GTP-binding nuclear protein

Overview
NameGTP-binding nuclear protein
Smed IDSMED30030013
Length (bp)837
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTP-binding nuclear protein (SMED30030013) t-SNE clustered cells

Violin plots show distribution of expression levels for GTP-binding nuclear protein (SMED30030013) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTP-binding nuclear protein (SMED30030013) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTP-binding nuclear protein (SMED30030013) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030013

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030013SMESG000072522.1 SmedASXL_004044SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030013SMESG000072522.1 Contig38852newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030013SMESG000072522.1 Contig38852uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30030013SMESG000072522.1 SMED30030013smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gamma neoblastSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v6_330_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030013SMESG000072524.1 SMESG000072522.1 dd_Smed_v6_330_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTP-binding nuclear protein vs. Ensembl Human
Match: RAN (RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9846])

HSP 1 Score: 354.755 bits (909), Expect = 2.527e-124
Identity = 166/188 (88.30%), Postives = 175/188 (93.09%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Human
Match: RAN (RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9846])

HSP 1 Score: 354.755 bits (909), Expect = 2.527e-124
Identity = 166/188 (88.30%), Postives = 175/188 (93.09%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Human
Match: RAN (RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9846])

HSP 1 Score: 348.206 bits (892), Expect = 1.629e-121
Identity = 169/199 (84.92%), Postives = 178/199 (89.45%), Query Frame = 1
Query:   55 NC----FKKMSGDAVAQF-KLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
            NC    F    G A  +F KLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:   11 NCASAIFPASVGRARRRFWKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 209          
BLAST of GTP-binding nuclear protein vs. Ensembl Human
Match: RAN (RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9846])

HSP 1 Score: 346.28 bits (887), Expect = 2.766e-121
Identity = 163/185 (88.11%), Postives = 173/185 (93.51%), Query Frame = 1
Query:   82 AVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
            A  + +LVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    3 AQGEPQLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 187          
BLAST of GTP-binding nuclear protein vs. Ensembl Human
Match: RAN (RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9846])

HSP 1 Score: 345.125 bits (884), Expect = 2.620e-120
Identity = 166/205 (80.98%), Postives = 175/205 (85.37%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQ-----------------GQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ                  QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQEMGIHHVAHAGLELMSSAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 208          
BLAST of GTP-binding nuclear protein vs. Ensembl Celegans
Match: ran-1 (GTP-binding nuclear protein ran-1 [Source:UniProtKB/Swiss-Prot;Acc:O17915])

HSP 1 Score: 358.992 bits (920), Expect = 1.787e-126
Identity = 167/191 (87.43%), Postives = 178/191 (93.19%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 645
             GD +  FKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG+IRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVT+R+TYKNVPNWHRDL RVCENIPIVL GNKVD+KDRKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP  +
Sbjct:    3 GGDGIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPALAPPEVQMDPAMI 193          
BLAST of GTP-binding nuclear protein vs. Ensembl Celegans
Match: rab-7 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146])

HSP 1 Score: 115.161 bits (287), Expect = 6.022e-31
Identity = 61/180 (33.89%), Postives = 98/180 (54.44%), Query Frame = 1
Query:   88 AQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKD-RKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMP 603
            A  K++++GD G GKT+ + ++V   F  +Y AT+G +    + N     +   +WDTAGQE+F  L   +Y    C ++ FDVT+  ++K++ +W  + +     R  ++ P VL+GNKVD++  R V +K        K N+ YY+VSAK   N E  FL IAR  +   + E  + P
Sbjct:    8 ALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTLQIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARESQETNDFP 187          
BLAST of GTP-binding nuclear protein vs. Ensembl Celegans
Match: rab-7 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146])

HSP 1 Score: 115.161 bits (287), Expect = 6.022e-31
Identity = 61/180 (33.89%), Postives = 98/180 (54.44%), Query Frame = 1
Query:   88 AQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKD-RKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMP 603
            A  K++++GD G GKT+ + ++V   F  +Y AT+G +    + N     +   +WDTAGQE+F  L   +Y    C ++ FDVT+  ++K++ +W  + +     R  ++ P VL+GNKVD++  R V +K        K N+ YY+VSAK   N E  FL IAR  +   + E  + P
Sbjct:    8 ALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTLQIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARESQETNDFP 187          
BLAST of GTP-binding nuclear protein vs. Ensembl Celegans
Match: rab-5 (RAB family [Source:UniProtKB/TrEMBL;Acc:P91857])

HSP 1 Score: 105.916 bits (263), Expect = 1.662e-27
Identity = 57/164 (34.76%), Postives = 93/164 (56.71%), Query Frame = 1
Query:   85 VAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-NIPIVLVGNKVDIKD-RKVKAKTITFHRKKN-LQYYDVSAKSNYNFEKPFLWIARKL 567
              QFKLVL+G+   GK++ V R V G+F +   +T+G              I+F +WDTAGQE++  L   YY   Q AI+++D+T++ +++   NW ++L R    NI + L GNK D+ + R V+ +    + + N L + + SAK++ N    F+ IA+KL
Sbjct:   17 TCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFMAIAKKL 180          
BLAST of GTP-binding nuclear protein vs. Ensembl Celegans
Match: F11A5.4 (pep chromosome:WBcel235:V:16195679:16196290:1 gene:WBGene00008672.1 transcript:F11A5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F11A5.4)

HSP 1 Score: 105.531 bits (262), Expect = 1.933e-27
Identity = 63/175 (36.00%), Postives = 103/175 (58.86%), Query Frame = 1
Query:   70 MSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-NIPIVLVGNKVDIK-DRKV-KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNL 585
            MS D V  FK V++GD G GK+  + R +   F+  + +TLG+E         R K++ +VWDT GQE+F  L   YY     A++++D+TSR ++ ++ +W  DL R+ + +I IVL+GNK D++ DR+V K +   F R+  L + ++SAK+N   E+ F+  A ++    N 
Sbjct:    1 MSSDHV--FKYVIIGDRGVGKSNLLLRFIGKPFDSIHPSTLGIEFGFRNLEIDRKKVKLHVWDTCGQERFRSLVGSYYRHAIGALLVYDITSRESFYHLEHWLTDLQRLGDPDIVIVLIGNKSDLEADREVRKEEGEAFAREFGLIFMEISAKTNEYVEEAFVNSAHEIYRKLNF 173          
BLAST of GTP-binding nuclear protein vs. Ensembl Fly
Match: Ran (gene:FBgn0020255 transcript:FBtr0340164)

HSP 1 Score: 352.829 bits (904), Expect = 5.138e-124
Identity = 165/190 (86.84%), Postives = 174/190 (91.58%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNW 642
             G  +  FK VLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG IRFNVWDTAGQEKFGGLRDGYYIQGQCA+IMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGDPNLEF  MPAL PPEV MD +W
Sbjct:    4 EGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDW 193          
BLAST of GTP-binding nuclear protein vs. Ensembl Fly
Match: Ran (gene:FBgn0020255 transcript:FBtr0073471)

HSP 1 Score: 352.829 bits (904), Expect = 5.138e-124
Identity = 165/190 (86.84%), Postives = 174/190 (91.58%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNW 642
             G  +  FK VLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG IRFNVWDTAGQEKFGGLRDGYYIQGQCA+IMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGDPNLEF  MPAL PPEV MD +W
Sbjct:    4 EGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDW 193          
BLAST of GTP-binding nuclear protein vs. Ensembl Fly
Match: Ran (gene:FBgn0020255 transcript:FBtr0073472)

HSP 1 Score: 352.829 bits (904), Expect = 5.138e-124
Identity = 165/190 (86.84%), Postives = 174/190 (91.58%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNW 642
             G  +  FK VLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG IRFNVWDTAGQEKFGGLRDGYYIQGQCA+IMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGDPNLEF  MPAL PPEV MD +W
Sbjct:    4 EGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDW 193          
BLAST of GTP-binding nuclear protein vs. Ensembl Fly
Match: Ran (gene:FBgn0020255 transcript:FBtr0340165)

HSP 1 Score: 352.829 bits (904), Expect = 5.138e-124
Identity = 165/190 (86.84%), Postives = 174/190 (91.58%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNW 642
             G  +  FK VLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG IRFNVWDTAGQEKFGGLRDGYYIQGQCA+IMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGDPNLEF  MPAL PPEV MD +W
Sbjct:    4 EGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDW 193          
BLAST of GTP-binding nuclear protein vs. Ensembl Fly
Match: Ran-like (gene:FBgn0036497 transcript:FBtr0075616)

HSP 1 Score: 251.521 bits (641), Expect = 5.169e-84
Identity = 117/179 (65.36%), Postives = 141/179 (78.77%), Query Frame = 1
Query:   88 AQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEV 624
            A FKL+L+GDGGTGKTT VKRH+TGEF+ +Y ATLGVEV  L FNT RG  R +VWDTAGQE++GGLRDGY++Q QCAIIMFDV S  TY NV  WHRDLVRVC NIPIV+ GNKVDI  +K   K + F RK N+   ++SAKSNYN EKPF+++ RKLVGDP+L+  + PA+ PP+V
Sbjct:    9 AIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKV 187          
BLAST of GTP-binding nuclear protein vs. Ensembl Zebrafish
Match: ran (RAN, member RAS oncogene family [Source:NCBI gene;Acc:30572])

HSP 1 Score: 354.755 bits (909), Expect = 1.274e-124
Identity = 164/182 (90.11%), Postives = 174/182 (95.60%), Query Frame = 1
Query:   91 QFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
            QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I++NVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF EMPALAPPE+ MDP
Sbjct:    9 QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPALAPPEIAMDP 190          
BLAST of GTP-binding nuclear protein vs. Ensembl Zebrafish
Match: ran (RAN, member RAS oncogene family [Source:NCBI gene;Acc:30572])

HSP 1 Score: 354.755 bits (909), Expect = 1.274e-124
Identity = 164/182 (90.11%), Postives = 174/182 (95.60%), Query Frame = 1
Query:   91 QFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
            QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I++NVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF EMPALAPPE+ MDP
Sbjct:    9 QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPALAPPEIAMDP 190          
BLAST of GTP-binding nuclear protein vs. Ensembl Zebrafish
Match: ran (RAN, member RAS oncogene family [Source:NCBI gene;Acc:30572])

HSP 1 Score: 354.755 bits (909), Expect = 1.274e-124
Identity = 164/182 (90.11%), Postives = 174/182 (95.60%), Query Frame = 1
Query:   91 QFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
            QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I++NVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF EMPALAPPE+ MDP
Sbjct:    9 QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPALAPPEIAMDP 190          
BLAST of GTP-binding nuclear protein vs. Ensembl Zebrafish
Match: rab7a (RAB7a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040426-1352])

HSP 1 Score: 112.464 bits (280), Expect = 9.089e-30
Identity = 56/163 (34.36%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C +++FDVT+  T+K + +W  + +     R  EN P V++GNK+D+++R+V  K        K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Zebrafish
Match: rab7a (RAB7a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040426-1352])

HSP 1 Score: 112.464 bits (280), Expect = 9.089e-30
Identity = 56/163 (34.36%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C +++FDVT+  T+K + +W  + +     R  EN P V++GNK+D+++R+V  K        K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Xenopus
Match: ran (RAN, member RAS oncogene family [Source:NCBI gene;Acc:448091])

HSP 1 Score: 354.755 bits (909), Expect = 1.686e-124
Identity = 166/188 (88.30%), Postives = 175/188 (93.09%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Xenopus
Match: rab7a (RAB7A, member RAS oncogene family [Source:NCBI gene;Acc:493388])

HSP 1 Score: 114.005 bits (284), Expect = 3.488e-30
Identity = 57/163 (34.97%), Postives = 94/163 (57.67%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAK--TITFHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C ++++DVT+  T+K + +W  + +     R  EN P V++GNKVD+++R+V  K   +  H K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFTNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKVDLENRQVTTKRAQVWCHSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Xenopus
Match: rab30 (RAB30, member RAS oncogene family [Source:NCBI gene;Acc:448082])

HSP 1 Score: 108.612 bits (270), Expect = 2.967e-28
Identity = 56/165 (33.94%), Postives = 92/165 (55.76%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCEN-IPIVLVGNKVDIKDRK--VKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDP 579
            FK+VL+G+ G GKT  V+R   G F     AT+GV+           KI+  +WDTAGQE+F  +   YY      I+ +D+T   +++ +P W R++ +   + +  VLVGNK+D+ +R+   + +   F   +N+ Y + SAK + N EK FL +A +L+ + 
Sbjct:   10 FKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEIKGEKIKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYANSEVITVLVGNKIDLAERREVSQQRAEEFAGTQNMYYLETSAKESDNVEKLFLDLACRLISEA 174          
BLAST of GTP-binding nuclear protein vs. Ensembl Xenopus
Match: rab5a (RAB5A, member RAS oncogene family [Source:NCBI gene;Acc:493430])

HSP 1 Score: 105.916 bits (263), Expect = 4.588e-27
Identity = 55/168 (32.74%), Postives = 93/168 (55.36%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-NIPIVLVGNKVDIKDRKVK--AKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
            +G+ + QFKLVL+G+   GK++ V R V G+F +   +T+G              ++F +WDTAGQE++  L   YY   Q AI+++D+T+  ++    NW ++L R    NI I L GNK D+  ++     +   +    +L + + SAK++ N  + F+ IA+KL
Sbjct:   15 AGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLASKRAVDFQEAQAYADDNSLLFMETSAKTSVNVNEIFMAIAKKL 182          
BLAST of GTP-binding nuclear protein vs. Ensembl Xenopus
Match: vasp (vasodilator stimulated phosphoprotein [Source:Xenbase;Acc:XB-GENE-6454542])

HSP 1 Score: 105.531 bits (262), Expect = 4.807e-27
Identity = 53/167 (31.74%), Postives = 90/167 (53.89%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQ--YYDVSAKSNYNFEKPFLWIARKLVG 573
             K++L+GDGG GK++ + R+VT +F+ +   T+GVE    E       +   +WDTAGQE+F  LR  +Y    C ++ F V    +++N+ NW ++      V+  ++ P V++GNK+DI DR+V  +      + N    Y++ SAK   N    F    R+++ 
Sbjct:    8 LKIILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKELEVDGHLVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLTNWKKEFIYYADVKDPDSFPFVILGNKIDITDRQVSVEEAQAWCRDNGNNPYFETSAKDATNVAAAFEEAVRRVLA 174          
BLAST of GTP-binding nuclear protein vs. Ensembl Mouse
Match: Ran (RAN, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1333112])

HSP 1 Score: 354.755 bits (909), Expect = 1.735e-124
Identity = 166/188 (88.30%), Postives = 175/188 (93.09%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Mouse
Match: Ran (RAN, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1333112])

HSP 1 Score: 354.755 bits (909), Expect = 1.735e-124
Identity = 166/188 (88.30%), Postives = 175/188 (93.09%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Mouse
Match: 1700009N14Rik (RIKEN cDNA 1700009N14 gene [Source:MGI Symbol;Acc:MGI:1922721])

HSP 1 Score: 344.739 bits (883), Expect = 1.274e-120
Identity = 162/188 (86.17%), Postives = 172/188 (91.49%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             GD   QFKLVLVGDGGTGKT FVKRH+TGEFEKKYVATLGVEVHPL F+T+RG I+FNVWDTAGQEKFGGLRDGYYIQ Q AIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVL GNKVD+KDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW++R+L GD NLEF  MPALAPPEV MDP
Sbjct:    4 EGDPPVQFKLVLVGDGGTGKTAFVKRHLTGEFEKKYVATLGVEVHPLMFHTSRGPIKFNVWDTAGQEKFGGLRDGYYIQAQGAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLSRRLTGDSNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Mouse
Match: Rasl2-9 (RAS-like, family 2, locus 9 [Source:MGI Symbol;Acc:MGI:104605])

HSP 1 Score: 337.421 bits (864), Expect = 1.105e-117
Identity = 156/188 (82.98%), Postives = 171/188 (90.96%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFK+VLVGDGGTGKTTF+KRH+TGEFEK+YVATLGVEVH L F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVP+WH+DLVRVCENIPIVL GNKVD+KD KVKAK I FHRKKNLQYYD+SA+SNYNFEKPF W+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKVVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDVKDMKVKAKPILFHRKKNLQYYDISARSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Mouse
Match: Rab7 (RAB7, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105068])

HSP 1 Score: 112.464 bits (280), Expect = 9.705e-30
Identity = 56/163 (34.36%), Postives = 93/163 (57.06%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C +++FDVT+  T+K + +W  + +     R  EN P V++GNK+D+++R+V  K      + K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. UniProt/SwissProt
Match: sp|P38542|RAN_BRUMA (GTP-binding nuclear protein Ran OS=Brugia malayi OX=6279 GN=Bm1_44725 PE=2 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 1.221e-126
Identity = 169/191 (88.48%), Postives = 180/191 (94.24%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 645
            +GD +  FKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG+IRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVT+R+TYKNVPNWHRDLVRVCENIPIVL GNKVD+KDRKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP  V
Sbjct:    3 TGDDIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLIFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPALAPPEVQMDPTMV 193          
BLAST of GTP-binding nuclear protein vs. UniProt/SwissProt
Match: sp|O17915|RAN_CAEEL (GTP-binding nuclear protein ran-1 OS=Caenorhabditis elegans OX=6239 GN=ran-1 PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.273e-125
Identity = 167/191 (87.43%), Postives = 178/191 (93.19%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 645
             GD +  FKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG+IRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVT+R+TYKNVPNWHRDL RVCENIPIVL GNKVD+KDRKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP  +
Sbjct:    3 GGDGIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPALAPPEVQMDPAMI 193          
BLAST of GTP-binding nuclear protein vs. UniProt/SwissProt
Match: sp|P52301|RAN_XENLA (GTP-binding nuclear protein Ran OS=Xenopus laevis OX=8355 GN=ran PE=1 SV=2)

HSP 1 Score: 354.755 bits (909), Expect = 8.738e-124
Identity = 166/188 (88.30%), Postives = 175/188 (93.09%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. UniProt/SwissProt
Match: sp|P42558|RAN_CHICK (GTP-binding nuclear protein Ran OS=Gallus gallus OX=9031 GN=RAN PE=2 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 8.738e-124
Identity = 166/188 (88.30%), Postives = 175/188 (93.09%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
             G+   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP
Sbjct:    4 QGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDP 191          
BLAST of GTP-binding nuclear protein vs. UniProt/SwissProt
Match: sp|P79735|RAN_DANRE (GTP-binding nuclear protein Ran OS=Danio rerio OX=7955 GN=ran PE=2 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 9.620e-124
Identity = 164/182 (90.11%), Postives = 174/182 (95.60%), Query Frame = 1
Query:   91 QFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
            QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I++NVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF EMPALAPPE+ MDP
Sbjct:    9 QFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPALAPPEIAMDP 190          
BLAST of GTP-binding nuclear protein vs. TrEMBL
Match: A0A267GL75 (GTP-binding nuclear protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010089g1 PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.287e-125
Identity = 170/187 (90.91%), Postives = 182/187 (97.33%), Query Frame = 1
Query:   79 DAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPN 639
            + +AQFKLVLVGDGG GKTTFVKRH+TGEFEKKYVATLGVEVHPL+F+TTRGK+RFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGD +LEF EMPALAPPE+ MDP+
Sbjct:   11 NVIAQFKLVLVGDGGVGKTTFVKRHLTGEFEKKYVATLGVEVHPLDFHTTRGKMRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDAHLEFVEMPALAPPELAMDPS 197          
BLAST of GTP-binding nuclear protein vs. TrEMBL
Match: A0A267G1T7 (GTP-binding nuclear protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012914g2 PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.312e-125
Identity = 170/187 (90.91%), Postives = 182/187 (97.33%), Query Frame = 1
Query:   79 DAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPN 639
            + +AQFKLVLVGDGG GKTTFVKRH+TGEFEKKYVATLGVEVHPL+F+TTRGK+RFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGD +LEF EMPALAPPE+ MDP+
Sbjct:   10 NVIAQFKLVLVGDGGVGKTTFVKRHLTGEFEKKYVATLGVEVHPLDFHTTRGKMRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDAHLEFVEMPALAPPELAMDPS 196          
BLAST of GTP-binding nuclear protein vs. TrEMBL
Match: A0A1I8HZD4 (GTP-binding nuclear protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.789e-125
Identity = 170/187 (90.91%), Postives = 182/187 (97.33%), Query Frame = 1
Query:   79 DAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPN 639
            + +AQFKLVLVGDGG GKTTFVKRH+TGEFEKKYVATLGVEVHPL+F+TTRGK+RFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGD +LEF EMPALAPPE+ MDP+
Sbjct:    5 NVIAQFKLVLVGDGGVGKTTFVKRHLTGEFEKKYVATLGVEVHPLDFHTTRGKMRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDAHLEFVEMPALAPPELAMDPS 191          
BLAST of GTP-binding nuclear protein vs. TrEMBL
Match: A0A0N5CX98 (GTP-binding nuclear protein OS=Thelazia callipaeda OX=103827 GN=TCLT_LOCUS5001 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.442e-124
Identity = 169/191 (88.48%), Postives = 181/191 (94.76%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 645
            SGD +  FKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG+IRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVT+R+TYKNVPNWHRDLVRVCENIPIVL GNKVD+KDRKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP+ +
Sbjct:    3 SGDDIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLIFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPALAPPEVQMDPSMI 193          
BLAST of GTP-binding nuclear protein vs. TrEMBL
Match: A0A4Z2DXJ0 (GTP-binding nuclear protein OS=Schistosoma japonicum OX=6182 GN=EWB00_001699 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.527e-124
Identity = 169/187 (90.37%), Postives = 181/187 (96.79%), Query Frame = 1
Query:   85 VAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 645
            VA FKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+F+TTRGK+RFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDI+DRKVKAK+ITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGDPNLEF EMPA+ PPE+ +DPN V
Sbjct:    7 VAVFKLVLVGDGGTGKTTFVKRHITGEFEKKYVATLGVEVHPLDFHTTRGKMRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIQDRKVKAKSITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVEMPAMEPPEIQIDPNLV 193          
BLAST of GTP-binding nuclear protein vs. Ensembl Cavefish
Match: ran (RAN, member RAS oncogene family [Source:NCBI gene;Acc:103033763])

HSP 1 Score: 356.295 bits (913), Expect = 2.409e-125
Identity = 165/187 (88.24%), Postives = 176/187 (94.12%), Query Frame = 1
Query:   79 DAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPN 639
            D   QFKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I++NVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF EMPALAPPE+ MDP+
Sbjct:    5 DPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPALAPPEIAMDPS 191          
BLAST of GTP-binding nuclear protein vs. Ensembl Cavefish
Match: rab7a (ras-related protein rab7 [Source:NCBI gene;Acc:103043048])

HSP 1 Score: 112.464 bits (280), Expect = 7.703e-30
Identity = 56/163 (34.36%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C +++FDVT+  T+K + +W  + +     R  EN P V++GNK+D+++R+V  K        K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Cavefish
Match: ENSAMXT00000041258.1 (RAB7A, member RAS oncogene family [Source:NCBI gene;Acc:103037857])

HSP 1 Score: 111.309 bits (277), Expect = 2.216e-29
Identity = 54/163 (33.13%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C ++++DVT+  T+K + +W  + +     R  +N P V++GNK+D+++R+V  K        K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTLDSWRDEFLIQASPRDPDNFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNMPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Cavefish
Match: rab7b (ras-related protein rab7-like [Source:NCBI gene;Acc:103037223])

HSP 1 Score: 110.153 bits (274), Expect = 4.906e-29
Identity = 54/163 (33.13%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C ++++DVT+  T+K + +W  + +     R  EN P V++GNK+D+++R+V  K        K N+ Y++ SAK   N ++ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Cavefish
Match: ENSAMXT00000002303.2 (RAB7A, member RAS oncogene family [Source:NCBI gene;Acc:103037857])

HSP 1 Score: 110.153 bits (274), Expect = 6.674e-29
Identity = 54/163 (33.13%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C ++++DVT+  T+K + +W  + +     R  +N P V++GNK+D+++R+V  K        K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTLDSWRDEFLIQASPRDPDNFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNMPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Sea Lamprey
Match: ran (RAN, member RAS oncogene family [Source:NCBI gene;Acc:30572])

HSP 1 Score: 295.434 bits (755), Expect = 1.784e-102
Identity = 137/154 (88.96%), Postives = 143/154 (92.86%), Query Frame = 1
Query:  184 ATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 645
            ATLGVEVHPL F+T RG I+FNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDP  V
Sbjct:    1 ATLGVEVHPLVFHTNRGAIKFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKAIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVQMDPQLV 154          
BLAST of GTP-binding nuclear protein vs. Ensembl Sea Lamprey
Match: rab30 (RAB30, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-250])

HSP 1 Score: 115.546 bits (288), Expect = 1.097e-31
Identity = 68/183 (37.16%), Postives = 103/183 (56.28%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVE--VHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVR-VCENIPIVLVGNKVDIKD-RKV-KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVP 627
            FK+VL+G+ G GKT  V+R   G F     AT+GV+  +  +E + T  KI+  +WDTAGQE+F  +   YY      ++ +DV+S  T+  +P W R++ +    ++P VLVGNK+D+ D R+V + +   F R   L+Y + SAK   N E+ F+ +AR+L  D     A  PAL     P
Sbjct:   10 FKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVDGT--KIKLQIWDTAGQERFRSITQSYYRSAHALVLTYDVSSEETFACLPAWLREMEQHASAHVPRVLVGNKLDLADVRQVTREQAEAFARLHGLRYLETSAKEAENVERLFVELARRLALD-----ARQPALGDAPGP 185          
BLAST of GTP-binding nuclear protein vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 107.071 bits (266), Expect = 1.821e-28
Identity = 58/174 (33.33%), Postives = 96/174 (55.17%), Query Frame = 1
Query:   67 KMSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-NIPIVLVGNKVDIKDRKVKAKTITFHRKK------NLQYYDVSAKSNYNFEKPFLWIARKL 567
            +++G+ + QFKLVL+G+   GK++ V R V G+F +   +T+G              ++F +WDTAGQE++  L   YY   Q AI+++D+T++ ++    NW ++L R    NI I L GNK D+ ++    +T+ F   +       L + + SAK+  N    FL IA+KL
Sbjct:   13 QVAGNKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDSFARAKNWVKELQRQANPNIVIALAGNKTDLANQ----RTVDFEEAQGYSEDNGLLFMETSAKTAMNVNDVFLAIAKKL 182          
BLAST of GTP-binding nuclear protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000009.1 (pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1 gene:ENSPMAG00000000008.1 transcript:ENSPMAT00000000009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 2.206e-27
Identity = 56/168 (33.33%), Postives = 90/168 (53.57%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-NIPIVLVGNKVDIKDRKVK--AKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
            S   + QFKLVL+G+   GK++ V R V G+F +   +T+G              ++F +WDTAGQE++  L   YY   Q AI+++D+T++ T+     W ++L R    NI I L GNK D+  +++    +  ++     L + + SAK+  N    FL IA+KL
Sbjct:   20 STSKILQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFSRAKTWVKELQRQASPNIVIALAGNKADLASKRIVEFEEAQSYADDNGLLFMETSAKTAMNVNDIFLAIAKKL 187          
BLAST of GTP-binding nuclear protein vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 102.064 bits (253), Expect = 1.669e-26
Identity = 65/197 (32.99%), Postives = 105/197 (53.30%), Query Frame = 1
Query:   55 NCFKKMSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-NIPIVLVGNKVDI-KDRKVKAKTITFHRKKN-LQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDP 636
            NC  + + + + QFKLVL+G+   GK++ V R V G+F +   +T+G        +     ++F +WDTAGQE++  L   YY   Q AI+++D+T+  ++     W ++L R     I I L GNK D+   R V+ +    + ++N L + + SAK+  N  + FL IA+KL   P  E  + P      VP+DP
Sbjct:   11 NC--QTATNKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVSLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNLDSFARAKTWVKELQRQANPTIVIALSGNKADLASQRMVEFEEAQGYAEENGLLFMETSAKTAMNVNEVFLAIAKKL---PKNE-QQNPGGKSNVVPIDP 201          
BLAST of GTP-binding nuclear protein vs. Ensembl Yeast
Match: GSP2 (GTP binding protein (mammalian Ranp homolog); involved in the maintenance of nuclear organization, RNA processing and transport; interacts with Kap121p, Kap123p and Pdr6p (karyophilin betas); not required for viability; protein abundance increases in response to DNA replication stress; GSP2 has a paralog, GSP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005711])

HSP 1 Score: 333.954 bits (855), Expect = 3.269e-117
Identity = 156/183 (85.25%), Postives = 168/183 (91.80%), Query Frame = 1
Query:   85 VAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMD 633
            V  FKLVLVGDGGTGKTTFVKRH+TGEFEKKY+AT+GVEVHPL F T  G+I+F+VWDTAGQEKFGGLRDGYYI  QCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVL GNKVD+K+RKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL G+P LEF   PALAPPEV +D
Sbjct:   11 VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVD 193          
BLAST of GTP-binding nuclear protein vs. Ensembl Yeast
Match: GSP1 (Ran GTPase; GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; regulated by Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and Kap95p; GSP1 has a paralog, GSP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004284])

HSP 1 Score: 333.183 bits (853), Expect = 5.577e-117
Identity = 156/183 (85.25%), Postives = 168/183 (91.80%), Query Frame = 1
Query:   85 VAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMD 633
            V  FKLVLVGDGGTGKTTFVKRH+TGEFEKKY+AT+GVEVHPL F T  G+I+F+VWDTAGQEKFGGLRDGYYI  QCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVL GNKVD+K+RKVKAKTITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL G+P LEF   PALAPPEV +D
Sbjct:   10 VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVD 192          
BLAST of GTP-binding nuclear protein vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 96.6709 bits (239), Expect = 1.145e-24
Identity = 58/185 (31.35%), Postives = 97/185 (52.43%), Query Frame = 1
Query:   73 SGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDL--VRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQ----YYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPAL 609
            SG ++ ++K+V +G+ G GKT+ + R +   F+  Y AT+G++            IR  +WDTAGQE+F  L   Y    + AII++D+T R +++ +  W  D+   R  EN+ + +VGNK D+ D + +  T    +K  L     + + S K+ YN +  F  IA+ L   P  + +E   L
Sbjct:    4 SGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDER-QISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSL---PEFQNSESTPL 184          
BLAST of GTP-binding nuclear protein vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 95.1301 bits (235), Expect = 3.569e-24
Identity = 54/168 (32.14%), Postives = 90/168 (53.57%), Query Frame = 1
Query:   82 AVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDL-VRVCENIPIVLVGNKVDI----KDRKV-KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
            +V   KLVL+G+   GK++ V R V+ +F +    T+G              ++F +WDTAGQE+F  L   YY   Q A++++DVT   ++    +W ++L  +  ++I I LVGNK+D+     +RKV + +      +K L +++ SAK+  N    FL I  K+
Sbjct:    4 SVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKI 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Yeast
Match: YPT53 (Stress-induced Rab family GTPase; required for vacuolar protein sorting and endocytosis; involved in ionic stress tolerance; similar to Vps21p and Ypt52p; functional homolog of Vps21p; mammalian Rab5 homolog; YPT53 has a paralog, VPS21, that arose from the whole genome duplication [Source:SGD;Acc:S000005037])

HSP 1 Score: 94.7449 bits (234), Expect = 6.598e-24
Identity = 55/167 (32.93%), Postives = 91/167 (54.49%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDL-VRVCENIPIVLVGNKVDI-------KDRKVKAKTI-TFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
             K+VL+G+   GK++ V R V+ +F++    T+G              I+F +WDTAGQE+F  L   YY   Q A+++FDVT+  ++    NW  +L  +V  +I I LVGNK+D+       ++R +KA  +     ++NL Y++ SAK+  N  + F  +  K+
Sbjct:   13 IKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKV 179          
BLAST of GTP-binding nuclear protein vs. Ensembl Nematostella
Match: EDO37375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG05])

HSP 1 Score: 355.525 bits (911), Expect = 2.170e-125
Identity = 168/185 (90.81%), Postives = 175/185 (94.59%), Query Frame = 1
Query:   85 VAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPN 639
            VA FKLVLVGDGGTGKTTFVKRH+TGEFEKKY+ATLGVEVHPL F T+RG I+FNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSR+TYKNVPNWHRDL RVCENIPIVL GNKVDIKDRKVKAK ITFHRKKNLQYYD+SAKSNYNFEKPFLW+ARKLVGDPNLEF EMPAL PPEV MDPN
Sbjct:    8 VATFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLIFFTSRGPIKFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLERVCENIPIVLCGNKVDIKDRKVKAKAITFHRKKNLQYYDLSAKSNYNFEKPFLWLARKLVGDPNLEFVEMPALQPPEVQMDPN 192          
BLAST of GTP-binding nuclear protein vs. Ensembl Nematostella
Match: EDO45332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT62])

HSP 1 Score: 111.694 bits (278), Expect = 4.536e-30
Identity = 55/167 (32.93%), Postives = 93/167 (55.69%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVG 573
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C +++FDVT   ++K + +W  + +     R  EN P V++GNK+D+++R V AK      H K ++ Y++ SAK   N E+ F  IA+  + 
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTQPNSFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRAVSAKRAQAWCHSKNDIPYFETSAKEAINVEQAFQTIAKNALA 175          
BLAST of GTP-binding nuclear protein vs. Ensembl Nematostella
Match: EDO43734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXW7])

HSP 1 Score: 111.309 bits (277), Expect = 9.385e-30
Identity = 54/156 (34.62%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   79 DAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPF 546
            D     K++ +GD   GK+  V+R +   ++ + ++T  + +   E       IR + WDTAGQE+F  +   YY Q    +++FD+T +ITYKN+ NW+++L +  ++IP ++V NK+D+ D KV  K+  F +K  L +Y VSA    N  K F
Sbjct:   20 DKETSVKVICLGDSAVGKSKLVERFLMDGYKPQQLSTYALTLFHYETKVDDKDIRVDFWDTAGQERFSSMHPSYYHQAHACLLVFDITRKITYKNLANWYKELRKYRDSIPCIVVANKIDV-DYKVTQKSFNFPKKYGLPFYFVSASDGTNVVKVF 174          
BLAST of GTP-binding nuclear protein vs. Ensembl Nematostella
Match: EDO44528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV85])

HSP 1 Score: 107.071 bits (266), Expect = 2.938e-28
Identity = 57/166 (34.34%), Postives = 91/166 (54.82%), Query Frame = 1
Query:   70 MSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKV--KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
            M+ D    FKL+++GD G GK++ + R     F   Y+ T+GV+      N    K++  +WDTAGQE+F  +   YY      I+++DVTS  T+ NV  W  ++ + C+++  +LVGNK D   +KV   A    F  + N++ ++ SAK N N E+ F  I +
Sbjct:    1 MARDYDHLFKLLIIGDSGVGKSSLLLRFADNMFSGSYITTIGVDFKIRTINIDGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSADTFVNVKRWLHEIDQNCDDVIRILVGNKDDCPSKKVVETADLQKFGEQMNIRVFETSAKENINVEEIFSSITK 166          
BLAST of GTP-binding nuclear protein vs. Ensembl Nematostella
Match: EDO40980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I3])

HSP 1 Score: 106.686 bits (265), Expect = 4.249e-28
Identity = 50/166 (30.12%), Postives = 95/166 (57.23%), Query Frame = 1
Query:   79 DAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-RVCENIPIVLVGNKVDIKDRKV--KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
            D  A +K++++GD G GKT  + R     F   Y++T+G++      +    +IR  +WDTAGQE+F  L   YY      ++++D+T+  ++K++  W +++      N+  VL+GNK+D +D +V    +  +     NL++Y+ SA++  N ++ F+ +ARK+
Sbjct:   12 DFEATYKILVLGDSGVGKTCLIFRFAEDIFSDSYISTIGIDCRSRVVDLDGQRIRLQIWDTAGQERFRTLTSAYYRGAMGILLVYDITTEDSFKHISQWLQNIEDNASPNVCKVLLGNKLDAEDERVIDAQRGRSVGEDNNLEFYEASARTGENVQQAFMAVARKI 177          
BLAST of GTP-binding nuclear protein vs. Ensembl Medaka
Match: ran (RAN, member RAS oncogene family [Source:NCBI gene;Acc:101156259])

HSP 1 Score: 355.525 bits (911), Expect = 5.743e-125
Identity = 166/185 (89.73%), Postives = 175/185 (94.59%), Query Frame = 1
Query:   85 VAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPN 639
            VA FKLVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL F+T RG I++NVWDTAGQEKFGGLRDGYYIQ QCAIIMFDVTSR+TYKNVPNWHRDLVRVCENIPIVL GNKVDIKDRKVKAK+I FHRKKNLQYYD+SAKSNYNFEKPFLW+ARKL+GDPNLEF  MPALAPPEV MDPN
Sbjct:   11 VAVFKLVLVGDGGTGKTTFVKRHITGEFEKKYVATLGVEVHPLMFHTNRGPIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVLMDPN 195          
BLAST of GTP-binding nuclear protein vs. Ensembl Medaka
Match: rab7a (ras-related protein rab7 [Source:NCBI gene;Acc:101157689])

HSP 1 Score: 112.464 bits (280), Expect = 6.786e-30
Identity = 56/163 (34.36%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C +++FDVT+  T+K + +W  + +     R  EN P V++GNK+D+++R+V  K        K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Medaka
Match: ENSORLT00000021125.2 (RAB7A, member RAS oncogene family [Source:NCBI gene;Acc:101157360])

HSP 1 Score: 112.464 bits (280), Expect = 7.338e-30
Identity = 56/163 (34.36%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
             K++++GD G GKT+ + ++V  +F  +Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C +++FDVT+  T+K + +W  + +     R  EN P V++GNK+D+++R+V  K        K N+ Y++ SAK   N E+ F  IAR
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIAR 171          
BLAST of GTP-binding nuclear protein vs. Ensembl Medaka
Match: rab10 (RAB10, member RAS oncogene family [Source:NCBI gene;Acc:101173671])

HSP 1 Score: 108.612 bits (270), Expect = 2.060e-28
Identity = 56/173 (32.37%), Postives = 100/173 (57.80%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDL-VRVCENIPIVLVGNKVDIKDRKV--KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL-----VGDPNLE 588
            FKL+L+GD G GKT  + R     F   +++T+G++           KI+  +WDTAGQE+F  +   YY      ++++D+++  +++N+  W R++     E++  +L+GNK D++D++V  KAK     R+  +++++ SAK+N N EK FL +A  +     V +PN E
Sbjct:   10 FKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDISNTKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILKKTPVKEPNSE 182          
BLAST of GTP-binding nuclear protein vs. Ensembl Medaka
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:101173484])

HSP 1 Score: 107.071 bits (266), Expect = 9.495e-28
Identity = 55/161 (34.16%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVR-VCENIPIVLVGNKVDIKDRKV--KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
            FKL+L+GD G GK+  + R     + + Y++T+GV+      +     ++  +WDTAGQE+F  +   YY      II++DVT + ++ NV  W  ++ R  CEN+  +LVGNK D+  +KV   A          + + + SAKS+ N EK FL +A ++
Sbjct:    9 FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDMDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTEQESFNNVRQWLEEIDRYACENVSRLLVGNKSDLVSKKVVDAATAQDLASSLKIPFLETSAKSSGNVEKAFLTMASEI 169          
BLAST of GTP-binding nuclear protein vs. Planmine SMEST
Match: SMESG000072522.1 (SMESG000072522.1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.767e-143
Identity = 192/192 (100.00%), Postives = 192/192 (100.00%), Query Frame = 1
Query:   70 MSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 645
            MSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV
Sbjct:    1 MSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWV 192          
BLAST of GTP-binding nuclear protein vs. Planmine SMEST
Match: SMESG000031968.1 (SMESG000031968.1)

HSP 1 Score: 103.219 bits (256), Expect = 1.779e-26
Identity = 49/150 (32.67%), Postives = 82/150 (54.67%), Query Frame = 1
Query:   97 KLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAKSNYNFEKPF 546
            K++ +GD   GK+  V+R +   ++ + ++T  + +   + N    K+  + WDTAGQE++  +   YY Q    I++FDVT +ITYKN+ NW+++L     +IP + V NK+D  D     ++  F  K  + +Y VSA    N  K F
Sbjct:   19 KIICLGDSAVGKSKLVERFLMDGYQPQQLSTYALTLFKYQTNLDGKKLTVDFWDTAGQERYQSMHTSYYYQAHACILVFDVTRKITYKNLDNWYKELREHRPDIPCICVANKID-ADMSATKRSFKFPTKNKMPFYFVSASDGTNVVKAF 167          
BLAST of GTP-binding nuclear protein vs. Planmine SMEST
Match: SMESG000051108.1 (SMESG000051108.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.532e-26
Identity = 56/163 (34.36%), Postives = 93/163 (57.06%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-NIPIVLVGNKVDIKDRK----VKAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
            FK+VL+GD G GKT  V+R  +G F +K  +T+GV+           K++  +WDTAGQE+F  +   YY      I+ +D+T R ++ NV +W  D+ +    NI  +L+GNK D+ +++     +A+ +  HR   L   + SA+ N N ++ F+ +AR+L
Sbjct:   13 FKIVLIGDAGVGKTCVVQRFKSGNFLEKNGSTIGVDFTMKTVVVDGKKVKLQIWDTAGQERFRTITQSYYRSANGVIVAYDITKRESFNNVLHWLEDIKKYAGPNILQILIGNKKDLDEQREVKFTEAQDLA-HRCNMLDSLETSAQENSNIDEVFMKLAREL 174          
BLAST of GTP-binding nuclear protein vs. Planmine SMEST
Match: SMESG000075649.1 (SMESG000075649.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.551e-26
Identity = 50/163 (30.67%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLVGNKVDIKDRKVKAKTIT--FHRKKNLQYYDVSAKSNYNFEKPFLWIAR 561
            FK++++GD G GKT+ + ++V   F   Y AT+G +    E       +   +WDTAGQE+F  L   +Y    C I+++DV+   T+KN+ +W  + +        E  P V++GNK+D+ +R+V  +T         ++ Y++ SAK   N +  F+  A+
Sbjct:   14 FKIIILGDSGVGKTSLLNQYVNKRFNTVYKATIGSDFQAKEVEINEHIVTLQIWDTAGQERFQSLGIAFYRGADCCILVYDVSRIDTFKNLNSWKEEFILQANLTAVEGFPFVVIGNKIDLDNRQVTLRTAQQWCLTNDDIAYFETSAKDAINVDNAFIKAAQ 176          
BLAST of GTP-binding nuclear protein vs. Planmine SMEST
Match: SMESG000049854.1 (SMESG000049854.1)

HSP 1 Score: 102.449 bits (254), Expect = 3.206e-26
Identity = 51/161 (31.68%), Postives = 88/161 (54.66%), Query Frame = 1
Query:   94 FKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEFNTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVC-ENIPIVLVGNKVDIKDRKV--KAKTITFHRKKNLQYYDVSAKSNYNFEKPFLWIARKL 567
            FKL+L+GD G GK+  + R     +   Y++T+GV+            ++  +WDTAGQE+F  +   YY      I+++DVT + ++ NV NW  ++ R   EN+  +L+GNK D+  +KV        F    N+ + + SA+ + N EK F+ +A+++
Sbjct:    9 FKLLLIGDSGVGKSCILLRFADDTYTDSYISTIGVDFKIRTIELDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQTSFNNVKNWLNEIERYANENVNKLLIGNKSDMVSKKVVDSGTAKEFADSLNIPFLETSARDSTNVEKTFITMAQEI 169          
The following BLAST results are available for this feature:
BLAST of GTP-binding nuclear protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAN2.527e-12488.30RAN, member RAS oncogene family [Source:HGNC Symbo... [more]
RAN2.527e-12488.30RAN, member RAS oncogene family [Source:HGNC Symbo... [more]
RAN1.629e-12184.92RAN, member RAS oncogene family [Source:HGNC Symbo... [more]
RAN2.766e-12188.11RAN, member RAS oncogene family [Source:HGNC Symbo... [more]
RAN2.620e-12080.98RAN, member RAS oncogene family [Source:HGNC Symbo... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ran-11.787e-12687.43GTP-binding nuclear protein ran-1 [Source:UniProt... [more]
rab-76.022e-3133.89RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146][more]
rab-76.022e-3133.89RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146][more]
rab-51.662e-2734.76RAB family [Source:UniProtKB/TrEMBL;Acc:P91857][more]
F11A5.41.933e-2736.00pep chromosome:WBcel235:V:16195679:16196290:1 gene... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ran5.138e-12486.84gene:FBgn0020255 transcript:FBtr0340164[more]
Ran5.138e-12486.84gene:FBgn0020255 transcript:FBtr0073471[more]
Ran5.138e-12486.84gene:FBgn0020255 transcript:FBtr0073472[more]
Ran5.138e-12486.84gene:FBgn0020255 transcript:FBtr0340165[more]
Ran-like5.169e-8465.36gene:FBgn0036497 transcript:FBtr0075616[more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ran1.274e-12490.11RAN, member RAS oncogene family [Source:NCBI gene;... [more]
ran1.274e-12490.11RAN, member RAS oncogene family [Source:NCBI gene;... [more]
ran1.274e-12490.11RAN, member RAS oncogene family [Source:NCBI gene;... [more]
rab7a9.089e-3034.36RAB7a, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab7a9.089e-3034.36RAB7a, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ran1.686e-12488.30RAN, member RAS oncogene family [Source:NCBI gene;... [more]
rab7a3.488e-3034.97RAB7A, member RAS oncogene family [Source:NCBI gen... [more]
rab302.967e-2833.94RAB30, member RAS oncogene family [Source:NCBI gen... [more]
rab5a4.588e-2732.74RAB5A, member RAS oncogene family [Source:NCBI gen... [more]
vasp4.807e-2731.74vasodilator stimulated phosphoprotein [Source:Xenb... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ran1.735e-12488.30RAN, member RAS oncogene family [Source:MGI Symbol... [more]
Ran1.735e-12488.30RAN, member RAS oncogene family [Source:MGI Symbol... [more]
1700009N14Rik1.274e-12086.17RIKEN cDNA 1700009N14 gene [Source:MGI Symbol;Acc:... [more]
Rasl2-91.105e-11782.98RAS-like, family 2, locus 9 [Source:MGI Symbol;Acc... [more]
Rab79.705e-3034.36RAB7, member RAS oncogene family [Source:MGI Symbo... [more]
back to top
BLAST of GTP-binding nuclear protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38542|RAN_BRUMA1.221e-12688.48GTP-binding nuclear protein Ran OS=Brugia malayi O... [more]
sp|O17915|RAN_CAEEL2.273e-12587.43GTP-binding nuclear protein ran-1 OS=Caenorhabditi... [more]
sp|P52301|RAN_XENLA8.738e-12488.30GTP-binding nuclear protein Ran OS=Xenopus laevis ... [more]
sp|P42558|RAN_CHICK8.738e-12488.30GTP-binding nuclear protein Ran OS=Gallus gallus O... [more]
sp|P79735|RAN_DANRE9.620e-12490.11GTP-binding nuclear protein Ran OS=Danio rerio OX=... [more]
back to top
BLAST of GTP-binding nuclear protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GL751.287e-12590.91GTP-binding nuclear protein (Fragment) OS=Macrosto... [more]
A0A267G1T71.312e-12590.91GTP-binding nuclear protein (Fragment) OS=Macrosto... [more]
A0A1I8HZD42.789e-12590.91GTP-binding nuclear protein OS=Macrostomum lignano... [more]
A0A0N5CX981.442e-12488.48GTP-binding nuclear protein OS=Thelazia callipaeda... [more]
A0A4Z2DXJ01.527e-12490.37GTP-binding nuclear protein OS=Schistosoma japonic... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ran2.409e-12588.24RAN, member RAS oncogene family [Source:NCBI gene;... [more]
rab7a7.703e-3034.36ras-related protein rab7 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000041258.12.216e-2933.13RAB7A, member RAS oncogene family [Source:NCBI gen... [more]
rab7b4.906e-2933.13ras-related protein rab7-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000002303.26.674e-2933.13RAB7A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ran1.784e-10288.96RAN, member RAS oncogene family [Source:NCBI gene;... [more]
rab301.097e-3137.16RAB30, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5c1.821e-2833.33RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000000009.12.206e-2733.33pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1... [more]
rab5c1.669e-2632.99RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GSP23.269e-11785.25GTP binding protein (mammalian Ranp homolog); invo... [more]
GSP15.577e-11785.25Ran GTPase; GTP binding protein (mammalian Ranp ho... [more]
YPT61.145e-2431.35Rab family GTPase; required for endosome-to-Golgii... [more]
VPS213.569e-2432.14Endosomal Rab family GTPase; required for endocyti... [more]
YPT536.598e-2432.93Stress-induced Rab family GTPase; required for vac... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373752.170e-12590.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453324.536e-3032.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437349.385e-3034.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445282.938e-2834.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409804.249e-2830.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ran5.743e-12589.73RAN, member RAS oncogene family [Source:NCBI gene;... [more]
rab7a6.786e-3034.36ras-related protein rab7 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000021125.27.338e-3034.36RAB7A, member RAS oncogene family [Source:NCBI gen... [more]
rab102.060e-2832.37RAB10, member RAS oncogene family [Source:NCBI gen... [more]
zgc:1719279.495e-2834.16ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
back to top
BLAST of GTP-binding nuclear protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072522.12.767e-143100.00SMESG000072522.1[more]
SMESG000031968.11.779e-2632.67SMESG000031968.1[more]
SMESG000051108.12.532e-2634.36SMESG000051108.1[more]
SMESG000075649.12.551e-2630.67SMESG000075649.1[more]
SMESG000049854.13.206e-2631.68SMESG000049854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030013 ID=SMED30030013|Name=GTP-binding nuclear protein|organism=Schmidtea mediterranea sexual|type=transcript|length=837bp
TAAAATTGAATTTGTTTGTCTTTGTTGTTTAATCACACATTTTAAATAAG
TCTGAACTGTTTTAAAAAGATGTCTGGTGATGCCGTAGCTCAGTTTAAAC
TGGTATTAGTTGGTGACGGTGGAACAGGCAAAACTACTTTTGTAAAGAGA
CATGTTACAGGAGAATTTGAAAAGAAATATGTCGCCACACTTGGAGTTGA
AGTTCATCCTTTGGAGTTCAATACGACTCGTGGAAAAATTCGTTTCAATG
TCTGGGATACTGCAGGCCAAGAAAAGTTTGGAGGTCTTAGAGATGGATAC
TATATTCAAGGCCAATGTGCTATCATTATGTTTGATGTAACTAGTCGTAT
TACATATAAAAATGTACCGAATTGGCATCGAGATTTAGTTAGGGTATGTG
AAAACATCCCTATTGTTCTCGTAGGTAATAAGGTGGATATTAAAGATAGA
AAGGTTAAGGCTAAGACAATTACCTTTCATAGAAAGAAGAATTTACAATA
TTACGATGTCTCTGCTAAGTCTAATTATAACTTTGAAAAACCATTTTTAT
GGATTGCTCGCAAATTGGTTGGAGATCCAAATCTCGAATTTGCTGAAATG
CCTGCCTTGGCACCTCCTGAAGTTCCAATGGATCCAAACTGGGTAGCTCA
ATGCGAAGCTGAAATCCAACAGGCTGCAGCTGCTCCATTGCCTGATGAGG
ATGAAGACTTGTGAAAATAAATTTTGTGTTGAATAATAATTGATTTATAG
TTCGTTATTTTTATGACTTATTGCAAGTAATTATTTTTCCGACATTTTTT
TATTTATTAAATACTGTTGTTTAAATAATCTATTTTG
back to top

protein sequence of SMED30030013-orf-1

>SMED30030013-orf-1 ID=SMED30030013-orf-1|Name=SMED30030013-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MSGDAVAQFKLVLVGDGGTGKTTFVKRHVTGEFEKKYVATLGVEVHPLEF
NTTRGKIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVP
NWHRDLVRVCENIPIVLVGNKVDIKDRKVKAKTITFHRKKNLQYYDVSAK
SNYNFEKPFLWIARKLVGDPNLEFAEMPALAPPEVPMDPNWVAQCEAEIQ
QAAAAPLPDEDEDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR002041Ran_GTPase
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0006913nucleocytoplasmic transport
GO:0007264small GTPase mediated signal transduction
GO:0006886intracellular protein transport
GO:0007165signal transduction
GO:0006810transport
GO:0015031protein transport
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002041Ran GTPasePRINTSPR00627GTPRANTC4coord: 163..185
score: 74.08
coord: 22..36
score: 89.23
coord: 125..143
score: 81.78
coord: 69..87
score: 89.88
coord: 89..110
score: 85.49
IPR002041Ran GTPasePANTHERPTHR24071FAMILY NOT NAMEDcoord: 5..214
IPR002041Ran GTPasePROSITEPS51418RANcoord: 2..166
score: 30.425
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 9..169
e-value: 1.7E-31
score: 120.6
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 6..169
e-value: 2.1E-12
score: 56.9
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 14..214
e-value: 8.4E-157
score: 536.9
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 11..169
e-value: 3.8E-9
score: -1.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 3..214
e-value: 1.9E-66
score: 225.2
NoneNo IPR availablePANTHERPTHR24071:SF17GTP-BINDING NUCLEAR PROTEIN RANcoord: 5..214
NoneNo IPR availableCDDcd00877Rancoord: 9..174
e-value: 4.99718E-132
score: 365.856
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 8..157
e-value: 1.9E-25
score: 87.5
IPR001806Small GTPasePFAMPF00071Rascoord: 10..166
e-value: 6.2E-51
score: 172.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 8..192