTAGCTTTAGTAGGGAATAATTGCTC
ATCGATCGTTATGTTTGCGCCAGGTTTGTAAAAAGCCTGACTATTTTTTC
CCATATTTTGGAAATCAAGGCAAGTTTGTCTGTCTTCAGTCTTTCACTGC
GTTCGTTTTTCTTATCAAAACGTATGAACCGAAGTATGTCTATAAATTTA
TCTCTAGACATTGTCTGGGCGAAAAAGCCGGACACCACTTCGCAGACCAC
AAATATGAGCACTTCAAATTTTTGCCTCATATGCTTCTCTAGCAAATAAA
ATTGCTACAAAGGCCCACAATTGTGATTTTGTTACCGATCATTCCTTATT
ATTCAAAACTTGACGAGCTTCGAGTTCGGTACATGATTTTATATACGCCA
TCATACCTTCGTCAATTATCAAATTGTATGCGCTACTTGCCGAACCAAGC
ATAATATGCCATTTAGCATAGGCAGTTGGACCAGAAACGTCTTTGAATAT
GGTATAAATCGGTGATCTACCTACGTTTCTGCCTTCGTTAAATGTTTCCC
ATAAAGTCCCATCAGCAACTTTTTCGGCTGAAATTTTTTTATCAGAAGAT
GTATCGATAGCGACTAAATCATTTTCGGTTTCAGAATCAGAAATAACTCT
ACCTCTTTTTTTACTAGGAGCTGTGTAACGAAAAACTTTATCTTCGCTGT
CAGTTTCAGAATCAGAAATAACCCTGGCTCTTTTTTTGTTAGGAGCTATA
TAACAAAGATCTTCATCTTCACTGCTTGAAGATTCAATTTTATTGACTTC
CTCCTCTAATTCAATTTCGTTATCACATTGGTCTATATAAATTGCATCCG
ATTCATTATCTGATTGGTCTTTCTTTATTTTGATTAGTTTTTTCAACAAA
AGACAATTTTTCTGATTTTTTCCCATAATAAATACCCTAGATAACCAGAT
AAAATAAATATCAAATGTAATACCTTTTACAAATAAATTATAAATTATAT
ACTACTTCACTGCACTGCTCACACGCGATGTATAAATCGAAATGATAACA
GAAGTGGGTAATGATGTAGCGGAGTAACGAAAACAAGTGACAATGGCTCC
CACATACACACAAATATTGTATGTGTGGAATGCCAAATGAGAAGCGAAAC
AACTTACGTGCGACTTGACTGTTGCCCAGGCCTGATAGAACCAATAAATT
TCATGTTATGCGATTAACTGTTAAACCATTCTGAGTCAAATTGGTTCACA
ACCGTGAAAATAGGTACACCACATTCGATAATGCAAAATGAAGGGGTCTG
CGGGGAAGAGGAATGCACGTTTACATATATTTCATGCAAGAACTGCTTTT
TAGTTTCAAGGATATGTCGATCACTAAGGGTTAAGGACCACTCCTTCAGA
TACAACATACTTAAAATTTCAACTAACATTTAATTTCACTAAATTATTAC
ATAAGTTACATTTTGTTTGCAGATATCGACTACCTCAAATGTATTTTGGT
ATTTGGATGATGATTTTTCTGTCGATATATGTTTGAGTAATGCTGCTGAA
AGCGCTGGTAGTAGCTGTGGTGACAGCTGTGAAATATTTAAAGCCGACGA
GAACTTTGAAGGTTTTCCGTTACAGGTTAATAAAAAATATTCAAAACAAA
CAAGTCTTTGTCATTTTGCTACTCACCCAGATTCTCTGCGGTATTCTCGT
GATATTCAAAGTTCTCCATATTTAAATGGATTTAAAAAATGCAAAATGGA
TTTATTTGATAATTTGTATTTTGAATTGCAACAATTGGAAAGAGATTTGG
ATAAACTTAAGTTGGAATTAGGGATTTACTCGACCAGATGTCACAGAGTT
TCCATTGAAATAGACTTTCTCTCTCAACATTTACTAGTCGAAAATTTTAT
TTATTCTATGCGGCAATTAAATTGGTCAAATGAATTTCTCTCTCTGCCAA
ATAATCAAAATTTGTATTTAAATTCTCATTATTGCCAAGATTATGGTGGT
GATGATAATGCCATGTCAGTGAACGGTCACGATTTTAATAATAACAGATG
GAGTTTAGATTTTGAATTATAATTTTTTTTATATTTTTAAATTTTCTTTT
TTGTATGTTATTACTTAAAGAATGATGTCAAACTACTTTTATGTCGCTAT
TTACTTCAAGGTACCGGCGATTTTTACCTAATTTCATTTCTATCTGACCA
TAACCAGATTGATTTGAAAAAAATTTTTGAAATTATTTTGCCTCTTTAAT
TGGCTTTGTTTAATTATGTGCACGAGCGTTATCGAATGGCTTTAATTGGA
TGAAATTGAAAATTTGATAAATGGGAAAAAATGAGAAATGGTGAAGCAAA
ATAGAAACTCAGACAGGCATGCTCAGTATGCGAACAGTCTCAGACAAATA
TTAAAATTAACAAAAATATTACATGAAAAGTAGTGTAAAACTGTAATTGA
AAACTAATTAAATTTGATGATAGTGAGCAAATCAATCTTAGAGAAAATAA
TCAAAGTGAGAATGGAATTACTCTTCGGGCATAATTTTCTAATAGAAACG
AAAAATCTC
back to top

protein sequence of SMED30030020-orf-1

>SMED30030020-orf-1 ID=SMED30030020-orf-1|Name=SMED30030020-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MGKNQKNCLLLKKLIKIKKDQSDNESDAIYIDQCDNEIELEEEVNKIESS
SSEDEDLCYIAPNKKRARVISDSETDSEDKVFRYTAPSKKRGRVISDSET
ENDLVAIDTSSDKKISAEKVADGTLWETFNEGRNVGRSPIYTIFKDVSGP
TAYAKWHIMLGSASSAYNLIIDEGMMAYIKSCTELEARQVLNNKE*
back to top

protein sequence of SMED30030020-orf-2

>SMED30030020-orf-2 ID=SMED30030020-orf-2|Name=SMED30030020-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MDLFDNLYFELQQLERDLDKLKLELGIYSTRCHRVSIEIDFLSQHLLVEN
FIYSMRQLNWSNEFLSLPNNQNLYLNSHYCQDYGGDDNAMSVNGHDFNNN
RWSLDFEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 32..49