Rootletin

Overview
NameRootletin
Smed IDSMED30030007
Uniprot Best hitRootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2 (E=0)
Length (bp)6612
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rootletin (SMED30030007) t-SNE clustered cells

Violin plots show distribution of expression levels for Rootletin (SMED30030007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rootletin (SMED30030007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rootletin (SMED30030007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Rootletin ( H.2.8b, crocc ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the proximal tubule, Category 5 cell, integumental system, renal system, protonephridia and epidermis

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30030007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030007SMESG000071494.1 SmedASXL_016248SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
protonephridiaSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
protonephridiaSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
epidermisSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
epidermisSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
epidermisSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
pharynxSMED30030007SMESG000071494.1 dd_Smed_v6_1404_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030007SMESG000071494.1 dd_Smed_v6_1404_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030007SMESG000071494.1 dd_Smed_v6_1404_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30030007SMESG000071494.1 dd_Smed_v4_1404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:19852954
Glazer et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal stripeSMED30030007SMESG000071494.1 SMED30030007smed_20140614PMID:19852954
Glazer et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rootletin vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 706/1937 (36.45%), Postives = 1145/1937 (59.11%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKM--QFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXX-AKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS---------------------GLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINS-RHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE   YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE ++  + G+ E ++ +              +   + DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++         ++++A  +  ED E + Q LR+++Q VL+DS+            DA +     +        PRR+      S     +P  +D+ T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +                     GL+  L  +EQ    L  +    R                      E+  L EQ+  L RQ S   +EL Q RRE +R   ++   ++EKE L KE   L VQ+ A ERE R  SE    L  ++E LE +L++ Q+ + QLE R+EQLE E Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL +  E+     E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H  EV+ L    +DL   +D  L+E  +L T L++ E+ RD LRRE++E  RKL+E++E +E  ++E  EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E      +E  ELR  L++VE++RL+ +RELQELRR +K LD+E  +L +E+ +LQ R+A  E  E E+RRE  GL+Q++++ EAS E +R++L  AQR + + E   ++++R     +E +R   ++  D    L+   +   A+  EL + LS AEGR   LE+ +ARVE  ++  E +L  + S+LRR +G  +      R    S +                              G+G   P T   S   +  S  P+    +P D++PEAVR ALREF+Q+L  A+R+RD+   Q  +L  +L E E + + A +R +QLQ+A+ ++EE ++ +DGRLS  Q  L +QEE++RR+ER+R+A  ++++  +R+  + ESE R  +++++K + ++ +LE + ++ K+ ++ +E+R  +L+L +RSLEG+LQR ++ L+D+E + + L DRV+SL +Q+ D E K+ +LQLT++R++ ALAK EE     +DK++ L  +L+  S  L   ++K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ ++ D E +R E EG  +Q   ++ QRQE E       QKL  E+  LQER+ S+QR LA  EAEK+E+ ++  +LEKDR AL+++L KVER+KL++ E   +   E+  LD+ L   E E  E QRQ+  L+ Q+   EQ+H    +E+++ + + E+  E+E LR++  Q ERTLE RERAHRQRV+GLEEQ+STLK QL  E++R
Sbjct:  135 RGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKRCSELEQQLLERSGELEQQRLR--------------DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLR---------LQEQAA-LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRH---------------------ERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGLGRAPSPAPRPVPGSPA----------------------RDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASP-DLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSATSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQRVRGLEEQVSTLKGQLQQELRR 2003          
BLAST of Rootletin vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 567.385 bits (1461), Expect = 1.478e-172
Identity = 450/1264 (35.60%), Postives = 731/1264 (57.83%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXX-AKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS---------------------GLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGF 4100
            DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++         ++++A  +  ED E + Q LR+++Q VL+DS+            DA +     +        PRR+      S     +P  +D+ T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +                     GL+  L  +EQ       ++A+++Q               L  L  E+  L EQ+  L RQ S   +EL Q RRE +R   ++   ++EKE L KE   L VQ+ A ERE R  SE    L  ++E LE +L++ Q+ + QLE R+EQLE E Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL +  E+     E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H  EV+ L    +DL   +D  L+E  +L T L++ E+ RD LRRE++E  RKL+E++E +E  ++E  EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E      +E  ELR  L++VE++RL+ +RELQELRR +K LD+E  +L +E+ +LQ R+A  E  E E+RRE  GL+Q++++ EAS E +R++L  AQR + + E   ++++R     +E +R   ++  D    L+   +   A+  EL + LS AEGR   LE+ +ARVE  ++  E +L  + S+LRR +G 
Sbjct:   74 DLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLR---------LQEQAA-LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQ------AQEALEQQ---------------LPTLRHERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGL 1306          
BLAST of Rootletin vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 301.982 bits (772), Expect = 2.065e-85
Identity = 235/671 (35.02%), Postives = 390/671 (58.12%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKM--QFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVX-XXXXXXXXXXXXXXXXXXXXAKTPPFAD-ATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS 2105
            +GL++ ++ELR++L+EE   YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE ++  + G+ E ++ +              +   + DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++  + A           +  ED E + Q LR+++Q VL+DS+            DA +     +  +   SP  R +     + R   +P  +D +T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +
Sbjct:   29 RGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKRCSELEQQLLERSGELEQQRLR--------------DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAA----------LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEAT 675          

HSP 2 Score: 69.707 bits (169), Expect = 5.751e-11
Identity = 43/98 (43.88%), Postives = 73/98 (74.49%), Query Frame = 3
Query: 2790 ENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDK 3083
            E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+
Sbjct:  740 EAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDR 837          
BLAST of Rootletin vs. Ensembl Human
Match: CROCC2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:HGNC Symbol;Acc:HGNC:51677])

HSP 1 Score: 265.388 bits (677), Expect = 1.311e-70
Identity = 331/1177 (28.12%), Postives = 613/1177 (52.08%), Query Frame = 3
Query: 1488 EIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEEL-NDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQE-ALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERD-DMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQ--SLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRH-------HDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKE-------TETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRM 4961
            E E+LR   +    E  + + +  +   E++ LE +   L  + +    E + L++   ELQR      + +E+     ER  +  E  Q  +  LE+K+S  +E++ + +EA++  QL+++V+  E++ +  AL+R E S A+LE+ V + ++  V   ++++ +++ +E L  DK A NH  + QLE ER  L  +++ LEQE++   ++L ++EQ+ AL  +  + +Q Q   +LE   E+LE + + L REK  L EQ+G +  QK AL E+L Q  ++ E    ++    + K+ L++E+ +L+ +  A ER+ R  +E  A L  +R+ LE++L +AQQL  +L   +EQLE E +   + ++ L  E+ +L+ +++++  K+     +L  +  Q ++E + A++ +  +H E + +L +  E+       E+E  + R  +E++ +++     E++ +  EI ++++ERD+SLL  E++ QQ  +LSL E E+  ++E       EL      L+R+++E+ ++QEQ +  I+  + ELK+ ++QFED    H+ E  +L   ++DL   +    +E   L   L +A+E    LR+E+  +        E++E L RE  E +R L +E REK+ ++  N  LR  I   E E+    R   + +QK+ + +E     +QE + LR +L ++E+A  D ++EL+EL R ++ L  E  + + E ++LQ + +++             L+++  + EA  E  RK++   QR + ++E   ++  +     +  SR   + L    +S+ +         + L+  L  A  R+ +LE  +A+ EGA+++ E +L  + S+LRR +G ++++      +  S                   TKG D++ A       SP  R   P S  R  S +P       +D+    V+  LR+FVQ+L +A+R+RDD+  Q  +L SRL E E +   A++R+ QLQ+AL +AEE ++ ++G LSSA+ A  +Q+E +RR E +  A          +  +   EKR+L+++L   R        H   L ++ K  ++ + N E+R    Q A+ SLE  L++M+     +E        E E LD  +NSL +++     ++Q LQ  +  M
Sbjct:  461 EREALRGQLEAQRLEVQQCRASCKLLGREKAALEMVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRERSCRALETSQGRLQQLEEKVSGLREELASVREALSTAQLQRDVVESEREGLRSALARAECSNADLELLVRRLKSEGVEQRDSLAAMAALMEGLAQDKSALNHLAL-QLEQERDQLREQRKTLEQERARAGEQLAQAEQQLALERAERRGLQ-QACGRLEQRQEQLEGQAALLGREKAQLQEQVGQVTCQKQALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQEALERQGRLAAEEAADLRVERDSLESSLLEAQQLATKL---QEQLEEEARSAGLARQALQVEMEQLQSDWEVQEMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKE--VARCQLEQEKELVTKSAAEREALKGEIQSLKQERDESLLQLEHKMQQVMALSLKETERSLLSE-------ELSRARRTLERVQQEAQSQQEQAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLAAERGDVEREAERLRAQLTVAQEGLAALRQELQGVE-------ESREGLHREAQEARRALSDEAREKDVLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILEEAQAALQQEASALRAHLWELEQAGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEV----------LELRRQAAKAEAKHEGARKEVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRAELHSVTRKLQEASGVADALQARLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQSPWASPEQPGSP------------------TKGSDSSQALPGQQGTSPPAR---PHSPLRWPSPTPGGRSSELMDVA--TVQDILRDFVQKLREAQRERDDSRIQMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLA----------SVRAAGQEKRRLQEQLETLRQALEESRRHSQGLAKQGKLLEEQLTNLEHRC---QKAEVSLE-PLRQMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEM 1569          

HSP 2 Score: 84.3445 bits (207), Expect = 2.599e-15
Identity = 66/209 (31.58%), Postives = 105/209 (50.24%), Query Frame = 3
Query:  432 NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL 1058
            ++DLE  L +LE  ++++  L + N  L+EQL    ++N  L R+++ ++   QR + ELE R   W   +         +  +L  L R  +       EL+ +TER + +L+ +  R AR L TAC NL  N++       LS    S     L  QLR+K  E+   Q R++ E   LQ R+ E T+L +KL  QN +K + + AL
Sbjct:  147 SVDLEEALGRLEAAEERSTGLCQVNALLREQLEHMKKANDALGRELAGMTGSVQRLQGELELRR--WAQRQTRSGGL--GQPRDLLLLWRQAVVLGTDLAELRVATERGLADLQADTARTARRLHTACLNLDSNLR-------LSA---SSTASTLGQQLRDKAGEMLQLQGRWDAEKVALQARLSEQTLLVEKLTEQNEQKAKTIAAL 341          

HSP 3 Score: 62.3882 bits (150), Expect = 1.399e-8
Identity = 84/278 (30.22%), Postives = 143/278 (51.44%), Query Frame = 3
Query: 5010 KMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQ-NNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            +M  L+  LS    +  + Q+++ QLQKAL  +E+ +R +E  L S++ A    K     L +E +  +++     E RR     L  Q  TL    ++A +E  +  Q L  +   L+E++ +++        +K E+      LE  R        ++E++ LK EE  ++   E+ +LDQ L  L  E     RQ   LQ Q+ E EQAH   L ++ ++H+++++ E E L  +  Q  + LE +E  H+Q+VK LEEQ+++LK+QL  E+Q R
Sbjct: 1390 QMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLASVRA--AGQEKRR-----LQEQLETL----RQALEESRRHSQGLAKQGKLLEEQLTNLEHR-----CQKAEV-----SLEPLR--------QMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQEWTHQQQVKVLEEQVASLKEQLDQEVQWR 1638          
BLAST of Rootletin vs. Ensembl Human
Match: CEP250 (centrosomal protein 250 [Source:HGNC Symbol;Acc:HGNC:1859])

HSP 1 Score: 203.756 bits (517), Expect = 1.863e-51
Identity = 269/1011 (26.61%), Postives = 506/1011 (50.05%), Query Frame = 3
Query:  309 YKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNL----------ENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL-QRIKNGDTAGEINMEDKAT--RVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELN-DKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIME 3299
            Y+  C ELE +++           G P    + +  E   D L     L++LEEEQ++   L E N +L+  + +A   N+ L  D+ KL+ +W R+R+EL ++E  W+ E+  F  YL  EH  L +L R  + FRR F+E+K++T+R++  LK E  R +  L T C  L+   +S E     S   + R+   L          E +  E+++EL   +++ + E  ELQ RV EL+ L  + + QN + ++ + AL + ++  +T     ME +A+  R   E+  S+ Q +++I+QV++ + D   A+ +G E   + + S   + +               AD     V+S + ++   +Q+L+ +L   +E+    ++Q D  E E +       A+R  ++ L  ++D    +    +  ++  S ER  L+K R  L  Q+E    E  RL+  N ELQ   ++ + ++E+ +++L   ++E ER Q  +  LE K S    +++  +EA+    LE E+L QE+ E+  AL+R E S AEL    N  +T   +L     KLS+  E L  DK   N + + QLE E  S+ +     EQ ++ L+ +L  +E+    L  +      ++++ E     L+ +L ++  EK ++ +++   + Q+ A   +L Q  +E +R    +    +EKE L +EK  L V++ A ER+ +  +E +  L+S +E LE++L++AQQ    +E  K QLE + Q +   KE + GE+  L+ E   E  +    R+    +  Q ++E K A++Q++ +H ++V +L +  E  R   + E  + +   ++ER+ M    E   +E   E+  IQ +R++    AE+   Q     E+E+ ++ E L++TQ EL     +L+R++++   ++ ++++    L ++L+  + + ++  + H  ++ +L      L   K    K+V DL + L   ++++  + +E+ E
Sbjct:   66 YRSWCQELEKRLEA---------TGGPIPQRWENVEEPNLDEL-----LVRLEEEQQRCESLAEVNTQLRLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNG--SGRMDGREPAQLLLLLAKTQELEKEAHERSQELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNEDYEKMIKALRETVEILETNHTELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNI-AQGSGHENSLELDSSIFSQFDYQD------------ADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQQQHDQWEEEGK-------ALRQRLQKLTGERDTLAGQTVDLQGEVDSLSKERELLQKAREELRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVKLSALNEALALDKVGLNQQLL-QLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALE--SLEREKM--ELEMRLKEQQTEMEAIQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQE 1035          
BLAST of Rootletin vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:UniProtKB/TrEMBL;Acc:H2L0I3])

HSP 1 Score: 91.6633 bits (226), Expect = 7.485e-18
Identity = 113/457 (24.73%), Postives = 230/457 (50.33%), Query Frame = 3
Query: 4479 ENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFR------HHDARL---EEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNM-SLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQL 5819
            E R + ++  L DAEE+++ ++ RL SA+T L  QEE +++ + +R+ M  K+   +      E++ R L ++L   R      H D R    +EE   S +          QL+   R  + D  + ++ +   E+E ++L +++  L   ++  + K Q ++   D++   L K E   S   +  + +++ S ++H  QL  L++++   Q  L  +   ++ LE  L + +  + + K + + +  R+  +Q  L D+   ++ +E        ++   +  E +L Q+ +   +EK    + +  ++R LA  E E++   +     +K++  L K +  +E +K +T+    +T  +R  +++ L  +E EN EL +    LQ Q+A+ E  + + ++E+ ++ R+E   ++  +R    QIE+ +E RER HR R+K LE+QI+ L+DQL
Sbjct: 1778 ETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTDIRSLRDKEEQWDSSRF---------QLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAE---SVENELRKTIDIQSKTSHEYQL--LKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQL 2220          
BLAST of Rootletin vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:UniProtKB/TrEMBL;Acc:H2L0I3])

HSP 1 Score: 91.6633 bits (226), Expect = 7.485e-18
Identity = 113/457 (24.73%), Postives = 230/457 (50.33%), Query Frame = 3
Query: 4479 ENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFR------HHDARL---EEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNM-SLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQL 5819
            E R + ++  L DAEE+++ ++ RL SA+T L  QEE +++ + +R+ M  K+   +      E++ R L ++L   R      H D R    +EE   S +          QL+   R  + D  + ++ +   E+E ++L +++  L   ++  + K Q ++   D++   L K E   S   +  + +++ S ++H  QL  L++++   Q  L  +   ++ LE  L + +  + + K + + +  R+  +Q  L D+   ++ +E        ++   +  E +L Q+ +   +EK    + +  ++R LA  E E++   +     +K++  L K +  +E +K +T+    +T  +R  +++ L  +E EN EL +    LQ Q+A+ E  + + ++E+ ++ R+E   ++  +R    QIE+ +E RER HR R+K LE+QI+ L+DQL
Sbjct: 1778 ETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTDIRSLRDKEEQWDSSRF---------QLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAE---SVENELRKTIDIQSKTSHEYQL--LKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQL 2220          
BLAST of Rootletin vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:UniProtKB/TrEMBL;Acc:H2L0I3])

HSP 1 Score: 91.2781 bits (225), Expect = 7.975e-18
Identity = 113/457 (24.73%), Postives = 230/457 (50.33%), Query Frame = 3
Query: 4479 ENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFR------HHDARL---EEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNM-SLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQL 5819
            E R + ++  L DAEE+++ ++ RL SA+T L  QEE +++ + +R+ M  K+   +      E++ R L ++L   R      H D R    +EE   S +          QL+   R  + D  + ++ +   E+E ++L +++  L   ++  + K Q ++   D++   L K E   S   +  + +++ S ++H  QL  L++++   Q  L  +   ++ LE  L + +  + + K + + +  R+  +Q  L D+   ++ +E        ++   +  E +L Q+ +   +EK    + +  ++R LA  E E++   +     +K++  L K +  +E +K +T+    +T  +R  +++ L  +E EN EL +    LQ Q+A+ E  + + ++E+ ++ R+E   ++  +R    QIE+ +E RER HR R+K LE+QI+ L+DQL
Sbjct: 1705 ETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTDIRSLRDKEEQWDSSRF---------QLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAE---SVENELRKTIDIQSKTSHEYQL--LKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQL 2147          
BLAST of Rootletin vs. Ensembl Fly
Match: Root (gene:FBgn0039152 transcript:FBtr0339245)

HSP 1 Score: 325.865 bits (834), Expect = 3.312e-89
Identity = 489/2036 (24.02%), Postives = 1003/2036 (49.26%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYG-------SPTNNGYGSRS-------------------ENPYDNLDLESTLI------------KLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTG----FETVXXXXXXXXXXXXXXXXXXXXXAKTP---------PFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQL--NCRYQQMDKEYKMA-----IQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRS-------QFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEG------LNRQSN-----TLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSL-------GKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLA--EAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM 6008
             LL+ N ELR+RL +E + YRR+L  ++ +Q  QA LV RLQ K+ QY+++C++LE +M    +ET K   G        PTN    S S                       D +D    L+            KLEEE ++   +   N  L++QL ++ ++N+ LT D+ KL+ +W   R+EL  +E  ++ EE +F DY  SEH+ L  + R  +  +R F E++ + + E+  +  E N   + +  + + ++  ++ A+       ++  R    L+NQL          + +YE    E+  R + L  L ++LK                K  D   +   +        ++ E ++ ++R I+Q V+ D++  D    AE TG       + ++  S       + S      K+P          FA+ T +AVQ+A++K  L + +++ K  ++ E+    K Q++ +E  ++ L  ++  + ++++S      +  +E +  +  L+    ++ Q E  R+ +N   E   ++ E+++    +LQ+  +++E++++  + +++R +K+    + ++   ED+ SR +E+ ++ +E +N+  L +++L Q++ E  + ++  E  K++LE +++K    + +L+E   KLS+     +D+       +++ + ER  L  +      E   LK EL   ++  L L  +     ++++ L++  E++ ++L+ + R++ D+  Q+  + R+K AL EEL++ R+ LE++  + + L++  E + K+  E  V +   E++  + +E++A+L S++E LE+ L+D    +   E R+ QLE + QE +V++E+L   + RL++E +    K   ++ QL    R  + D   K+A      ++    H E++ +L       R+  E   ++ +      +DD I+  ++    +   + ++ ++ +++L+ AE+EKQQ+L +  ++K A+ E+L     +L++ +  LDR ++E++ R E+ +  IA L  E+   R+       + E+  +  E+++ SL    + L  + +       +L   +++ E+  ++   E+ +  RK KE E   + L++E+ + +R L +   E++    SN+ LR  +K VE+ + +  R + ++ QK++  ++   + + E   L   LK+ E       ++L   +  +++   E  +  +   +LQ ++  + E ++ A++E   +K+++ + EA+  A R++L  A+      E+   +++++ +  +E  R   ++L D +++L+           EL+  L GAEGR+ AL+  ++ VE  K++ E KL+S+  +LRR+ G + +  V +  R  S                   ++ F            SP    G         +RS S C   P+D++P+ VR  +R  + Q+   ER++DD  +Q  + + +L++  +Q    + +L +LQ  L + +E+K  ++       +A+   EE ++    + + + E+L+  +   A+   E  Q E+RL K R   ++L+ E +Q ++ +   E R ++L+L + ++EGDL R++MAL +K+     + +R+ +  + +  LE +  +L+ T+D++   L K+    +  + +++ L   LS      +  ++K+  +QK+L ++E ++R+L ERL+S++  L+E +      ++  Q +Q  + D E +RS LE        N++S      T        E+EL+++ +    EK+ L+ ++ ++Q  +   E +++   K  G    DR+    S        G+ +  +       +        LD  +  +E E  +L+ +V  L+  LA  E+E A C   M  N   +    ++ +  R++ +  E+ L+ RE++HRQ+V  LE QIS L++QL  E +RR    Y   + K+N+      LR  L  SL  V++ P +D  LLE+E+RRLD ++ M
Sbjct:   90 ALLRQNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERM----HETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVD--DVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEINCVGKDINGSNATVAFAVQQAKRAADDELKQSQRSNDELQNQL-------ATLKVQYESARHEIMERDQRLLELMNQLK----------------KLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREADAEVTGGVMQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVVIDLHEKDTHRLNELLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKIANLQACAEEAAKRHGEEILQL-------RNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSE-------ELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQNNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGIQVDGSVNLSHRLLSP------------------SRRF------------SPSRSCGDYD------NRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRKMKISAIQALEEKLKHRNDECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLRIAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKS--KFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYDVGGGNAGGGSFNCGLDHSV--IEQETRDLRLKVRRLETLLAEKESELARCKARM--NDSAKCHDGLDGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQ--YILRSSKANR--EMQHLRSTLGDSLRNVSQHP-VDPHLLESESRRLDSAVSM 2035          
BLAST of Rootletin vs. Ensembl Fly
Match: Root (gene:FBgn0039152 transcript:FBtr0339244)

HSP 1 Score: 325.865 bits (834), Expect = 3.312e-89
Identity = 489/2036 (24.02%), Postives = 1003/2036 (49.26%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYG-------SPTNNGYGSRS-------------------ENPYDNLDLESTLI------------KLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTG----FETVXXXXXXXXXXXXXXXXXXXXXAKTP---------PFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQL--NCRYQQMDKEYKMA-----IQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRS-------QFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEG------LNRQSN-----TLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSL-------GKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLA--EAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM 6008
             LL+ N ELR+RL +E + YRR+L  ++ +Q  QA LV RLQ K+ QY+++C++LE +M    +ET K   G        PTN    S S                       D +D    L+            KLEEE ++   +   N  L++QL ++ ++N+ LT D+ KL+ +W   R+EL  +E  ++ EE +F DY  SEH+ L  + R  +  +R F E++ + + E+  +  E N   + +  + + ++  ++ A+       ++  R    L+NQL          + +YE    E+  R + L  L ++LK                K  D   +   +        ++ E ++ ++R I+Q V+ D++  D    AE TG       + ++  S       + S      K+P          FA+ T +AVQ+A++K  L + +++ K  ++ E+    K Q++ +E  ++ L  ++  + ++++S      +  +E +  +  L+    ++ Q E  R+ +N   E   ++ E+++    +LQ+  +++E++++  + +++R +K+    + ++   ED+ SR +E+ ++ +E +N+  L +++L Q++ E  + ++  E  K++LE +++K    + +L+E   KLS+     +D+       +++ + ER  L  +      E   LK EL   ++  L L  +     ++++ L++  E++ ++L+ + R++ D+  Q+  + R+K AL EEL++ R+ LE++  + + L++  E + K+  E  V +   E++  + +E++A+L S++E LE+ L+D    +   E R+ QLE + QE +V++E+L   + RL++E +    K   ++ QL    R  + D   K+A      ++    H E++ +L       R+  E   ++ +      +DD I+  ++    +   + ++ ++ +++L+ AE+EKQQ+L +  ++K A+ E+L     +L++ +  LDR ++E++ R E+ +  IA L  E+   R+       + E+  +  E+++ SL    + L  + +       +L   +++ E+  ++   E+ +  RK KE E   + L++E+ + +R L +   E++    SN+ LR  +K VE+ + +  R + ++ QK++  ++   + + E   L   LK+ E       ++L   +  +++   E  +  +   +LQ ++  + E ++ A++E   +K+++ + EA+  A R++L  A+      E+   +++++ +  +E  R   ++L D +++L+           EL+  L GAEGR+ AL+  ++ VE  K++ E KL+S+  +LRR+ G + +  V +  R  S                   ++ F            SP    G         +RS S C   P+D++P+ VR  +R  + Q+   ER++DD  +Q  + + +L++  +Q    + +L +LQ  L + +E+K  ++       +A+   EE ++    + + + E+L+  +   A+   E  Q E+RL K R   ++L+ E +Q ++ +   E R ++L+L + ++EGDL R++MAL +K+     + +R+ +  + +  LE +  +L+ T+D++   L K+    +  + +++ L   LS      +  ++K+  +QK+L ++E ++R+L ERL+S++  L+E +      ++  Q +Q  + D E +RS LE        N++S      T        E+EL+++ +    EK+ L+ ++ ++Q  +   E +++   K  G    DR+    S        G+ +  +       +        LD  +  +E E  +L+ +V  L+  LA  E+E A C   M  N   +    ++ +  R++ +  E+ L+ RE++HRQ+V  LE QIS L++QL  E +RR    Y   + K+N+      LR  L  SL  V++ P +D  LLE+E+RRLD ++ M
Sbjct:   90 ALLRQNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERM----HETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVD--DVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEINCVGKDINGSNATVAFAVQQAKRAADDELKQSQRSNDELQNQL-------ATLKVQYESARHEIMERDQRLLELMNQLK----------------KLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREADAEVTGGVMQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVVIDLHEKDTHRLNELLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKIANLQACAEEAAKRHGEEILQL-------RNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSE-------ELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQNNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGIQVDGSVNLSHRLLSP------------------SRRF------------SPSRSCGDYD------NRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRKMKISAIQALEEKLKHRNDECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLRIAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKS--KFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYDVGGGNAGGGSFNCGLDHSV--IEQETRDLRLKVRRLETLLAEKESELARCKARM--NDSAKCHDGLDGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQ--YILRSSKANR--EMQHLRSTLGDSLRNVSQHP-VDPHLLESESRRLDSAVSM 2035          
BLAST of Rootletin vs. Ensembl Fly
Match: Root (gene:FBgn0039152 transcript:FBtr0304161)

HSP 1 Score: 325.865 bits (834), Expect = 3.312e-89
Identity = 489/2036 (24.02%), Postives = 1003/2036 (49.26%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYG-------SPTNNGYGSRS-------------------ENPYDNLDLESTLI------------KLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTG----FETVXXXXXXXXXXXXXXXXXXXXXAKTP---------PFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQL--NCRYQQMDKEYKMA-----IQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRS-------QFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEG------LNRQSN-----TLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSL-------GKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLA--EAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM 6008
             LL+ N ELR+RL +E + YRR+L  ++ +Q  QA LV RLQ K+ QY+++C++LE +M    +ET K   G        PTN    S S                       D +D    L+            KLEEE ++   +   N  L++QL ++ ++N+ LT D+ KL+ +W   R+EL  +E  ++ EE +F DY  SEH+ L  + R  +  +R F E++ + + E+  +  E N   + +  + + ++  ++ A+       ++  R    L+NQL          + +YE    E+  R + L  L ++LK                K  D   +   +        ++ E ++ ++R I+Q V+ D++  D    AE TG       + ++  S       + S      K+P          FA+ T +AVQ+A++K  L + +++ K  ++ E+    K Q++ +E  ++ L  ++  + ++++S      +  +E +  +  L+    ++ Q E  R+ +N   E   ++ E+++    +LQ+  +++E++++  + +++R +K+    + ++   ED+ SR +E+ ++ +E +N+  L +++L Q++ E  + ++  E  K++LE +++K    + +L+E   KLS+     +D+       +++ + ER  L  +      E   LK EL   ++  L L  +     ++++ L++  E++ ++L+ + R++ D+  Q+  + R+K AL EEL++ R+ LE++  + + L++  E + K+  E  V +   E++  + +E++A+L S++E LE+ L+D    +   E R+ QLE + QE +V++E+L   + RL++E +    K   ++ QL    R  + D   K+A      ++    H E++ +L       R+  E   ++ +      +DD I+  ++    +   + ++ ++ +++L+ AE+EKQQ+L +  ++K A+ E+L     +L++ +  LDR ++E++ R E+ +  IA L  E+   R+       + E+  +  E+++ SL    + L  + +       +L   +++ E+  ++   E+ +  RK KE E   + L++E+ + +R L +   E++    SN+ LR  +K VE+ + +  R + ++ QK++  ++   + + E   L   LK+ E       ++L   +  +++   E  +  +   +LQ ++  + E ++ A++E   +K+++ + EA+  A R++L  A+      E+   +++++ +  +E  R   ++L D +++L+           EL+  L GAEGR+ AL+  ++ VE  K++ E KL+S+  +LRR+ G + +  V +  R  S                   ++ F            SP    G         +RS S C   P+D++P+ VR  +R  + Q+   ER++DD  +Q  + + +L++  +Q    + +L +LQ  L + +E+K  ++       +A+   EE ++    + + + E+L+  +   A+   E  Q E+RL K R   ++L+ E +Q ++ +   E R ++L+L + ++EGDL R++MAL +K+     + +R+ +  + +  LE +  +L+ T+D++   L K+    +  + +++ L   LS      +  ++K+  +QK+L ++E ++R+L ERL+S++  L+E +      ++  Q +Q  + D E +RS LE        N++S      T        E+EL+++ +    EK+ L+ ++ ++Q  +   E +++   K  G    DR+    S        G+ +  +       +        LD  +  +E E  +L+ +V  L+  LA  E+E A C   M  N   +    ++ +  R++ +  E+ L+ RE++HRQ+V  LE QIS L++QL  E +RR    Y   + K+N+      LR  L  SL  V++ P +D  LLE+E+RRLD ++ M
Sbjct:   90 ALLRQNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERM----HETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVD--DVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEINCVGKDINGSNATVAFAVQQAKRAADDELKQSQRSNDELQNQL-------ATLKVQYESARHEIMERDQRLLELMNQLK----------------KLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREADAEVTGGVMQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVVIDLHEKDTHRLNELLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKIANLQACAEEAAKRHGEEILQL-------RNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSE-------ELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQNNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGIQVDGSVNLSHRLLSP------------------SRRF------------SPSRSCGDYD------NRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRKMKISAIQALEEKLKHRNDECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLRIAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKS--KFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYDVGGGNAGGGSFNCGLDHSV--IEQETRDLRLKVRRLETLLAEKESELARCKARM--NDSAKCHDGLDGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQ--YILRSSKANR--EMQHLRSTLGDSLRNVSQHP-VDPHLLESESRRLDSAVSM 2035          
BLAST of Rootletin vs. Ensembl Zebrafish
Match: crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:ZFIN;Acc:ZDB-GENE-131121-625])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 604/1911 (31.61%), Postives = 1054/1911 (55.15%), Query Frame = 3
Query:  210 EEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYD---NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLAS-EHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATR-VLIEDTESMHQALRNISQVVLNDS--DYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQ-----SKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIP--RTGSPSSKRRQLSRSPSN---------------CDFNPV-----DINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            EE   YR KL  +Q+SQ +QAQLVQ+LQ K+LQYK++C  LE ++     E+ K +    ++    +     ++   +LD+++ L  L++EQK+ + L++ N  L+EQL QA ++NQ LT       E  Q++R+E EQR+   R E +  N    S E   +++L R     R  F +L+A  +R +++L+ E+   +  L+ AC NL       E+ +  S    S     LE QLR+K RE    Q R++ E  EL  R+ EL  +  +L+ QN EK+  L AL+   N +       ED+A R  L  +  S+HQ L NI+QVV  +   D     +  F +    + S                +  P       AVQ A+ ++  Q ++L++ L +S+E     ++Q+   E++ R LE ++  ++ E + L R ++DS R+A+R++N+L I ++E+ +LE+  S++  Q+E   TE E L+S++ ++QR R+ L  ++ED ++ L R+  ESER + +++ LE + S  ++++V  KEA+++  L+KEVL  E   +  ALS+ E   AE E+ + K ++ +  L+++++K+ +  E L   + E +R + Q E E++ L   +R  E E+   ++EL R +QE L L+ EK         L+     L+ E + L REK  + EQ     +QK A+ E+L  C RE+E S   +    KE++ L ++K  L VQ+T+ +R+++  ++ +A+L ++RE LE++L D Q+L   LE  +++L+GEN  L    ++L  EL  ++ E + +  + +  ++ L  +  Q ++  +  +   + SH E +    K  E        +RE+   +   E  ++     +  Q++ +++  +Q+   +SLL AE+ KQQ LS  E EK  + E++I  + ++++   E DR++++  ++QEQDK   +GL +EL + RS+FE+   + E+  +SLN  I++L+     A +E   L   L   EE+RD  R+E++E +R+L+E  + K+  +RE  +LKR L +  REKE +  SN  LR  +K VE E   L R   +  Q++ V +E   + +QEV +LR N++++EK+RL  +RELQELRR +K L+ +  +  +E++D+Q R+ ++E++E+E R+E F L+QKV+E+EA +EA  K+ A  QRHI +LE   Q      + RD +S+ +S  +   ++A    +LQ+      A   E  ++++ AE R   LE  +A+ +  ++++E +L  ++S+LRR +G R+                                            G+ SP P  R  SPS  R   +RSP                 C  +P      +++ +AV++ L  F Q+L D +++RD++ AQ  SL  +++  +   E +   +Q L+Q++ + EE K+ +   L   Q +L++++E ++R E   + M E+L+   ++   +E+E + L+D+L + +  +  LE E ++ K+  E  + R  +L L +R LEG+LQR ++  T+ E E   L +R+N+L +++ D E ++  L++  +R++ ALA  E + S  KDK+Q L  SL+  +      +++  QLQ+AL +SE ++++++E+L+ ++ AL  ++ QN+ L ER+Q +Q    + E + SEL+   R     + QRQ+AEQE  +    L  + + LQE+V ++Q      + EK ++ +   +L KDRS+LK++L KVE  + K E        ER + +Q +R LE+E  E Q ++  LQ+Q++  E  H   L+E+++RH+QE+ +E E +R S  Q ER LE RE+AHRQRV  LEEQ+STLK+QL  EM+RR
Sbjct:  126 EEGRSYRLKLQAYQESQHRQAQLVQKLQAKLLQYKKRCGNLEQQVLEKTSESEKLRLSLQSHLDSSAHRLQRFEQEHSLDVQNKLALLDDEQKRCSGLSQVNALLREQLEQANETNQALT-------ESLQKARDEAEQRDTRLRRE-LEMNTSRNSREQVRVRSLWRQVAFLRSSFTQLRAFADRSLSDLQAEYAATSHRLRVACLNL-------EASKSQSCTTASNGVSALETQLRDKLREAMQLQARFDAEKVELSSRILELGEMVKQLRAQNSEKESNLIALR--SNLNKMETNRSEDRAERDALRSEISSLHQILHNINQVVSGEVSRDCSSKHEHSFISAGSISSSQ---------------REGPLI-----AVQKALLQRQTQTEDLQACLEASQEQVVTLQKQLHVEEDKTRTLEKRLQELQQENQLLERAEEDSTRDAERYRNSLGIITSEKGELERQLSAMQQQLECTQTEQEGLRSSSLDVQRQRDLLRQQREDLERQLARERSESERGRHTLEQLEARYSDVRKELVTLKEALSQLSLQKEVLEDENRSLAQALSKAEAQNAEQELALTKLRSEDAGLQDSLAKMGALSEGLAKDKVELNRLLLQAEAEKAELGERRREAELERMAAREELARLQQELLDLTAEKRALEASHNYLQEAKMTLDAEYNLLQREKSSVQEQHAQASKQKQAVQEQLNACHREMELSAALLQKTYKERDELARDKANLTVQLTSEQRKSKALAQDLAALRAERESLESSLLDRQELASSLEAIRDRLDGENASLQQANKSLTRELSSVQSELEQQMSRALQEKQALELKLAQAERNAQEMLITTQQSHQEQLHTERKHKERMHAELCAQREQAESQLRAECKELRIQSRRVLQQLQEDLAKLQQHCTESLLQAESHKQQVLSEKEAEKATLIERIITLERDMEAAALEKDRMRRDFLSKQEQDKDTASGLQAELHNLRSRFEESLSSREVSERSLNEQIRELSTQWQGAHQEAERLKRELSEVEESRDTGRKELIEAHRELRECLQDKDEQRREGLDLKRALGDAVREKEAINTSNHELRTALKRVEFENNSLKRVGEEKDQRLTVLEECKSSLQQEVLKLRTNMRELEKSRLQARRELQELRRQVKTLEGQCTQQGQELSDMQARLTQEEQREEEMRKETFTLRQKVLESEAGKEAALKEAAGLQRHIAELEEAHQQEKELQQQRD-ASLQDSQLKQREEVARLEGALQESQ----AQLREFGLSVNLAEARAQGLEEQLAQNDAKRRDLEHRLNVLNSTLRRTLGSRR--------------------------------------------GRQSPTPGERGRSPSPWR---TRSPVKGEIISDETGVGGLPVCSLSPSRREDGELDLDAVQMLLHSFQQELRDTQKERDESHAQVHSLSKQVENLQANQERSNTCIQMLRQSIRELEEGKRELAKHLEGMQASLVLRDEAVQRGETQNRIMNEELAKMKKSQLIIETEAKALQDKLERSQASEESLEAERRRLKETCEAVDARAARLDLKRRGLEGELQRAQLRTTEMEAEASSLQERLNNLRRELGDSEERAALLKVECERLATALAHKELQESQLKDKLQALTASLTDSNASAGTARDQAVQLQRALSASEHNQKMVQEKLDKTREALTHSRKQNHDLSERLQSLQRSQEECELKVSELDKQTRVLQETVRQRQQAEQEAQESCLLLQEQNSQLQEQVATLQTTAHRLQGEKSDLERTLLRLGKDRSSLKRTLEKVEHNRQKKEVEILHGEREREQQEQKIRNLEEELNETQAEIHTLQSQISILEHTHSQRLLEVSARHKQELDLESERMRDSQQQTERALEAREKAHRQRVHCLEEQVSTLKEQLEQEMKRR 1947          
BLAST of Rootletin vs. Ensembl Zebrafish
Match: crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:ZFIN;Acc:ZDB-GENE-131121-625])

HSP 1 Score: 293.893 bits (751), Expect = 7.428e-82
Identity = 262/893 (29.34%), Postives = 486/893 (54.42%), Query Frame = 3
Query: 2367 KEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQ-----SKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIP--RTGSPSSKRRQLSRSPSN---------------CDFNPV-----DINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMS 4964
            KE++ L ++K  L VQ+T+ +R+++  ++ +A+L ++RE LE++L D Q+L   LE  +++L+GEN  L    ++L  EL  ++ E + +  + +  ++ L  +  Q ++  +  +   + SH E +    K  E        +RE+   +   E  ++     +  Q++ +++  +Q+   +SLL AE+ KQQ LS  E EK  + E++I  + ++++   E DR++++  ++QEQDK   +GL +EL + RS+FE+   + E+  +SLN  I++L+     A +E   L   L   EE+RD  R+E++E +R+L+E  + K+  +RE  +LKR L +  REKE +  SN  LR  +K VE E   L R   +  Q++ V +E   + +QEV +LR N++++EK+RL  +RELQELRR +K L+ +  +  +E++D+Q R+ ++E++E+E R+E F L+QKV+E+EA +EA  K+ A  QRHI +LE   Q      + RD +S+ +S  +   ++A    +LQ+      A   E  ++++ AE R   LE  +A+ +  ++++E +L  ++S+LRR +G R+                                            G+ SP P  R  SPS  R   +RSP                 C  +P      +++ +AV++ L  F Q+L D +++RD++ AQ  SL  +++  +   E +   +Q L+Q++ + EE K+ +   L   Q +L++++E ++R E   + M E+L+   ++   +E+E + L+D+L + +  +  LE E ++ K+  E  + R  +L L +R LEG+LQR ++  T+ E E   L +R+N+L +++ D E ++  L++ +  +S
Sbjct:  129 KERDELARDKANLTVQLTSEQRKSKALAQDLAALRAERESLESSLLDRQELASSLEAIRDRLDGENASLQQANKSLTRELSSVQSELEQQMSRALQEKQALELKLAQAERNAQEMLITTQQSHQEQLHTERKHKERMHAELCAQREQAESQLRAECKELRIQSRRVLQQLQEDLAKLQQHCTESLLQAESHKQQVLSEKEAEKATLIERIITLERDMEAAALEKDRMRRDFLSKQEQDKDTASGLQAELHNLRSRFEESLSSREVSERSLNEQIRELSTQWQGAHQEAERLKRELSEVEESRDTGRKELIEAHRELRECLQDKDEQRREGLDLKRALGDAVREKEAINTSNHELRTALKRVEFENNSLKRVGEEKDQRLTVLEECKSSLQQEVLKLRTNMRELEKSRLQARRELQELRRQVKTLEGQCTQQGQELSDMQARLTQEEQREEEMRKETFTLRQKVLESEAGKEAALKEAAGLQRHIAELEEAHQQEKELQQQRD-ASLQDSQLKQREEVARLEGALQESQ----AQLREFGLSVNLAEARAQGLEEQLAQNDAKRRDLEHRLNVLNSTLRRTLGSRR--------------------------------------------GRQSPTPGERGRSPSPWR---TRSPVKGEIISDETGVGGLPVCSLSPSRREDGELDLDAVQMLLHSFQQELRDTQKERDESHAQVHSLSKQVENLQANQERSNTCIQMLRQSIRELEEGKRELAKHLEGMQASLVLRDEAVQRGETQNRIMNEELAKMKKSQLIIETEAKALQDKLERSQASEESLEAERRRLKETCEAVDARAARLDLKRRGLEGELQRAQLRTTEMEAEASSLQERLNNLRRELGDSEERAALLKVCVCVLS 969          
BLAST of Rootletin vs. Ensembl Zebrafish
Match: si:dkey-230p4.1 (si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-380])

HSP 1 Score: 87.4261 bits (215), Expect = 2.021e-16
Identity = 90/277 (32.49%), Postives = 144/277 (51.99%), Query Frame = 3
Query:  201 RLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQ--------ARCLQTACSNLSCNMKSAESKQQLSTERE--SRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTV 1001
            RL+EE  E+R+KL   ++ + +QA L+ +LQ KVL Y+ +C  LE +             G         R      +  LESTLI+LEEEQ+++  L+E +  L+ QL+Q+T++N+ L  D+ KL+ +W ++ EE+ Q+E  W+ E+     Y+  EHS L  L    +  RRQ   LK +T++++  LK +F+R         A  L       + ++  + S Q LST +   S D LN E     K+ EL   +   E E  EL++R+ EL +
Sbjct:   61 RLDEEQREWRKKLREGREREARQALLIHKLQHKVLDYRARCQALEQQA-----------VGEERELRIRERILRDERSDTLESTLIRLEEEQQRSLGLSEVSALLRSQLSQSTEANEALRDDLRKLTADWSKAVEEVVQKEIDWQKEKEVLTGYIGKEHSRLMTLWGRVVTLRRQCHSLKTATDKDLWELKADFSRLSSSLLSVWASPLSAPKLTHNSSLSQSTSAQPLSTTQGPLSLDDLNHEQTDERKSSEL---KADIESETLELRNRITELNM 323          
BLAST of Rootletin vs. Ensembl Zebrafish
Match: si:dkey-230p4.1 (si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-380])

HSP 1 Score: 81.2629 bits (199), Expect = 2.983e-16
Identity = 65/184 (35.33%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  201 RLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTE 752
            RL+EE  E+R+KL   ++ + +QA L+ +LQ KVL Y+ +C  LE +   G+    + +     +     RS+       LESTLI+LEEEQ+++  L+E +  L+ QL+Q+T++N+ L  D+ KL+ +W ++ EE+ Q+E  W+ E+     Y+  EHS L  L    +  RRQ   LK +T+
Sbjct:   61 RLDEEQREWRKKLREGREREARQALLIHKLQHKVLDYRARCQALEQQA-VGEERELRIRERILRDE----RSDT------LESTLIRLEEEQQRSLGLSEVSALLRSQLSQSTEANEALRDDLRKLTADWSKAVEEVVQKEIDWQKEKEVLTGYIGKEHSRLMTLWGRVVTLRRQCHSLKTATD 233          
BLAST of Rootletin vs. Ensembl Xenopus
Match: pgm2 (phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1006723])

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 625/1926 (32.45%), Postives = 1090/1926 (56.59%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYD---NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQ--QLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLND--SDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRR--DKDDSFREA-----------------------DRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQ---LNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            G  +  L+LR+R  EE   Y+RKL  +Q+ QQ+QAQLVQRLQ KVLQYK +C ELE ++     E+ + +              N  D   +L+L + L +L+EEQ++++ L + N  L+EQ+ Q   +N+ LT +I +L+ +  +S E+L+QRE  WR E  ++  YL++EHS +  L R     R QF++++  TER +  +K + +R +R + TAC NL  N++ ++S     L T R       LE QLR+K R++   Q++++ E  EL  RV EL++ ++KL  +N +K++    L+     DT  E+    +  R   E+ +S+ Q L +I+Q+   D   D    E TG     +  +                + +P F  ++     S I ++S        +   + ++  N  ++  D E E   L +++ A RD +E  ++  +K+    EA                        R +N++ + + E+  +E+   ++  + E  L E ERLK+ N EL R REALE+++E+  ++ +R  KE ER QR  + LE+K+S  K+D+V  +E++++  LE++VL  EK+ +  ALS+ E S+AELE+ +N+  +    L ++++K+ +  E L   +   +R I QLE ER++L  ++R  E   + LK++    E E   L  ++    +R  + E   +R EE+L  +++E+  L +Q+         L ++L + RRE++   +++   ++  E LT +  EL VQ+ A E E ++  E  A L + +E LE+TLY+ Q+   QLE R+EQLEGE   L + K++L  E    RQ  + E E +   R+Q   +  +  Q ++  ++++  +   H + V+RL +  ES R     ++++ + R   E++D++ + E  KQ+++ EI+ +Q ER++SLL  E+EKQ++L L E EK +++EKL+ TQ EL   + E++R ++E+  +QEQDK ++  + SELK+ +S FED    H  E K+L   +K L+  ++   KEV +L T L++AE++RD+LRR+I+E+ R L+E EE  E  ++E  EL+R + +  RE+E +  SN  LR  IK +E+ER  L   + + +Q+++V  E    +++E   LR  L+DVE++ ++ +R+LQELRR +K L  E  +  +EV +LQ R+ ++E+KE ++RRE+  L+Q++ E+E+ REA R+++   Q+H+  LE+  + ++++    +  SR   ++L +A  SLQ+      +++ + R+ L   E RV ALE+ +++ + +++E E  +  ++S+LRR IG R  +    R+ ++                    TKG D+++ +  +G+ +P  R  SP       SRSP      P ++ PE V+ ALR+F+Q+L D +R+RD+A  Q  SL  +L++     E  +++ Q+LQ+ L D +E ++G + RL +A T + + ++ +R +E +R+A  E++   + +    E E R  +DRL++ R+ + R E E K  ++ +E +ENR T+L+L KRSLEG+L+R +M+L ++E E + L +R + L +Q++D E +  SLQ  + R+++AL++ ++     ++K Q L  +L   +     LQ  +S+LQ AL ++EQDRR+L+ERL+S + AL ++K  N  L + IQ  Q  L +      EL+   +     ++++Q+ E+E      +       +QE++  +Q + A  E +KQEI  +   LEK  + L+ +L KV+R++L+ E  A +   E+ +L   +  L  +  E QRQ   LQ Q+ E E++H   LME++ RHRQE+  E     +   Q+E TLE RER+HRQRV+GLEEQI++L++QL  E++RR
Sbjct:  126 GETEAVLDLRQRFHEEEMAYKRKLSAYQEGQQRQAQLVQRLQDKVLQYKRRCRELEQQLLEKTSESEQQRLALQARLDSAETKLNRMDQNHSLELNNALTRLDEEQQRSSSLAQVNNTLREQMEQLKTTNEKLTEEIKRLTSDLHKSHEDLDQREAEWRKERQNYTFYLSNEHSGILTLWRKAAALRSQFLDMRGITERGLAEIKTDISRSSRRMHTACLNLDSNLRLSQSAAGASLHTAR-------LEQQLRDKVRQMMQLQSQWDAEKVELNSRVSELSLQTEKLVRENSKKEKEKQILEN-SGCDTLQEL----EGVR---EECDSLQQVLSSITQMCQTDVSPDPTCVESTGVSATNEMRQ----------------SVSPLFVFSS-----SPIRRRSPTRMRSPQRSELALKAVQNVLQRHQDREKE---LHSELAAARDSLEQTKKQQEKNQHVSEAHTEELKKENKEINTILESVKQELQRCQNSIELLTREKEDMEESLQTIKQKAEGSLLETERLKAVNAELLRQREALEEQKEELNRERDRSQKELERGQRIQEQLEEKVSILKKDLVTVRESLSQTALERDVLQGEKEAVASALSKAESSRAELELALNQMHSERATLTDSLAKMGALNEGLAQDKVALNRVILQLEGERAALHEDRRAGEANCAALKEQQEALEHEVSQLQADRVGLERRCREAEEKHKRQEEQLLGVHKERGKLQDQLAQANTLVQTLQDQLKESRREMDLQGSALQRAAQRMEELTSQNAELGVQLAALEDERQEHEEEFAQLRAQKESLESTLYETQRRAAQLEDRREQLEGEIHTLTLVKQSLQVETQ--RQALEAE-EALAGLRQQKVTVELQLAQTEQAAQLSLSNQSQQHQDTVDRLKREKESLRLTMIADKQDSVQRLEKEKEDLLFDRENVKQKLSAEILRLQEEREESLLKVESEKQKALLLKETEKNSLSEKLMNTQRELSDTKMEMERCRREAQIKQEQDKTSLDNVLSELKALQSDFEDAVSAHSKENKNLRDRMKQLSQERESLNKEVEELRTQLRLAEDSRDSLRRDIIEVQRLLREKEEICESQRKETLELRRDVGDLTRERETLQKSNTELRACIKKIESERSSLQVAMEEKQQRISVLQEGKSCAEREAAHLRATLRDVERSHIEARRQLQELRRQVKTLGGESSQKEQEVAELQARIQQEEQKEQQSRRESLELRQRITESESEREAARREILTLQQHLSALESSSRQREKELEQRLSESRAGEQRLQEACKSLQEQLQRCTSESGDSRLQLGAFEARVRALEAELSKSQASRREAESHVNGLYSALRRTIGVRGRSPSPRRALSS--------------------TKGLDSSHGSPMEGRVTPSSRGVSPDR-----SRSP-----YP-ELEPELVKQALRDFMQELRDTQRERDEAGIQVLSLRRQLEDSINSCERLQSQQQKLQRQLADLQEGQRGTEERLGTAHTEMRLLQDNLRHSEAERQASGERIMELEHSLRICEDENRDFQDRLSRARNAENRQELECKGLREVLEASENRGTELELRKRSLEGELERTRMSLAEREAEVQTLQERAHHLQEQLKDSEDREASLQTEVQRLNLALSRAQDGERQLQEKSQGLTQALGEATAGRGNLQEDVSRLQGALTAAEQDRRVLQERLDSVRQALSDSKRHNLRLSQTIQEQQQQLEEMHLNCRELQAQLQDLQQTLIKQQQREEEQGAALLE-------VQEKLKMLQGDKAQVELDKQEIQHSAVLLEKGNNTLRATLDKVKREQLRIEGEAQRLSVEKEQLSHSVISLRKDLAEAQRQNQYLQEQMTEMERSHTQRLMEVSLRHRQELDSESNRAHSIQQQVESTLESRERSHRQRVRGLEEQINSLQEQLEQEVRRR 1971          
BLAST of Rootletin vs. Ensembl Xenopus
Match: pgm2 (phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1006723])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 625/1926 (32.45%), Postives = 1090/1926 (56.59%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYD---NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQ--QLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLND--SDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRR--DKDDSFREA-----------------------DRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQ---LNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            G  +  L+LR+R  EE   Y+RKL  +Q+ QQ+QAQLVQRLQ KVLQYK +C ELE ++     E+ + +              N  D   +L+L + L +L+EEQ++++ L + N  L+EQ+ Q   +N+ LT +I +L+ +  +S E+L+QRE  WR E  ++  YL++EHS +  L R     R QF++++  TER +  +K + +R +R + TAC NL  N++ ++S     L T R       LE QLR+K R++   Q++++ E  EL  RV EL++ ++KL  +N +K++    L+     DT  E+    +  R   E+ +S+ Q L +I+Q+   D   D    E TG     +  +                + +P F  ++     S I ++S        +   + ++  N  ++  D E E   L +++ A RD +E  ++  +K+    EA                        R +N++ + + E+  +E+   ++  + E  L E ERLK+ N EL R REALE+++E+  ++ +R  KE ER QR  + LE+K+S  K+D+V  +E++++  LE++VL  EK+ +  ALS+ E S+AELE+ +N+  +    L ++++K+ +  E L   +   +R I QLE ER++L  ++R  E   + LK++    E E   L  ++    +R  + E   +R EE+L  +++E+  L +Q+         L ++L + RRE++   +++   ++  E LT +  EL VQ+ A E E ++  E  A L + +E LE+TLY+ Q+   QLE R+EQLEGE   L + K++L  E    RQ  + E E +   R+Q   +  +  Q ++  ++++  +   H + V+RL +  ES R     ++++ + R   E++D++ + E  KQ+++ EI+ +Q ER++SLL  E+EKQ++L L E EK +++EKL+ TQ EL   + E++R ++E+  +QEQDK ++  + SELK+ +S FED    H  E K+L   +K L+  ++   KEV +L T L++AE++RD+LRR+I+E+ R L+E EE  E  ++E  EL+R + +  RE+E +  SN  LR  IK +E+ER  L   + + +Q+++V  E    +++E   LR  L+DVE++ ++ +R+LQELRR +K L  E  +  +EV +LQ R+ ++E+KE ++RRE+  L+Q++ E+E+ REA R+++   Q+H+  LE+  + ++++    +  SR   ++L +A  SLQ+      +++ + R+ L   E RV ALE+ +++ + +++E E  +  ++S+LRR IG R  +    R+ ++                    TKG D+++ +  +G+ +P  R  SP       SRSP      P ++ PE V+ ALR+F+Q+L D +R+RD+A  Q  SL  +L++     E  +++ Q+LQ+ L D +E ++G + RL +A T + + ++ +R +E +R+A  E++   + +    E E R  +DRL++ R+ + R E E K  ++ +E +ENR T+L+L KRSLEG+L+R +M+L ++E E + L +R + L +Q++D E +  SLQ  + R+++AL++ ++     ++K Q L  +L   +     LQ  +S+LQ AL ++EQDRR+L+ERL+S + AL ++K  N  L + IQ  Q  L +      EL+   +     ++++Q+ E+E      +       +QE++  +Q + A  E +KQEI  +   LEK  + L+ +L KV+R++L+ E  A +   E+ +L   +  L  +  E QRQ   LQ Q+ E E++H   LME++ RHRQE+  E     +   Q+E TLE RER+HRQRV+GLEEQI++L++QL  E++RR
Sbjct:  121 GETEAVLDLRQRFHEEEMAYKRKLSAYQEGQQRQAQLVQRLQDKVLQYKRRCRELEQQLLEKTSESEQQRLALQARLDSAETKLNRMDQNHSLELNNALTRLDEEQQRSSSLAQVNNTLREQMEQLKTTNEKLTEEIKRLTSDLHKSHEDLDQREAEWRKERQNYTFYLSNEHSGILTLWRKAAALRSQFLDMRGITERGLAEIKTDISRSSRRMHTACLNLDSNLRLSQSAAGASLHTAR-------LEQQLRDKVRQMMQLQSQWDAEKVELNSRVSELSLQTEKLVRENSKKEKEKQILEN-SGCDTLQEL----EGVR---EECDSLQQVLSSITQMCQTDVSPDPTCVESTGVSATNEMRQ----------------SVSPLFVFSS-----SPIRRRSPTRMRSPQRSELALKAVQNVLQRHQDREKE---LHSELAAARDSLEQTKKQQEKNQHVSEAHTEELKKENKEINTILESVKQELQRCQNSIELLTREKEDMEESLQTIKQKAEGSLLETERLKAVNAELLRQREALEEQKEELNRERDRSQKELERGQRIQEQLEEKVSILKKDLVTVRESLSQTALERDVLQGEKEAVASALSKAESSRAELELALNQMHSERATLTDSLAKMGALNEGLAQDKVALNRVILQLEGERAALHEDRRAGEANCAALKEQQEALEHEVSQLQADRVGLERRCREAEEKHKRQEEQLLGVHKERGKLQDQLAQANTLVQTLQDQLKESRREMDLQGSALQRAAQRMEELTSQNAELGVQLAALEDERQEHEEEFAQLRAQKESLESTLYETQRRAAQLEDRREQLEGEIHTLTLVKQSLQVETQ--RQALEAE-EALAGLRQQKVTVELQLAQTEQAAQLSLSNQSQQHQDTVDRLKREKESLRLTMIADKQDSVQRLEKEKEDLLFDRENVKQKLSAEILRLQEEREESLLKVESEKQKALLLKETEKNSLSEKLMNTQRELSDTKMEMERCRREAQIKQEQDKTSLDNVLSELKALQSDFEDAVSAHSKENKNLRDRMKQLSQERESLNKEVEELRTQLRLAEDSRDSLRRDIIEVQRLLREKEEICESQRKETLELRRDVGDLTRERETLQKSNTELRACIKKIESERSSLQVAMEEKQQRISVLQEGKSCAEREAAHLRATLRDVERSHIEARRQLQELRRQVKTLGGESSQKEQEVAELQARIQQEEQKEQQSRRESLELRQRITESESEREAARREILTLQQHLSALESSSRQREKELEQRLSESRAGEQRLQEACKSLQEQLQRCTSESGDSRLQLGAFEARVRALEAELSKSQASRREAESHVNGLYSALRRTIGVRGRSPSPRRALSS--------------------TKGLDSSHGSPMEGRVTPSSRGVSPDR-----SRSP-----YP-ELEPELVKQALRDFMQELRDTQRERDEAGIQVLSLRRQLEDSINSCERLQSQQQKLQRQLADLQEGQRGTEERLGTAHTEMRLLQDNLRHSEAERQASGERIMELEHSLRICEDENRDFQDRLSRARNAENRQELECKGLREVLEASENRGTELELRKRSLEGELERTRMSLAEREAEVQTLQERAHHLQEQLKDSEDREASLQTEVQRLNLALSRAQDGERQLQEKSQGLTQALGEATAGRGNLQEDVSRLQGALTAAEQDRRVLQERLDSVRQALSDSKRHNLRLSQTIQEQQQQLEEMHLNCRELQAQLQDLQQTLIKQQQREEEQGAALLE-------VQEKLKMLQGDKAQVELDKQEIQHSAVLLEKGNNTLRATLDKVKREQLRIEGEAQRLSVEKEQLSHSVISLRKDLAEAQRQNQYLQEQMTEMERSHTQRLMEVSLRHRQELDSESNRAHSIQQQVESTLESRERSHRQRVRGLEEQINSLQEQLEQEVRRR 1966          
BLAST of Rootletin vs. Ensembl Xenopus
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:100486658])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 532/1416 (37.57%), Postives = 858/1416 (60.59%), Query Frame = 3
Query: 1413 NFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSEN--------------EREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKD-LTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQ 5615
            + ++Q+ DNENERR LE ++  ++ E + +   K+D+ R+  R +N +   + E+  LEK   +L +++  Q  E E+L+ AN +LQR R+ L++E+ED  +D ER ++  +R  ++ + LE K+S  ++++V  KE+++K  LE+EV   E+ ++  ALS+ E   AELE+ +N+++T E +L + +SK+S+  E L   + E  R I QLE ER+ L  +K  +EQEK+ ++DELVR EQE L L  E+      ++ +E N E+L +E+  L +E+  L EQ+G  Q    ++ ++L+Q RR++E  +  +   S+EKE L K+KG LVVQ+TA ERE+R  +E IA L +++E LE  L++AQQ +I + +RKEQ       L V+ +NL     RL +E        +      +C Y   D E                         N  G++N              E+EEL+HR   ER++++  +E E++EM++EI  +Q+ERD+SLL AE EKQQ+LS+ E EK +++EKL   Q  L  +  EL+R K++S  RQEQD+  I  L+SELK  R Q E+    H+ E+K LN   ++ L L       EV +L T L + E+ RD +RRE++E +R+++E +E  E  K+E  EL+R L +E +EKE V  SNE LR  ++  E+ERI L R   + +Q+++V +E    S++EVN+LR++L+DVE++RL+ +RELQ+LRR +K LD E  K ++++ ++Q R++  E++E+E+RR+NF LKQK++ETEA REA RK+L+  QR + ++E     ++R+    ++ +R + +KL D   +L+        ++ +L + LS +EGRV  LE+ ++R+EG K+E+EFKL S+HS+LRR +G  +                                     T +    G      R+GSP SK  +   SP+  +    DI+PE VR ALR+F+Q+L D ER+RD+   Q  +    L E E + + A  R+QQLQ+ L + EE K+ +DG+L   QT L++QEET+RR ER+RK   EK ++ +R+  + E E+R  +D++NK + ++A+ E E ++ K+ ++ +E+R T+L+L++R LEG+LQR K+ L D+E E + +  R+ +L +Q+ D EG+  +LQL ++R++  LAK +E  +  K+K+Q L  +LS  +       +K++QLQK L  SE +RR+L+ERLE+++ A+ E K QN  LME+ Q+++ +  + E +R+ELEG  RQ   ++ QRQE+E    +  QKL  E+  LQER+  +QR +   E+EK+E+ ++  +LEKD++ALKK+L KVER+KLKT E   +   E+  LD+ L  +E E  E QRQV +L+
Sbjct:   36 SLRKQLSDNENERRALEQKIQQLQQERDVMGGAKEDAERDVTRLRNHIEQLNGEKGALEKSLQNLQEELNGQRQENEKLQLANSDLQRQRDLLQEEKEDVCRDRERALQNVDRGHKAQEQLEVKLSALRKELVVVKESLHKCSLEREVSEAERVDVSQALSKAETRLAELELTLNRQRTEEASLRDALSKMSALNESLAQDKTELSRIIAQLEEERAHLQGQKHEVEQEKASIRDELVRLEQEKLELDTERFGLDNSLQAMEQNREKLLQEVQALRKERGQLQEQLG--QVSLLSIRDDLVQSRRDVELQSECLLRASREKEELMKDKGSLVVQLTASERESRALAEEIAVLRTEKEALETALFEAQQQLIHVTSRKEQ-------LEVESQNL-----RLNKES-------LQGTGSFSC-YGSCDHE-------------------------NGQGNDNTLFAQNELRLELESEKEELVHRLTQEREELVARHEMEREEMSEEIAALQQERDESLLQAEFEKQQALSVKESEKASLSEKLSHAQHGLSGLSLELERHKRDSQIRQEQDRGTILALNSELKGLRGQLEEALVLHDRELKGLNDKSREPLGLDLIGCCLEVEELKTQLCVVEDARDAVRRELIEAHRRVREGQELLEGHKKENMELRRALGDEAKEKEAVQKSNEELRGAVRRAESERISLKRSNEEKEQRLSVLEEARGASEKEVNDLRSSLRDVERSRLEARRELQDLRRQLKLLDDESIKRSRDMAEVQARLSTYEQREEESRRDNFTLKQKLMETEAGREAARKELSALQRKVAEVEGEFGVRERELQGSLDEARGNEKKLLDNTRNLEIKLQAAQEESGQLGLRLSASEGRVHGLEAELSRLEGLKREVEFKLGSLHSALRRTLGIGRAG----------------------------------RTPSPAYRG------RSGSPKSKTPERPPSPTRGEQLVADIDPEVVRAALRDFLQELRDTERERDELRTQLGTSNRHLAEMEAERDGAITRVQQLQKVLSECEEAKRNVDGKLGGLQTTLILQEETLRRYERERKLAQEKAASLERSLQAAEGEQRAAQDKMNKIKANEAKYENERRRLKEVLDASESRNTKLELSRRGLEGELQRHKLVLADREAEMQEMQQRMEALQRQLSDSEGRVGTLQLCVERLNSTLAKAQESETSLKEKVQSLTGALSDSNCTSASSHDKLNQLQKVLTGSEHERRILQERLEAARQAVAEGKKQNVALMEQNQVLRDEQAEGELQRAELEGQVRQMQEILRQRQESEGASLRNVQKLQEEREVLQERLCGLQRAVVQLESEKREVERSSMRLEKDKNALKKTLDKVEREKLKTAEDTLRLSAEKGRLDRSLTTVEQELAEAQRQVQLLE 1364          
BLAST of Rootletin vs. Ensembl Xenopus
Match: pgm2 (phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1006723])

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 613/1923 (31.88%), Postives = 1077/1923 (56.01%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQ--QLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLND--SDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRR--DKDDSFREA-----------------------DRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQ---LNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            G  +  L+LR+R  EE   Y+RKL  +Q+ QQ+QAQL                 L+ K+Q    ++ +TK      N           +L+L + L +L+EEQ++++ L + N  L+EQ+ Q   +N+ LT +I +L+ +  +S E+L+QRE  WR E  ++  YL++EHS +  L R     R QF++++  TER +  +K + +R +R + TAC NL  N++ ++S     L T R       LE QLR+K R++   Q++++ E  EL  RV EL++ ++KL  +N +K++    L+     DT  E+    +  R   E+ +S+ Q L +I+Q+   D   D    E TG     +  +                + +P F  ++     S I ++S        +   + ++  N  ++  D E E   L +++ A RD +E  ++  +K+    EA                        R +N++ + + E+  +E+   ++  + E  L E ERLK+ N EL R REALE+++E+  ++ +R  KE ER QR  + LE+K+S  K+D+V  +E++++  LE++VL  EK+ +  ALS+ E S+AELE+ +N+  +    L ++++K+ +  E L   +   +R I QLE ER++L  ++R  E   + LK++    E E   L  ++    +R  + E   +R EE+L  +++E+  L +Q+         L ++L + RRE++   +++   ++  E LT +  EL VQ+ A E E ++  E  A L + +E LE+TLY+ Q+   QLE R+EQLEGE   L + K++L  E    RQ  + E E +   R+Q   +  +  Q ++  ++++  +   H + V+RL +  ES R     ++++ + R   E++D++ + E  KQ+++ EI+ +Q ER++SLL  E+EKQ++L L E EK +++EKL+ TQ EL   + E++R ++E+  +QEQDK ++  + SELK+ +S FED    H  E K+L   +K L+  ++   KEV +L T L++AE++RD+LRR+I+E+ R L+E EE  E  ++E  EL+R + +  RE+E +  SN  LR  IK +E+ER  L   + + +Q+++V  E    +++E   LR  L+DVE++ ++ +R+LQELRR +K L  E  +  +EV +LQ R+ ++E+KE ++RRE+  L+Q++ E+E+ REA R+++   Q+H+  LE+  + ++++    +  SR   ++L +A  SLQ+      +++ + R+ L   E RV ALE+ +++ + +++E E  +  ++S+LRR IG R  +    R+ ++                    TKG D+++ +  +G+ +P  R  SP       SRSP      P ++ PE V+ ALR+F+Q+L D +R+RD+A  Q  SL  +L++     E  +++ Q+LQ+ L D +E ++G + RL +A T + + ++ +R +E +R+A  E++   + +    E E R  +DRL++ R+ + R E E K  ++ +E +ENR T+L+L KRSLEG+L+R +M+L ++E E + L +R + L +Q++D E +  SLQ  + R+++AL++ ++     ++K Q L  +L   +     LQ  +S+LQ AL ++EQDRR+L+ERL+S + AL ++K  N  L + IQ  Q  L +      EL+   +     ++++Q+ E+E      +       +QE++  +Q + A  E +KQEI  +   LEK  + L+ +L KV+R++L+ E  A +   E+ +L   +  L  +  E QRQ   LQ Q+ E E++H   LME++ RHRQE+  E     +   Q+E TLE RER+HRQRV+GLEEQI++L++QL  E++RR
Sbjct:  126 GETEAVLDLRQRFHEEEMAYKRKLSAYQEGQQRQAQL--------------VQRLQDKLQ-ARLDSAETKLNRMDQN----------HSLELNNALTRLDEEQQRSSSLAQVNNTLREQMEQLKTTNEKLTEEIKRLTSDLHKSHEDLDQREAEWRKERQNYTFYLSNEHSGILTLWRKAAALRSQFLDMRGITERGLAEIKTDISRSSRRMHTACLNLDSNLRLSQSAAGASLHTAR-------LEQQLRDKVRQMMQLQSQWDAEKVELNSRVSELSLQTEKLVRENSKKEKEKQILEN-SGCDTLQEL----EGVR---EECDSLQQVLSSITQMCQTDVSPDPTCVESTGVSATNEMRQ----------------SVSPLFVFSS-----SPIRRRSPTRMRSPQRSELALKAVQNVLQRHQDREKE---LHSELAAARDSLEQTKKQQEKNQHVSEAHTEELKKENKEINTILESVKQELQRCQNSIELLTREKEDMEESLQTIKQKAEGSLLETERLKAVNAELLRQREALEEQKEELNRERDRSQKELERGQRIQEQLEEKVSILKKDLVTVRESLSQTALERDVLQGEKEAVASALSKAESSRAELELALNQMHSERATLTDSLAKMGALNEGLAQDKVALNRVILQLEGERAALHEDRRAGEANCAALKEQQEALEHEVSQLQADRVGLERRCREAEEKHKRQEEQLLGVHKERGKLQDQLAQANTLVQTLQDQLKESRREMDLQGSALQRAAQRMEELTSQNAELGVQLAALEDERQEHEEEFAQLRAQKESLESTLYETQRRAAQLEDRREQLEGEIHTLTLVKQSLQVETQ--RQALEAE-EALAGLRQQKVTVELQLAQTEQAAQLSLSNQSQQHQDTVDRLKREKESLRLTMIADKQDSVQRLEKEKEDLLFDRENVKQKLSAEILRLQEEREESLLKVESEKQKALLLKETEKNSLSEKLMNTQRELSDTKMEMERCRREAQIKQEQDKTSLDNVLSELKALQSDFEDAVSAHSKENKNLRDRMKQLSQERESLNKEVEELRTQLRLAEDSRDSLRRDIIEVQRLLREKEEICESQRKETLELRRDVGDLTRERETLQKSNTELRACIKKIESERSSLQVAMEEKQQRISVLQEGKSCAEREAAHLRATLRDVERSHIEARRQLQELRRQVKTLGGESSQKEQEVAELQARIQQEEQKEQQSRRESLELRQRITESESEREAARREILTLQQHLSALESSSRQREKELEQRLSESRAGEQRLQEACKSLQEQLQRCTSESGDSRLQLGAFEARVRALEAELSKSQASRREAESHVNGLYSALRRTIGVRGRSPSPRRALSS--------------------TKGLDSSHGSPMEGRVTPSSRGVSPDR-----SRSP-----YP-ELEPELVKQALRDFMQELRDTQRERDEAGIQVLSLRRQLEDSINSCERLQSQQQKLQRQLADLQEGQRGTEERLGTAHTEMRLLQDNLRHSEAERQASGERIMELEHSLRICEDENRDFQDRLSRARNAENRQELECKGLREVLEASENRGTELELRKRSLEGELERTRMSLAEREAEVQTLQERAHHLQEQLKDSEDREASLQTEVQRLNLALSRAQDGERQLQEKSQGLTQALGEATAGRGNLQEDVSRLQGALTAAEQDRRVLQERLDSVRQALSDSKRHNLRLSQTIQEQQQQLEEMHLNCRELQAQLQDLQQTLIKQQQREEEQGAALLE-------VQEKLKMLQGDKAQVELDKQEIQHSAVLLEKGNNTLRATLDKVKREQLRIEGEAQRLSVEKEQLSHSVISLRKDLAEAQRQNQYLQEQMTEMERSHTQRLMEVSLRHRQELDSESNRAHSIQQQVESTLESRERSHRQRVRGLEEQINSLQEQLEQEVRRR 1943          
BLAST of Rootletin vs. Ensembl Xenopus
Match: ENSXETT00000012563.1 (centrosomal protein 250 [Source:NCBI gene;Acc:100498015])

HSP 1 Score: 87.4261 bits (215), Expect = 2.894e-16
Identity = 45/133 (33.83%), Postives = 78/133 (58.65%), Query Frame = 3
Query:  426 YDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNL 824
            +   +LE  L KLEEEQ++   L   N  L+E L    ++N+ L  D+ KL+ +W  + +EL+ +E  W  E   +N  +  EHS L  +    + FRR F ELK++TER++++++ +++R    +Q+ CS+L
Sbjct:   40 HGETELERALQKLEEEQQRCENLAAVNALLREDLGHTQEANKVLCNDMHKLTADWTSALQELKHKENDWEQEREHYNSLMKGEHSRLLRIWTEVVTFRRHFRELKSATERDLSSVRADWSRCLCLIQSCCSSL 172          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 692/1936 (35.74%), Postives = 1136/1936 (58.68%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE + YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE   Q  D  T   +           R  +   + DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:  137 RGLVRQSVELRRQLQEEQSSYRRKLQAYQEGQQRQAQLVQRLQAKILQYKKQCSELEK--QLMDRSTELEQQ----------RLRDTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1995          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 654/1845 (35.45%), Postives = 1079/1845 (58.48%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:   52 DLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 654/1845 (35.45%), Postives = 1079/1845 (58.48%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:   52 DLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 654/1845 (35.45%), Postives = 1079/1845 (58.48%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:   52 DLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:MGI Symbol;Acc:MGI:3045962])

HSP 1 Score: 313.153 bits (801), Expect = 1.559e-85
Identity = 386/1421 (27.16%), Postives = 742/1421 (52.22%), Query Frame = 3
Query:  432 NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL----QRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD-AEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKT--PPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELN-DKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGL-SNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDF-SSMVESSR----------RDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVD--INPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMA 4628
            ++DLE  L +LE  Q+++  L++ N  L++QL    ++N  L R++++ +     S   L+++ ++  ++ +S       +  ++  L R     +    EL+ASTER + +++ +  R A+ L  AC NL  +++       L+    + D   LE +LRE+ RE+   Q ++  E   LQ R+ E T+L +KL +Q  + +RA+  L    QR+K+  + G++ +++     L ++ ES+H  L +I +V  +D+   + A  +  E      R  SP R+ S       A+T  P        AVQ+AI ++  + QEL+ +L SS+E     + Q+     E R  +  +     E E L    +   +EA   + ++++   E+  LE     L  + + +  E ++L+  N EL+R      +++ +  +  ER ++E E  Q  ++ LE+K+S  ++++   +EA++  QL++++L  EK+ +  AL++ E   A+LE+ V + +   +  +++++K+++ +E L+ DK   NH  + QLE ER  L  +++ L+QE++G++++L ++ Q+ LGL   E+   ++    LE   + LE+++  L +E   L EQ+G +  +K AL ++L Q  ++ E   + +     EK  L++E+ +L+ +  A ER +   ++  A L ++R  LE +L++AQ+L  QL+T++EQLEG+ +   + +  L  E+ RL+ ++++   K+     QL  +  Q ++E ++A++++  +H ED+ RL +  +     S  E +E   R+  ++ +++     +++ +  EI  +++ERD+SLL  E+E QQ+LSL + EK  +++       EL     EL+R ++E+ N+Q Q +  +  ++ EL++ + QFE+    H+ E  +L   ++++   +    +E  +L   L +A E    LR+E+       +  +             +R L +E +EK+ + +SN  LR  I   E E+  L R   + +QK+ +  E  V +++E  ELR  L+++E+A+ D +R+LQE  R ++ L+ E  +  +EV+DLQ +V+RD +   +  +E+  L+++V E +A+ + V+K++   ++ + ++E   +++ +     + ES R          R  RKL +A N          AD+  L+ +L  A  RV  LE  +A+ EGA+   E +L  + S+L   +G +  N++    R +S                   T G   T       + SP  R+ SP       +R PS    +P    I+   VR ALR+ VQ L++A+++RD++  Q  +L S+L E E +    ++R++QLQ+ L DAEE ++  +  L SAQ A  +Q+E ++R E +  A A
Sbjct:  146 SMDLEEALSRLEASQQRSMGLSQVNTLLRQQLEHMQKANDTLARELTRATH----SLVHLQRKLELQESQRLSLR-----QPRDILPLWRQAKALQTHLAELRASTERGLTDVQADMTRTAQRLHMACLNLDSHLR-------LTASSMTSD---LEQRLREQAREMLQLQGQWAAEKVALQARLSEQTLLVEKLSVQKEQGERAILTLKSDIQRLKSRRSGGQLAVDE-----LRDEVESLHHVLASIKEVAQSDAMCPELAWSSSIEVREAQARLRSPPRSVSPHQRMSPARTSSPTSLHPALQAVQAAIERRQQREQELRLRLESSQEEAAGLREQLSGYRQELRTSQRLLQDRAQEHEDLLGQLEAQRQEAQLSQASVHLLEREKEALETTMEELRAKADIREAETQKLEVTNAELRRSLLLRAEQKAELAQQSERSLRELEASQGRVEQLEEKVSGLRKELATSREALSSMQLQRDILETEKESLHGALAQAESGNADLELLVTRLKAEGMEQQDSLAKMAALLEGLSQDKGTLNHLAL-QLEQERDQLREQQKMLQQEQAGMREQLTQTGQQ-LGLIRAERRSLKETCGHLEQKQDHLEKQVVLLGQENAQLREQVGQVTNKKQALEKQLAQSLQDQEAQMDILQEALHEKNTLSEERAQLLAKQEALERHSELVTKEAADLRAERNSLENSLFEAQRLTTQLQTQQEQLEGKAEAAQLARRALQVEIERLKSDWEVRETKLQLHLGQLQQQAAQQEQEAQLALERQELAHTEDLARLHR-EKDTLSLSLAEEKEAAARWMEQQKELLTRSAADREALQGEIQNLKQERDESLLQLEHEMQQALSLKDAEKSLLSK-------ELSGAHRELERARQEAQNQQVQAEATVTTMTKELRTLQVQFEEAISTHQREADTLREKLREIAAERSSVRREAEELQAQLNVAHERLAELRQELQASEESREGLQREALGA-------RRALEDEVQEKDVLQHSNTELRASIHRAEQEKASLKRSKEEQEQKLLLLQEAQVAAQKEAYELRTRLQELERAQRDTRRKLQERHRQVRTLEAENQRKRQEVSDLQAQVSRDAQHRQKNLQESLELQRQVAEAQAAHDGVQKEVLGLRQKLAEVEASGETRAKQLEGHLCESQRAEQTLQAELCRITRKLQEASNQ---------ADS--LQRSLDNACSRVHVLEQELAKAEGARCNAEAQLGRLWSTLCSGLG-QSRNLLASPKRPHSP------------------TTGSSQTRPGRQ--RTSPPTRSYSP-------ARWPSPVPVDPKSEVIDVAFVRDALRDLVQGLLEAQQERDNSGIQVANLSSQLSEAERERLRLQSRVEQLQRDLADAEEGQRRAESALQSAQAARALQKEALQRLETEHLASA 1486          
BLAST of Rootletin vs. UniProt
Match: sp|Q8CJ40|CROCC_MOUSE (Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2)

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 692/1936 (35.74%), Postives = 1136/1936 (58.68%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE + YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE   Q  D  T   +           R  +   + DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:  137 RGLVRQSVELRRQLQEEQSSYRRKLQAYQEGQQRQAQLVQRLQAKILQYKKQCSELEK--QLMDRSTELEQQ----------RLRDTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1995          
BLAST of Rootletin vs. UniProt
Match: sp|Q5TZA2|CROCC_HUMAN (Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 706/1937 (36.45%), Postives = 1145/1937 (59.11%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKM--QFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXX-AKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS---------------------GLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINS-RHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE   YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE ++  + G+ E ++ +              +   + DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++         ++++A  +  ED E + Q LR+++Q VL+DS+            DA +     +        PRR+      S     +P  +D+ T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +                     GL+  L  +EQ    L  +    R                      E+  L EQ+  L RQ S   +EL Q RRE +R   ++   ++EKE L KE   L VQ+ A ERE R  SE    L  ++E LE +L++ Q+ + QLE R+EQLE E Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL +  E+     E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H  EV+ L    +DL   +D  L+E  +L T L++ E+ RD LRRE++E  RKL+E++E +E  ++E  EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E      +E  ELR  L++VE++RL+ +RELQELRR +K LD+E  +L +E+ +LQ R+A  E  E E+RRE  GL+Q++++ EAS E +R++L  AQR + + E   ++++R     +E +R   ++  D    L+   +   A+  EL + LS AEGR   LE+ +ARVE  ++  E +L  + S+LRR +G  +      R    S +                              G+G   P T   S   +  S  P+    +P D++PEAVR ALREF+Q+L  A+R+RD+   Q  +L  +L E E + + A +R +QLQ+A+ ++EE ++ +DGRLS  Q  L +QEE++RR+ER+R+A  ++++  +R+  + ESE R  +++++K + ++ +LE + ++ K+ ++ +E+R  +L+L +RSLEG+LQR ++ L+D+E + + L DRV+SL +Q+ D E K+ +LQLT++R++ ALAK EE     +DK++ L  +L+  S  L   ++K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ ++ D E +R E EG  +Q   ++ QRQE E       QKL  E+  LQER+ S+QR LA  EAEK+E+ ++  +LEKDR AL+++L KVER+KL++ E   +   E+  LD+ L   E E  E QRQ+  L+ Q+   EQ+H    +E+++ + + E+  E+E LR++  Q ERTLE RERAHRQRV+GLEEQ+STLK QL  E++R
Sbjct:  135 RGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKRCSELEQQLLERSGELEQQRLR--------------DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLR---------LQEQAA-LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRH---------------------ERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGLGRAPSPAPRPVPGSPA----------------------RDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASP-DLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSATSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQRVRGLEEQVSTLKGQLQQELRR 2003          
BLAST of Rootletin vs. UniProt
Match: sp|H7BZ55|CRCC2_HUMAN (Putative ciliary rootlet coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=CROCC2 PE=5 SV=4)

HSP 1 Score: 271.552 bits (693), Expect = 8.533e-72
Identity = 331/1175 (28.17%), Postives = 613/1175 (52.17%), Query Frame = 3
Query: 1488 EIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEEL-NDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQE-ALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERD-DMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRH-------HDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKE-------TETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRM 4961
            E E+LR   +    E  + + +  +   E++ LE +   L  + +    E + L++   ELQR      + +E+     ER  +  E  Q  +  LE+K+S  +E++ + +EA++  QL+++V+  E++ +  AL+R E S A+LE+ V + ++  V   ++++ +++ +E L  DK A NH  + QLE ER  L  +++ LEQE++   ++L ++EQ+ AL  +  + +Q Q   +LE   E+LE + + L REK  L EQ+G +  QK AL E+L Q  ++ E    ++    + K+ L++E+ +L+ +  A ER+ R  +E  A L  +R+ LE++L +AQQL  +L   +EQLE E +   + ++ L  E+ +L+ +++++  K+     +L  +  Q ++E + A++ +  +H E + +L +  E+       E+E  + R  +E++ +++     E++ +  EI ++++ERD+SLL  E++ QQ+LSL E E+  ++E       EL      L+R+++E+ ++QEQ +  I+  + ELK+ ++QFED    H+ E  +L   ++DL   +    +E   L   L +A+E    LR+E+  +        E++E L RE  E +R L +E REK+ ++  N  LR  I   E E+    R   + +QK+ + +E     +QE + LR +L ++E+A  D ++EL+EL R ++ L  E  + + E ++LQ + +++             L+++  + EA  E  RK++   QR + ++E   ++  +     +  SR   + L    +S+ +         + L+  L  A  R+ +LE  +A+ EGA+++ E +L  + S+LRR +G ++++      +  S                   TKG D++ A       SP  R   P S  R  S +P       +D+    V+  LR+FVQ+L +A+R+RDD+  Q  +L SRL E E +   A++R+ QLQ+AL +AEE ++ ++G LSSA+ A  +Q+E +RR E +  A          +  +   EKR+L+++L   R        H   L ++ K  ++ + N E+R    Q A+ SLE  L++M+     +E        E E LD  +NSL +++     ++Q LQ  +  M
Sbjct:  461 EREALRGQLEAQRLEVQQCRASCKLLGREKAALEMVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRERSCRALETSQGRLQQLEEKVSGLREELASVREALSTAQLQRDVVESEREGLRSALARAECSNADLELLVRRLKSEGVEQRDSLAAMAALMEGLAQDKSALNHLAL-QLEQERDQLREQRKTLEQERARAGEQLAQAEQQLALERAERRGLQ-QACGRLEQRQEQLEGQAALLGREKAQLQEQVGQVTCQKQALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQEALERQGRLAAEEAADLRVERDSLESSLLEAQQLATKL---QEQLEEEARSAGLARQALQVEMEQLQSDWEVQEMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKE--VARCQLEQEKELVTKSAAEREALKGEIQSLKQERDESLLQLEHKMQQALSLKETERSLLSE-------ELSRARRTLERVQQEAQSQQEQAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLAAERGDVEREAERLRAQLTVAQEGLAALRQELQGVE-------ESREGLHREAQEARRALSDEAREKDVLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILEEAQAALQQEASALRAHLWELEQAGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEV----------LELRRQAAKAEAKHEGARKEVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRAELHSVTRKLQEASGVADALQARLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQSPWASPEQPGSP------------------TKGSDSSQALPGQQGTSPPAR---PHSPLRWPSPTPGGRSSELMDVA--TVQDILRDFVQKLREAQRERDDSRIQMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLA----------SVRAAGQEKRRLQEQLETLRQALEESRRHSQGLAKQGKLLEEQLTNLEHRC---QKAEVSLE-PLRQMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEM 1567          

HSP 2 Score: 84.7297 bits (208), Expect = 1.037e-14
Identity = 66/209 (31.58%), Postives = 105/209 (50.24%), Query Frame = 3
Query:  432 NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL 1058
            ++DLE  L +LE  ++++  L + N  L+EQL    ++N  L R+++ ++   QR + ELE R   W   +         +  +L  L R  +       EL+ +TER + +L+ +  R AR L TAC NL  N++       LS    S     L  QLR+K  E+   Q R++ E   LQ R+ E T+L +KL  QN +K + + AL
Sbjct:  147 SVDLEEALGRLEAAEERSTGLCQVNALLREQLEHMKKANDALGRELAGMTGSVQRLQGELELRR--WAQRQTRSGGL--GQPRDLLLLWRQAVVLGTDLAELRVATERGLADLQADTARTARRLHTACLNLDSNLR-------LSA---SSTASTLGQQLRDKAGEMLQLQGRWDAEKVALQARLSEQTLLVEKLTEQNEQKAKTIAAL 341          

HSP 3 Score: 62.3882 bits (150), Expect = 5.536e-8
Identity = 84/278 (30.22%), Postives = 141/278 (50.72%), Query Frame = 3
Query: 5010 KMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQ-NNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            +M  L+  LS    +  + Q+++ QLQKAL  +E+ +R +E  L S++ A    K     L +E +  +++     E RR     L  Q  TL    ++A +E  +  Q L  +   L+E++ +++     AE            LE  R        ++E++ LK EE  ++   E+ +LDQ L  L  E     RQ   LQ Q+ E EQAH   L ++ ++H+++++ E E L  +  Q  + LE +E  H+Q+VK LEEQ+++LK+QL  E+Q R
Sbjct: 1388 QMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLASVRA--AGQEKRR-----LQEQLETL----RQALEESRRHSQGLAKQGKLLEEQLTNLEHRCQKAEV----------SLEPLR--------QMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQEWTHQQQVKVLEEQVASLKEQLDQEVQWR 1636          
BLAST of Rootletin vs. UniProt
Match: sp|Q9BV73|CP250_HUMAN (Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 8.947e-51
Identity = 269/1011 (26.61%), Postives = 506/1011 (50.05%), Query Frame = 3
Query:  309 YKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNL----------ENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL-QRIKNGDTAGEINMEDKAT--RVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELN-DKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIME 3299
            Y+  C ELE +++           G P    + +  E   D L     L++LEEEQ++   L E N +L+  + +A   N+ L  D+ KL+ +W R+R+EL ++E  W+ E+  F  YL  EH  L +L R  + FRR F+E+K++T+R++  LK E  R +  L T C  L+   +S E     S   + R+   L          E +  E+++EL   +++ + E  ELQ RV EL+ L  + + QN + ++ + AL + ++  +T     ME +A+  R   E+  S+ Q +++I+QV++ + D   A+ +G E   + + S   + +               AD     V+S + ++   +Q+L+ +L   +E+    ++Q D  E E +       A+R  ++ L  ++D    +    +  ++  S ER  L+K R  L  Q+E    E  RL+  N ELQ   ++ + ++E+ +++L   ++E ER Q  +  LE K S    +++  +EA+    LE E+L QE+ E+  AL+R E S AEL    N  +T   +L     KLS+  E L  DK   N + + QLE E  S+ +     EQ ++ L+ +L  +E+    L  +      ++++ E     L+ +L ++  EK ++ +++   + Q+ A   +L Q  +E +R    +    +EKE L +EK  L V++ A ER+ +  +E +  L+S +E LE++L++AQQ    +E  K QLE + Q +   KE + GE+  L+ E   E  +    R+    +  Q ++E K A++Q++ +H ++V +L +  E  R   + E  + +   ++ER+ M    E   +E   E+  IQ +R++    AE+   Q     E+E+ ++ E L++TQ EL     +L+R++++   ++ ++++    L ++L+  + + ++  + H  ++ +L      L   K    K+V DL + L   ++++  + +E+ E
Sbjct:   66 YRSWCQELEKRLEA---------TGGPIPQRWENVEEPNLDEL-----LVRLEEEQQRCESLAEVNTQLRLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNG--SGRMDGREPAQLLLLLAKTQELEKEAHERSQELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNEDYEKMIKALRETVEILETNHTELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNI-AQGSGHENSLELDSSIFSQFDYQD------------ADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQQQHDQWEEEGK-------ALRQRLQKLTGERDTLAGQTVDLQGEVDSLSKERELLQKAREELRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVKLSALNEALALDKVGLNQQLL-QLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALE--SLEREKM--ELEMRLKEQQTEMEAIQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQE 1035          
BLAST of Rootletin vs. UniProt
Match: sp|Q60952|CP250_MOUSE (Centrosome-associated protein CEP250 OS=Mus musculus OX=10090 GN=Cep250 PE=1 SV=4)

HSP 1 Score: 194.512 bits (493), Expect = 5.156e-48
Identity = 268/1008 (26.59%), Postives = 494/1008 (49.01%), Query Frame = 3
Query:  309 YKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKL--------NLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQR---IKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIME 3299
            Y+  C +LE +++                 G   +     +  +LE  LI+LEEEQ++   L E N  L+  + +A   N+ L  D+ KL+ +W R+R+EL ++E  WR E+  F  YL  EH  L NL R  + FRR F+++K++T+R++  LK E  R +  L T C  L+   +S ES     TE     +L         LE +  EK++EL   ++  + E  ELQ RV EL+ L  + + QN + ++ + AL+    I   + A  +  E   +R   E+  S+ Q ++ I+Q + +     + EDT  ++    +   S     S          P   D     VQS + ++   +Q+L+ +L+  +E+ +  ++Q D  E E R       A+R++++ L  ++D    +    +  ++  S ER  L+K R  L  Q+E    E  RL+  N ELQ   ++ + E+ + +++L   ++E ER Q ++  LE K S    +++  +EA+   +LE E+L QE+ E+  AL+R E S  EL    N  +    +L     KL +  E L   + E ++ + QLE E  SL +     EQ +S L+ +L  +E+    L  +K     ++++ E     L+ EL     EK +L +++     Q+      L Q  ++ ER   ++    +EKE L +E+  L V++ A ER+ +  +E +  L S +EQLE+ L++AQQ    ++  K QLE + Q +I  KE + GE+  L+ E   E  +     + +  +  Q ++E + ++++++ +H E+V RL +  E  R   + E ++ +     ER ++     +++ EM  E +  QRE + S   A++   Q     E+E+ ++ E L++TQ EL     +L+R++++   ++ ++++    L ++L+  + + ++  Q H  ++ +      DL        K+V DL + L   ++++  ++ EI E
Sbjct:   65 YRSWCQDLEKRLE--------------ATGGLIPQRWESVEEPNLEQLLIRLEEEQQRCESLVEVNTELRLHMEKADVVNKALQEDVEKLTVDWSRARDELVRKESQWRMEQEFFKGYLRGEHGRLLNLWREVVTFRRHFLKMKSATDRDLTELKAEHARLSGSLLTCCLRLTLRAQSRESSGSGRTEESEPARLLLLVAKTQALEKEAHEKSQELMQLKSHGDLEKAELQDRVTELSALLTQSQKQNEDYEKMVKALRETMEILETNHAELMEHEASLSRNAQEEKLSLQQVIKAITQALAS----VEEEDTVTQSSGHEDSLQSDCNGLSQFD-------PQDPDRALTLVQSVLTRRQQAVQDLRQQLSGCQEAMSFLQQQHDQWEEEGR-------ALREKLQKLTGERDALAGQTVGLQGEVDSLSRERELLQKARGELQQQLEVLEQEAWRLRRMNMELQLQGDSAQGEKLEQQEELHLAVRERERLQETLVGLEAKQSESLSELLTLREALESSRLEGELLKQERVEVAAALARAEQSIVELSGSENSLKAEVADLRAAAVKLGALNEALALDKVELNQQLLQLEQENQSLCSRVEAAEQLRSALQVDLAEAERRREALWEKKTQLETQLQKAEEAGAELQAELRGTREEKEELKDKLSEAHHQQETATAHLEQLHQDAERQEETLARAVQEKEALVRERAALEVRLQAVERDRQDLTEHVLGLRSAKEQLESNLFEAQQQNSVIQVTKGQLEVQIQTIIQAKEVIQGEVKCLKLELDAERTRAEQEWDAVARQLAQAEQEGQASLERQKVAHEEEVNRLQEKWEKERSWLQQELDKTLETLERERAELETKLREQQTEM--EAIRAQREEERS--QADSALYQMQLETEKERVSLLETLLRTQKELADASQQLERLRQDMKIQKLKEQETTGMLQAQLQETQQELKEAAQQHRDDLAAFQKDKLDLQ-------KQVEDLMSQLVAHDDSQRLVKEEIEE 1029          
BLAST of Rootletin vs. TrEMBL
Match: gnl|BL_ORD_ID|18247968 (tr|A0A267F2Q1|A0A267F2Q1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001435g3 PE=4 SV=1)

HSP 1 Score: 1746.87 bits (4523), Expect = 0.000e+0
Identity = 1048/2017 (51.96%), Postives = 1458/2017 (72.29%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTE--LES---KMQFGDYETRKTKYGSPTNNGYGSRSENPYDNL-DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDT------------AGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD-YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENV---VTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNT--YATTTDGKGSPIPRTGSPSSKRRQLSRS--PSNCDF-NPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM-------CGSRDQSPTRQKRIEMSKKSAAPNN--SNRRLTAG 6107
            +GL+Q+N++LRKRL++E   Y+RKL  +Q+ QQ+QAQLVQ+LQ KVL YK+K +E  LE+   K Q   ++     Y    ++    RS    D+  DLES LI+LEEEQ+++  L   N  L+EQL QATQ NQ+LT D+ +LSE++QR+R +LE+RE  WR+EE SF++Y +SEH+ L +L RN ++FRRQF ELK + ER++NN KNE  RQ+R +  AC NL+ N+KSAE++  ++ ++E   + NLE+ LRE+ REL D Q ++E    +L  RV EL+V ++KLK Q  EKDR L+ LQR+++               A     +D ATR LIE+TE+MHQ+LR+I+Q V++D+D Y D  D G     +        R        + +++P FAD+TY+AVQ+A+NK++LQ+QEL+ KL S+K++  N +RQ+D++ENERRRLE+QVL +R+E+++++R + DS R+ +R K+AL     ERSQLEK+RS+LN+QIE    +++RL+ AN ELQR R+ LED++ D KKDL+RQ+KE+ERCQR ID LE+K+S  K D+V  KE +N+  LEKEVL QEK E+ DALSR E++KAELE+E+NK ++ E  L + + K+ S  E L   + E ++ +   E+E++ L  EK+ LEQEK G+++EL+R EQE + L NEKA   Q +E  E++ E+LE+EL  +NRE+L+L EQ+  + RQK ALAEELL  RRE ER++N+V  ++KEKE LTKEKGELVVQ+TACERE R+  E+ + L +D++QLE  L++AQ+LI+QLETRK QLEGENQELI+KKENLN E+ R+ +EF++E +K+   RE L  + QQM+++ K A+ QE+ SH +D+ERLTK  ++ R   EN+R+E+IH+ NMER++M+ ++E+E++++  EI   QRERD+SL++AEN+KQQ+LS++EQEK  I E+L  T  ELQ+V SELDR ++E++ +Q+QDK+ I  L+ ELK FR QFE   + HE EV+ LN  I +LT  ++ A +EV +L   L++AE+ RDNLRRE+++ NR+++E EEA +  KREI ELKR L EE R +E V  SNE LRKKIK++E ERI+  R + + KQ++ V +EQ     +EV +LR NL++VEKAR++ KRELQELRR +K LDTERGKL KEV DLQ+RVA DEEK++E RRENFGLKQKVVETEASREA+RK+L N++R   DLE  L+SK RDF+  +E +R++ R+L DAR+ LQ   +   A+NNELR AL GAEGR++ALE+ +AR +  KKE+E+KLASIHSS+RRLIGFRQ+N      +R R+ S +     +           TKGFD +  +ATT +G+GSPIPR+GSP+++ R   RS  PS  D  N  DI+PEAVRLALR+FVQQLV+ ER+RDDA A ARSLE R+ E EE  +  E R QQL + LC+ EEDKKGIDGRL+SAQTALM+QEETIRRNER++KA+ +K+S  +R  + +E+EKRQL+++LNK + HDAR EE+ K  K+++++ ENR TQL+L KR+LEGDLQRM++AL DK+ E +VL DRV++L KQI DLE K+QSLQLTI+R+SV+LAKTEE+GS  KD++QQLN S+S  +  ++ LQ ++ QLQKAL SSE DRR+L+ERL+++  A++EAKHQN+ L+ER+Q +Q +L D+E+RR++LE  NRQ+N+L+ Q+QEAEQEL QK  K N E+  +QERV S+QR LA  E EK+EI K+  +LEKD++ALKK+L KVER++++TEE ASK+ F R ELD  LRRLE+EN  LQRQV  LQ+ LAEAEQAH   LM++ ++HR+E   E+E L+A  +  ERTLE RER HRQRVKGLEEQ++TLKDQL  E++RR     + S           D+R +LDSSL  V++DP LDA L + E+RRLDE++ +        G R  SP+R      + +S+ P+   +  RL+ G
Sbjct:   24 RGLMQMNMDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKKVSESDLENQRLKTQLRSFKQSNDSYQFKLDSETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRDFSDAG-----RGRSVSPVGRGGRSPAGRQRSRSPAFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLNAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQEMIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKKIKEMEAERIERDRSIAEQKQRIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEDARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRSPSPMRGRSPSPARRSRPNSP---------TKGFDGSQPFATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDLQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAAMNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEDSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDKVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRR---NQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALDLHNAFPGGAGKRAGSPSRLGGAGGALRSSTPSGRPAGMRLSRG 2023          
BLAST of Rootletin vs. TrEMBL
Match: gnl|BL_ORD_ID|18314330 (tr|A0A267H6I3|A0A267H6I3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018782g1 PE=4 SV=1)

HSP 1 Score: 1745.33 bits (4519), Expect = 0.000e+0
Identity = 1048/2017 (51.96%), Postives = 1457/2017 (72.24%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTE--LES---KMQFGDYETRKTKYGSPTNNGYGSRSENPYDNL-DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDT------------AGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD-YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENV---VTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNT--YATTTDGKGSPIPRTGSPSSKRRQLSRS--PSNCDF-NPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM-------CGSRDQSPTRQKRIEMSKKSAAPNN--SNRRLTAG 6107
            +GL+Q+N++LRKRL++E   Y+RKL  +Q+ QQ+QAQLVQ+LQ KVL YK+K +E  LE+   K Q   ++     Y    ++    RS    D+  DLES LI+LEEEQ+++  L   N  L+EQL QATQ NQ+LT D+ +LSE++QR+R +LE+RE  WR+EE SF++Y +SEH+ L +L RN ++FRRQF ELK + ER++NN KNE  RQ+R +  AC NL+ N+KSAE++  ++ ++E   + NLE+ LRE+ REL D Q ++E    +L  RV EL+V ++KLK Q  EKDR L+ LQR+++               A     +D ATR LIE+TE+MHQ+LR+I+Q V++D+D Y D  D G     +        R        + +++P FAD+TY+AVQ+A+NK++LQ+QEL+ KL S+K++  N +RQ+D++ENERRRLE+QVL +R+E+++++R + DS R+ +R K+AL     ERSQLEK+RS+LN+QIE    +++RL+ AN ELQR R+ LED++ D KKDL+RQ+KE+ERCQR ID LE+K+S  K D+V  KE +N+  LEKEVL QEK E+ DALSR E++KAELE+E+NK ++ E  L + + K+ S  E L   + E ++ +   E+E++ L  EK+ LEQEK G+++EL+R EQE + L NEKA   Q +E  E++ E+LE+EL  +NRE+L+L EQ+  + RQK ALAEELL  RRE ER++N+V  ++KEKE LTKEKGELVVQ+TACERE R+  E+ + L +D++QLE  L++AQ+LI+QLETRK QLEGENQELI+KKENL  E+ R+ +EF++E +K+   RE L  + QQM+++ K A+ QE+ SH +D+ERLTK  ++ R   EN+R+E IH+ NMER++M+ ++E+E++++  EI   QRERD+SL++AEN+KQQ+LS++EQEK  I E+L  T  ELQ+V SELDR ++E++ +Q+QDK+ I  L+ ELK FR QFE   + HE EV+ LN  I +LT  ++ A +EV +L   L++AE+ RDNLRRE+++ NR+++E EEA +  KREI ELKR L EE R +E V  SNE LRKKIK++E ERI+  R + + KQ++ V +EQ     +EV +LR NL++VEKAR++ KRELQELRR +K LDTERGKL KEV DLQ+RVA DEEK++E RRENFGLKQKVVETEASREA+RK+L N++R   DLE  L+SK RDF+  +E +R++ R+L DAR+ LQ   +   A+NNELR AL GAEGR++ALE+ +AR +  KKE+E+KLASIHSS+RRLIGFRQ+N      +R R+ S +     +           TKGFD +  +ATT +G+GSPIPR+GSP+++ R   RS  PS  D  N  DI+PEAVRLALR+FVQQLV+ ER+RDDA A ARSLE R+ E EE  +  E R QQL + LC+ EEDKKGIDGRL+SAQTALM+QEETIRRNER++KA+ +K+S  +R  + +E+EKRQL+++LNK + HDAR EE+ K  K+++++ ENR TQL+L KR+LEGD+QRM++AL DK+ E +VL DRV++L KQI DLE K+QSLQLTI+R+SV+LAKTEE+GS  KD++QQLN S+S  +  ++ LQ ++ QLQKAL SSE DRR+L+ERL+++  AL+EAKHQN+ L+ER+Q +Q +L D+E+RR++LEG NRQ+N+L+ Q+QEAEQEL QK  K N E+  +QERV S+QR LA  E EK+EI K+  +LEKD++ALKK+L KVER++++TEE ASK+ F R ELD  LRRLE+EN  LQRQV  LQ+ LAEAEQAH   LM++ ++HR+E   E+E L+A  +  ERTLE RER HRQRVKGLEEQ++TLKDQL  E++RR     + S           D+R +LDSSL  V++DP LDA L + E+RRLDE++ +        G R  SP+R      + +S+ P+   +  RL+ G
Sbjct:   24 RGLMQMNMDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKKVSESDLENQRLKTQLRSFKQSNDSYQFKLDSETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRDFSDAG-----RGRSVSPVGRGGRSPAGRQRSRSPAFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLTAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQETIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKKIKEMEAERIERDRSIAEQKQRIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEEARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRSPSPMRGRSPSPARRSRPNSP---------TKGFDGSQPFATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDMQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAALNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEGSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDKVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRR---NQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALDLHNAFPGGAGKRAGSPSRLGGAGGALRSSTPSGRPAGMRLSRG 2023          
BLAST of Rootletin vs. TrEMBL
Match: gnl|BL_ORD_ID|18229458 (tr|A0A1I8FWZ5|A0A1I8FWZ5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1714.51 bits (4439), Expect = 0.000e+0
Identity = 1039/2017 (51.51%), Postives = 1444/2017 (71.59%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTE--LES---KMQFGDYETRKTKYGSPTNNGYGSRSENPYDNL-DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDT------------AGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD-YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENV---VTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNT--YATTTDGKGSPIPRTGSPSSKRRQLSRS--PSNCDF-NPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM-------CGSRDQSPTRQKRIEMSKKSAAPNN--SNRRLTAG 6107
            +GL+Q+N++LRKRL++E   Y+RKL  +Q+ QQ+QAQLVQ+LQ KVL YK+K +E  LE+   K Q   ++     Y    ++    RS    D+  DLES LI+LEEEQ+++  L   N  L+EQL QATQ NQ+LT D+ +LSE++QR+R +LE+RE  WR+EE SF++Y +SEH+ L +L RN ++FRRQF ELK + ER++NN KNE  RQ+R +  AC NL+ N+KSAE++  ++ ++E   + NLE+ LRE+ REL D Q ++E    +L  RV EL+V ++KLK Q  EKDR L+ LQR+++               A     +D ATR LIE+TE+MHQ+LR+I+Q V++D+D Y D  D G     +        R        + +++P FAD+TY+AVQ+A+NK++LQ+QEL+ KL S+K++  N +RQ+D++ENERRRLE+QVL +R+E+++++R + DS R+ +R K+AL     ERSQLEK+RS+LN+QIE    +++RL+ AN ELQR R+ LED++ D KKDL+RQ+KE+ERCQR ID LE+K+S  K D+V  KE +N+  LEKEVL QEK E+ DALSR E++KAELE+E+NK ++ E  L + + K+ S  E L   + E ++ +   E+E++ L  EK+ LEQEK G+++EL+R EQE + L NEKA   Q +E  E++ E+LE+EL  +NRE+L+L EQ+  + RQK ALAEELL  RRE ER++N+V  ++KEKE LTKEKGELVVQ+TACERE R+  E+ + L +D++QLE  L++AQ+LI+QLETRK QLEGENQELI+KKENLN E+ R+ +EF++E +K+   RE L  + QQM+++ K A+ QE+ SH +D+ERLTK  ++ R   EN+R+E+IH+ NMER++M+ ++E+E++++  EI   QRERD+SL++AEN+KQQ+LS++EQEK  I E+L  T  ELQ+V SELDR ++E++ +Q+QDK+ I  L+ ELK FR QFE   + HE EV+ LN  I +LT  ++ A +EV +L   L++AE+ RDNLRRE+++ NR+++E EEA +  KREI ELKR L EE R +E V  SNE LRKK                    ++ V +EQ     +EV +LR NL++VEKAR++ KRELQELRR +K LDTERGKL KEV DLQ+RVA DEEK++E RRENFGLKQKVVETEASREA+RK+L N++R   DLE  L+SK RDF+  +E +R++ R+L DAR+ LQ   +   A+NNELR AL GAEGR++ALE+ +AR +  KKE+E+KLASIHSS+RRLIGFRQ+N      +R R+ S +     +           TKGFD +  +ATT +G+GSPIPR+GSP+++ R   RS  PS  D  N  DI+PEAVRLALR+FVQQLV+ ER+RDDA A ARSLE R+ E EE  +  E R QQL + LC+ EEDKKGIDGRL+SAQTALM+QEETIRRNER++KA+ +K+S  +R  + +E+EKRQL+++LNK + HDAR EE+ K  K+++++ ENR TQL+L KR+LEGDLQRM++AL DK+ E +VL DRV++L KQI DLE K+QSLQLTI+R+SV+LAKTEE+GS  KD++QQLN S+S  +  ++ LQ ++ QLQKAL SSE DRR+L+ERL+++  A++EAKHQN+ L+ER+Q +Q +L D+E+RR++LE  NRQ+N+L+ Q+QEAEQEL QK  K N E+  +QERV S+QR LA  E EK+EI K+  +LEKD++ALKK+L KVER++++TEE ASK+ F R ELD  LRRLE+EN  LQRQV  LQ+ LAEAEQAH   LM++ ++HR+E   E+E L+A  +  ERTLE RER HRQRVKGLEEQ++TLKDQL  E++RR     + S           D+R +LDSSL  V++DP LDA L + E+RRLDE++ +        G R  SP+R      + +S+ P+   +  RL+ G
Sbjct:  131 RGLMQMNMDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKKVSESDLENQRLKTQLRSFKQSNDSYQFKLDSETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRDFSDAG-----RGRSVSPVGRGGRSPAGRQRSRSPAFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLNAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQEMIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKK--------------------RIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEDARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRSPSPMRGRSPSPARRSRPNSP---------TKGFDGSQPFATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDLQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAAMNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEDSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDKVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRR---NQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALDLHNAFPGGAGKRAGSPSRLGGAGGALRSSTPSGRPAGMRLSRG 2110          
BLAST of Rootletin vs. TrEMBL
Match: gnl|BL_ORD_ID|17038078 (tr|A0A1S3JC29|A0A1S3JC29_LINUN rootletin-like isoform X4 OS=Lingula unguis OX=7574 GN=LOC106171578 PE=4 SV=1)

HSP 1 Score: 1665.59 bits (4312), Expect = 0.000e+0
Identity = 1025/2010 (51.00%), Postives = 1450/2010 (72.14%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESK-MQFGDYETRKTKYGSPTNNGYGSRSENPYDNL---------DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEI-------NMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFET--VXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQE----NVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSP----SSKRRQLSRSPSNCD--FNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRIEMSKKSAAPNNSNRRLTAG 6107
            K L+  N+ELR++LEEEH  Y+RKL  +QD QQ+QAQLVQ+LQ KVLQYK+KC ELE++  QF     +  +    T +   SR E     L         DLE+ LIKLEEEQ++++ L   N  L+EQL QAT +NQ LT+DI +L+ +WQR+REELEQ+E  WR+EE SFN+Y ++EHS L +L R  + FRRQF E+K++TER++++++ +  R +R + +AC NLS N++S +++ Q+S +R+  D+  LENQLR+K RE+ + QT+++   +EL  +V ELT++++KLKIQ +EKD++++ LQ   +   AG +       +ME +A++ + E+TE++H ALR+I+Q V++D+D    ED G  T  + ++       R R+ + ++  +++P FAD+T++AVQ+A+NK+ LQ+QE+++K N+SK+     ++Q+DD ENERRR+E Q++  R+E+++ RRDK+DSFR+ DRFKN L++T +E+SQLE++R +LN+QIE   TE E+L++AN E+QR R+ +EDE++D  KD ERQIKE+ERC + I+ LE K+S+ +ED V  KE ++K QL+K+VL  EK E+G+ALS+ E+  AELE+ VNK +T E  L + + K+ +  E L   + E ++ I QLE E++SL  EK  +  EKSG+++ELVR EQE + L  EK    Q +E  E   E L+EE++ LNREK+++TEQ+  + RQKSALAEELLQ R+E ER +++V  ++KEKE LTKEK  L+VQ+T+ ERENRQQSE+IA   +D+E LE  LY+AQQL  QLETRKEQLEGENQELI++KE L  E+ RLR+E +LE EK+   +E +  +  Q +++  +++ QE+ +H ED+ERLT+  E+ R   E  REE++H   ME+++MI   E EK+++ QE+  IQRERDDS+L AENEKQQ LSL+EQEK  + EKL  TQ +LQS   E +R+K+ES +RQE DK +I GL +ELK FRSQFE+     + E+K LN  +++L   K+QAL+EV +L   LK+ EETRD +RR+++E NRK++EA+E KE +++EI +LKR + +E REKE V  +NE LR KIK  E E+I+L R + ++KQ++ + +EQ    ++E ++LR +L++VEKARLD +RELQELRR +K LD+ER KL KEV DLQ RVARDEEKE+E+RRE +GLKQKVVETEASREA+RK+LAN QR   +LE+  + K++D+   +E SRR+ RKL + R +L+   +    +  EL++ALSGAEGRV+ALE+ +ARVEGAK+++EFKL+SIHS+LRR IGFRQ+       T+R+R+ S    R  S            KGFDNT+ TTTDG+GSPI RTGSP    S  RR+   SPS  D   +  DI+PEAVR+ALR+FVQQL  +ER+RDD  +Q RSL  +LKE EE  +  E RLQQLQ++L +AEEDK+GID RL+SAQTALM+QEETIRRNER+RK MAEK++  +R  A+MESEKRQL++R+ K + ++A+LEE+ KQ + A++++E R T+ +LAKRS+EGDLQR+K+A+ DKETE +VL +R+++L +Q+QDL+ K QSLQLTIDR+S AL+KTEEE S  KDK+Q LNMSLS  S  +  LQ ++ QLQ+AL SSE DRR+L+ERL++++ A +EAK QN+ LMER+Q IQ++L+DSE RR+ELEG  RQ++ +IVQRQE EQELNQ+ QKL +EK  LQERV S+QR  A  E +K+EI +N  + EKD+SALKK+L KVER+K+KTEE+AS+++ E+  ++  L+RLE+EN +LQRQ+  +Q Q+AE EQAH   L+++ +RHR E  ME E LR++ +Q ERTLE RERAHRQRVKGLEEQI+TLKDQL  EM++R       STR     D   D+R++LDSSL  VA+DP LD +LL+ E  +L +++    +   SPTR     +S +  +P  S   +  G
Sbjct:   39 KSLVTQNVELRRKLEEEHASYKRKLQAYQDGQQRQAQLVQKLQAKVLQYKKKCGELEAQNSQFKSESQQVKRSLQSTQDVLQSRLETTEARLRMAEEDASMDLETALIKLEEEQQRSSSLAHVNSMLREQLDQATSANQQLTQDIHRLTTDWQRAREELEQKESEWRDEEQSFNEYFSAEHSRLLSLWRAVVAFRRQFGEMKSATERDLSHIRADLTRTSRSMHSACLNLSANLRSMDTQSQVSADRDRSDRNALENQLRDKVREVMELQTKFDIHTSELNSKVNELTMMNEKLKIQLIEKDKSISTLQANMDRVDAGRMEAARERESMEVEASQTMREETEALHAALRDIAQAVISDADQSKLEDEGASTAELARSMSPSRSPRMRTRTRSASPSRSPAFADSTFSAVQAALNKRQLQVQEMRAKFNASKDQNAALRKQLDDTENERRRIERQMMEYREELDNARRDKEDSFRDRDRFKNQLDLTGSEKSQLERMRQALNEQIEALNTENEKLQAANSEIQRQRDNIEDEKDDVIKDKERQIKENERCHKVIEQLEMKLSKLREDFVETKETLHKSQLDKDVLENEKAEMGEALSKAELRMAELELAVNKLKTEEAGLRDALLKMQALNEGLGQDKIELNKIIMQLEAEKASLFGEKHAIIAEKSGIQEELVRVEQEKMDLDTEKLGLNQTVEIHEQTVENLQEEITILNREKVEITEQLNSVSRQKSALAEELLQSRKECERQSDTVVRIAKEKEDLTKEKASLIVQLTSSERENRQQSEIIAGFKADKESLENALYEAQQLNAQLETRKEQLEGENQELILRKEALQAEIARLRKEMELEIEKLERQKESITAKLGQTERDLNVSLTQEKQAHEEDIERLTREKETQRIEYEANREEILHHNAMEKEEMIARAENEKEQLQQELAAIQRERDDSMLFAENEKQQVLSLMEQEKSTLAEKLNSTQKDLQSQIVENERLKRESMSRQESDKNSINGLQAELKKFRSQFEEATVAQDRELKDLNGRMQELQRQKEQALREVAELKVQLKMVEETRDTIRRDLIEANRKIREADETKELMRKEIGDLKRSVNDEVREKEAVQKANEELRNKIKRAEGEKIELSRNLQEAKQRIGILEEQKTGVQKEASDLRASLREVEKARLDARRELQELRRQVKMLDSERSKLGKEVGDLQNRVARDEEKEEESRREQYGLKQKVVETEASREALRKELANLQRRYAELEDESRVKEKDYQMALEDSRRNERKLEEIRRNLETNLEACNNEIGELKLALSGAEGRVNALEAQLARVEGAKRDVEFKLSSIHSTLRRTIGFRQDMPRSPSPTMRARSPSPRRTRPTSP----------AKGFDNTFTTTTDGRGSPIARTGSPDRARSPTRRERDMSPSRLDQSVSIADIDPEAVRIALRDFVQQLAGSERERDDCLSQVRSLSMQLKEMEEDRDRTEARLQQLQKSLGEAEEDKRGIDSRLASAQTALMLQEETIRRNERERKTMAEKINTLERGLAAMESEKRQLQERVGKMKQNEAKLEEDKKQLRMALDDSEQRCTKTELAKRSMEGDLQRLKLAMNDKETENQVLQERIDNLTRQMQDLDSKCQSLQLTIDRLSNALSKTEEEESVQKDKVQVLNMSLSEQSATIADLQERVQQLQRALTSSEHDRRVLQERLDTTRQAQNEAKKQNHSLMERVQAIQNELSDSEVRRNELEGQVRQAHGIIVQRQEQEQELNQRLQKLGTEKQGLQERVASLQRQYAQLETDKREIERNVIRTEKDKSALKKTLDKVEREKMKTEEVASRSMTEKGSMEGTLKRLEEENMDLQRQLQSMQAQMAEMEQAHSQRLIDLTTRHRSETEMETERLRSAQLQAERTLEARERAHRQRVKGLEEQINTLKDQLAQEMRKRQ-QFIQRSTRTG---DDIKDIRNILDSSLGTVARDPGLDTLLLDHETSKLGDTVDHHST--ISPTR-----LSPRRRSPTRSTSPVRLG 2027          
BLAST of Rootletin vs. TrEMBL
Match: gnl|BL_ORD_ID|16984382 (tr|A0A1S3HNJ8|A0A1S3HNJ8_LINUN rootletin-like isoform X5 OS=Lingula unguis OX=7574 GN=LOC106156388 PE=4 SV=1)

HSP 1 Score: 1665.59 bits (4312), Expect = 0.000e+0
Identity = 1023/2010 (50.90%), Postives = 1452/2010 (72.24%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYG-SPTNNGYGSRSENPYDNL---------DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEI-------NMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFET--VXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQE----NVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSP----SSKRRQLSRSPSNCD--FNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRIEMSKKSAAPNNSNRRLTAG 6107
            K L+  N+ELR++LEEEH  Y+RKL  +QD QQ+QAQLVQ+LQ KVLQYK+KC ++E  +Q  + E  ++++    T +   SR E     L         DLE+ LIKLEEEQ++++ L   N  L+EQL QAT +NQ LT+DI +L+ +WQR+REELEQ+E  WR+EE SFN+Y ++EHS L +L R  + FRRQF E+K++TER++++++ +  R +R + +AC NLS N++S +++ Q+S +R+  D+  LENQLR+K RE+ + QT+++   +EL  +V ELT++++KLKIQ +EKD++++ LQ   +   AG +       +ME +A++ + E+TE++H ALR+I+Q V++D+D    ED G  T  + ++       R R+ + ++  +++P FAD+T++AVQ+A+NK+ LQ+QE+++K N+SK+     ++Q+DD ENERRR+E Q++  R+E+++ RRDK+DSFR+ DRFKN L++T +E+SQLE++R +LN+QIE   TE E+L++AN E+QR R+ +EDE++D  KD ERQIKE+ERC + I+ LE K+S+ +ED V  KE ++K QL+K+VL  EK E+G+ALS+ E+  AELE+ VNK +T E  L + + K+ +  E L   + E ++ I QLE E++SL  EK  +  EKSG+++ELVR EQE + L  EK    Q +E  E   E L+EE++ LNREK+++TEQ+  + RQKSALAEELLQ R+E ER +++V  ++KEKE LTKEK  L+VQ+T+ ERENRQQSE+IA   +D+E LE  LY+AQQL  QLETRKEQLEGENQELI++KE L  E+ RLR+E +LE EK+   +E +  +  Q +++  +++ QE+ +H ED+ERLT+  E+ R   E  REE++H   ME+++MI   E EK+++ QE+  IQRERDDS+L AENEKQQ LSL+EQEK  + EKL  TQ +LQS   E +R+K+ES +RQE DK +I GL +ELK FRSQFE+     + E+K LN  +++L   K+QAL+EV +L   LK+ EETRD +RR+++E NRK++EA+E KE +++EI +LKR + +E REKE V  +NE LR KIK  E E+I+L R + ++KQ++ + +EQ    ++E ++LR +L++VEKARLD +RELQELRR +K LD+ER KL KEV DLQ RVARDEEKE+E+RRE +GLKQKVVETEASREA+RK+LAN QR   +LE+  + K++D+   +E SRR+ RKL + R +L+   +    +  EL++ALSGAEGRV+ALE+ +ARVEGAK+++EFKL+SIHS+LRR IGFRQ+       T+R+R+ S    R  S            KGFDNT+ TTTDG+GSPI RTGSP    S  RR+   SPS  D   +  DI+PEAVR+ALR+FVQQL  +ER+RDD  +Q RSL  +LKE EE  +  E RLQQLQ++L +AEEDK+GID RL+SAQTALM+QEETIRRNER+RK MAEK++  +R  A+MESEKRQL++R+ K + ++A+LEE+ KQ + A++++E R T+ +LAKRS+EGDLQR+K+A+ DKETE +VL +R+++L +Q+QDL+ K QSLQLTIDR+S AL+KTEEE S  KDK+Q LNMSLS  S  +  LQ ++ QLQ+AL SSE DRR+L+ERL++++ A +EAK QN+ LMER+Q IQ++L+DSE RR+ELEG  RQ++ +IVQRQE EQELNQ+ QKL +EK  LQERV S+QR  A  E +K+EI +N  + EKD+SALKK+L KVER+K+KTEE+AS+++ E+  ++  L+RLE+EN +LQRQ+  +Q Q+AE EQAH   L+++ +RHR E  ME E LR++ +Q ERTLE RERAHRQRVKGLEEQI+TLKDQL  EM++R       STR     D   D+R++LDSSL  VA+DP LD +LL+ E  +L +++    +   SPTR     +S +  +P  S   +  G
Sbjct:   39 KSLVTQNVELRRKLEEEHASYKRKLQAYQDGQQRQAQLVQKLQAKVLQYKKKCGQMEDILQQKELELHRSRFSLQSTQDVLQSRLETTEARLRMAEEDASMDLETALIKLEEEQQRSSSLAHVNSMLREQLDQATSANQQLTQDIHRLTTDWQRAREELEQKESEWRDEEQSFNEYFSAEHSRLLSLWRAVVAFRRQFGEMKSATERDLSHIRADLTRTSRSMHSACLNLSANLRSMDTQSQVSADRDRSDRNALENQLRDKVREVMELQTKFDIHTSELNSKVNELTMMNEKLKIQLIEKDKSISTLQANMDRVDAGRMEAARERESMEVEASQTMREETEALHAALRDIAQAVISDADQSKLEDEGASTAELARSMSPSRSPRMRTRTRSASPSRSPAFADSTFSAVQAALNKRQLQVQEMRAKFNASKDQNAALRKQLDDTENERRRIERQMMEYREELDNARRDKEDSFRDRDRFKNQLDLTGSEKSQLERMRQALNEQIEALNTENEKLQAANSEIQRQRDNIEDEKDDVIKDKERQIKENERCHKVIEQLEMKLSKLREDFVETKETLHKSQLDKDVLENEKAEMGEALSKAELRMAELELAVNKLKTEEAGLRDALLKMQALNEGLGQDKIELNKIIMQLEAEKASLFGEKHAIIAEKSGIQEELVRVEQEKMDLDTEKLGLNQTVEIHEQTVENLQEEITILNREKVEITEQLNSVSRQKSALAEELLQSRKECERQSDTVVRIAKEKEDLTKEKASLIVQLTSSERENRQQSEIIAGFKADKESLENALYEAQQLNAQLETRKEQLEGENQELILRKEALQAEIARLRKEMELEIEKLERQKESITAKLGQTERDLNVSLTQEKQAHEEDIERLTREKETQRIEYEANREEILHHNAMEKEEMIARAENEKEQLQQELAAIQRERDDSMLFAENEKQQVLSLMEQEKSTLAEKLNSTQKDLQSQIVENERLKRESMSRQESDKNSINGLQAELKKFRSQFEEATVAQDRELKDLNGRMQELQRQKEQALREVAELKVQLKMVEETRDTIRRDLIEANRKIREADETKELMRKEIGDLKRSVNDEVREKEAVQKANEELRNKIKRAEGEKIELSRNLQEAKQRIGILEEQKTGVQKEASDLRASLREVEKARLDARRELQELRRQVKMLDSERSKLGKEVGDLQNRVARDEEKEEESRREQYGLKQKVVETEASREALRKELANLQRRYAELEDESRVKEKDYQMALEDSRRNERKLEEIRRNLETNLEACNNEIGELKLALSGAEGRVNALEAQLARVEGAKRDVEFKLSSIHSTLRRTIGFRQDMPRSPSPTMRARSPSPRRTRPTSP----------AKGFDNTFTTTTDGRGSPIARTGSPDRARSPTRRERDMSPSRLDQSVSIADIDPEAVRIALRDFVQQLAGSERERDDCLSQVRSLSMQLKEMEEDRDRTEARLQQLQKSLGEAEEDKRGIDSRLASAQTALMLQEETIRRNERERKTMAEKINTLERGLAAMESEKRQLQERVGKMKQNEAKLEEDKKQLRMALDDSEQRCTKTELAKRSMEGDLQRLKLAMNDKETENQVLQERIDNLTRQMQDLDSKCQSLQLTIDRLSNALSKTEEEESVQKDKVQVLNMSLSEQSATIADLQERVQQLQRALTSSEHDRRVLQERLDTTRQAQNEAKKQNHSLMERVQAIQNELSDSEVRRNELEGQVRQAHGIIVQRQEQEQELNQRLQKLGTEKQGLQERVASLQRQYAQLETDKREIERNVIRTEKDKSALKKTLDKVEREKMKTEEVASRSMTEKGSMEGTLKRLEEENMDLQRQLQSMQAQMAEMEQAHSQRLIDLTTRHRSETEMETERLRSAQLQAERTLEARERAHRQRVKGLEEQINTLKDQLAQEMRKRQ-QFIQRSTRTG---DDIKDIRNILDSSLGTVARDPGLDTLLLDHETSKLGDTVDHHST--ISPTR-----LSPRRRSPTRSTSPVRLG 2027          
BLAST of Rootletin vs. Ensembl Cavefish
Match: crocc2 (rootletin-like [Source:NCBI gene;Acc:103030367])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 617/1895 (32.56%), Postives = 1052/1895 (55.51%), Query Frame = 3
Query:  198 KRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSR----SENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQRE-KIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNL--SCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATR-VLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEK-AIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQ-----SKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            +RL +E   YR KL  +QDSQ +QAQLV +LQ KVLQYK++C E+E ++     E  K +    T+    +     SE  + +LD +S L  LEEE+++ + LT+ N  L+EQL QA ++NQ LT       E    ++EE EQR+ ++ R +EMS +  L  E + ++ L R   + R  F +L+A  +R +++++ EF    R L  AC NL    N  SA +  ++S          LE QL++K +E    Q R++ E  EL  R+ EL  +  +L+ QN EKD  L ALQ   + D       EDKA +  L ++   +   L +I + V +D D   ++  G E                         + P  D T  +VQ A++++    Q+L++ L+++ +     + ++ D+E+E R+LE ++  ++ E     +   +  R+A R++ +L + ++E+ +LEK       Q+     E+ERL+S++ ++QR R+ L  ++ED ++ L R+  E+ER  R+I+ LE K S  ++++V  +EA+++  L+KEVL  EK  +  ALS+ E   AE E+ + K Q+ E  L ++  K+++  E L   + E +R + Q+E E++ L   KR  E E++  ++EL   +QE + +  EK A++   +   E       E       +   L EQ+  +  QK AL E+L  C+RE E   +S+    +E+E L ++K  L VQ+TA +R  +  ++ +A+   + E LE+ ++D Q+ I  LE    +LEGE   L    E L  E+ R++ E + +  + +  R+ L  +  Q ++  + ++   + SH E +E   K  ES R     +RE++  +  +E +++      + Q++ +E+   Q+   DSLL AE+ KQQ+LS  E EK  + E+++  Q ++++   E +R++++  N+QEQDK   AGL SEL+  R  FE+   + E+  K LN  I++L+L + +A +EV  L   +   EE+RD +R+E++E   +L+E  + +E  +RE  EL+R L  E REKE +  SN+ LR  +K  E+E   L R + + +Q++ V +E   + +QE  ++RN+++++EK+ L  +RELQELRR +K L+ + G+  +EV +LQ R+ ++E++E+EAR+E+F LKQ+V+E++A REA  K++A  QR + +LE V +      + RD +S+ +S RR   + A    +LQ+V   +   N EL++    AEGR  +LE  +A  + ++ ++E +L+ + S+LRR +G      +  R+R+ +  P   R        P    KG ++         G P+     PS        SP + +   +D+  E+V+ ALR F Q+L DA+R+RDDA AQ  SL+ +L E +   E +  R QQL+ ++ D E+ K+ +  RL + Q +L +QEE  RR +R+R+ M E+LS       + ++  R L++RL +    +A L  E ++ K+  + AE R ++L+L+ R+LEG+LQR ++   + E E   L +R++SL +++ + E  +  L++  +R + ALA+ E + +  ++K+Q    +L          + + +QLQ  L +SE + R L+ERLE  + AL ++K QN  L ER+Q +Q    + E R SEL+         + QR++  +E       L  ++  LQERV ++Q +L   + ++ ++ K   +L KD++ALK++L KVE+++ + EE       ++ EL+Q L  LE +  +   +   L++QL+  EQAH   L+E+ +RHRQE+ +E E LR S  Q ER LE RE+AHRQRV+ LEEQ+ TLK+QL  EM+RR
Sbjct:  140 QRLRDESRAYRLKLQAYQDSQHRQAQLVHKLQTKVLQYKKRCGEMEQQVLEKTSELEKLRLSLQTHLDSSAHRFQLSEQEH-SLDAQSKLALLEEERRRCSGLTKVNALLREQLEQANEANQALT-------ESLHEAQEEAEQRDIRLRREQEMSAS-RLGREQARVRALWRQAASLRSTFTQLRAFADRNLSDIRGEFANANRKLHVACLNLQSGINEHSAPAGLEVSA---------LEKQLKDKLKEAMQLQGRFDAEKVELNSRIVELAEMVKQLRAQNSEKDSCLAALQ--SSLDRMEVSQAEDKAEKDTLRKEISGLQMILHSIGKAVCDDGDSSSSDSPGEELPSPVPTV-----------------SSPQRDNTLISVQRALSQRQKLTQDLQTCLDAALDQAAVLRDRLQDSESECRQLEQRIQQLQQENRHAEKAGVEISRDAQRYRTSLGLITSEKGELEKHLFVAQHQLNHDQAELERLRSSSLDVQRQRDILRQQREDLERQLARERSEAERGLRTIEQLEAKHSDVRKELVTVREALSQITLQKEVLEDEKASLEKALSKAEAQNAEQELALTKLQSEEAGLRDSFEKMAALCEGLAKDKVELNRVLLQVEAEKAELSERKREAELERAAAREELALIQQELMDVVAEKRALEASHVLLQESRAGLDTELTLLQREKSSVL-EQLAQVSEQKQALMEQLSVCQRESELQTSSLQRTGREREELARDKAGLSVQLTAEQRRAKTLAQELAAARVEWESLESAVFDGQEQISALEADLSRLEGERGNLQQANEALTREVSRIQSELEQQVSQALLERQALELKLTQAERNAQRSLASAQQSHQEQLEAERKDKESVRLALTAQREQVEEQLRVEYEELRLRSRTDLQQLQEELARAQQHCTDSLLQAESHKQQALSEKEAEKTVLTERILSLQRDIETTALETERMRRDFLNKQEQDKDTAAGLQSELQQLRLHFEESLSSREISEKRLNDQIRELSLQRHEAQQEVEQLRRSVLEVEESRDGVRKELVEARAELRECVQEREAGRRESLELRRALGNESREKEAIHTSNQELRTSVKRAESENNGLKRTLEEREQRLTVLEECKSSLQQEALKVRNSMRELEKSHLQARRELQELRRKVKTLEGQCGQQEQEVGELQARLVQEEQREEEARKESFSLKQRVLESDAGREAALKEVAGLQRRVAELEEVQRVEKECQRQRD-ASLQDSQRRQREETARLEGALQEVQAELREQNVELKL----AEGRGRSLEEQLALADASRSDLEQRLSGLSSALRRTLG------IGCRARSPTPRPRGRRPSPWRNRSPE---KGSESVS-------GGPMGSVQDPSV-------SPVHGEDGKLDV--ESVQAALRNFQQELRDAQRERDDAQAQVMSLKRQLSELQAGQEKSSARAQQLKHSIKDLEQGKRDLAERLEAVQASLSLQEEAGRRGDRERRVMEEELSRLKNGLQASDAGARALQERLERVEQSEAGLGAECRRLKECWDAAEARASRLELSHRTLEGELQRSQIRSAELEAELSSLQERMSSLRRELGESEECTALLKVEGERAATALARAELQEAQLREKLQSTAAALKESCSSAGAAKEQTAQLQSTLTASELEGRTLQERLEKMREALSDSKKQNYALSERLQNLQRTQEEYELRVSELDKHTHSLQEALRQREQVVEEARADCTVLQKDRVELQERVTNLQTSLHSLQDDRTQLDKILTRLGKDKAALKRTLQKVEQERRRQEEEVLCVGRQKEELEQSLSSLEQQLSDTHAESHTLKSQLSHLEQAHSQRLLEVTARHRQELELETERLRGSQQQAERALEAREKAHRQRVRCLEEQVCTLKEQLEQEMRRR 1966          
BLAST of Rootletin vs. Ensembl Cavefish
Match: crocc2 (rootletin-like [Source:NCBI gene;Acc:103030367])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 606/1895 (31.98%), Postives = 1030/1895 (54.35%), Query Frame = 3
Query:  198 KRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSR----SENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQRE-KIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNL--SCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATR-VLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEK-AIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQ-----SKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            +RL +E   YR KL  +QDSQ +QAQLV +LQ KVLQYK++C E+E ++     E  K +    T+    +     SE  + +LD +S L  LEEE+++ + LT+ N  L+EQL QA ++NQ LT       E    ++EE EQR+ ++ R +EMS +  L  E + ++ L R   + R  F +L+A  +R +++++ EF    R L  AC NL    N  SA +  ++S          LE QL++K +E    Q R++ E  EL  R+ EL  +  +L+ QN EKD  L ALQ   + D       EDKA +  L ++   +   L +I + V +D D   ++  G E                         + P  D T  +VQ A++++    Q+L++ L+++ +     + ++ D+E+E R+LE ++  ++ E     +   +  R+A R++ +L + ++E+ +LEK       Q+     E+ERL+S++ ++QR R+ L  ++ED ++ L R+  E+ER  R+I+ LE K S  ++++V  +EA+++  L+KEVL  EK  +  ALS+ E   AE E+ + K Q+ E  L ++  K+++  E L   + E +R + Q+E E++ L   KR  E E++  ++EL   +QE + +  EK A++   +   E       E       +   L EQ+  +  QK AL E+L  C+RE E   +S+    +E+E L ++K  L VQ+TA +R  +  ++ +A+   + E LE+ ++D Q+ I  LE    +LEGE   L    E L  E+ R++ E + +  + +  R+ L  +  Q ++  + ++   + SH E +E   K  ES R     +RE++  +  +E +++      + Q++ +E+   Q+   DSLL AE+ KQQ+LS  E EK  + E+++  Q ++++   E +R++++  N+QEQDK   AGL SEL+  R  FE+   + E+  K LN  I++L+L + +A +EV  L   +   EE+RD +R+E++E   +L+E  + +E  +RE  EL+R L  E REKE +  SN+ LR  +K  E+E   L R + + +Q++ V +E   + +QE  ++RN+++++EK+ L  +RELQELRR +K L+ + G+  +EV +LQ R+ ++E++E+EAR+E+F LKQ+V+E++A REA  K++A  QR + +LE V +      + RD +S+ +S RR   + A    +LQ+V   +   N EL++    AEGR  +LE  +A  + ++ ++E +L+ + S+LRR +G      +  R+R+ +  P   R        P    KG ++         G P+     PS        SP + +   +D+  E+V+ ALR F Q+L DA+R+RDDA AQ  SL+ +L E +   E +  R QQL+ ++ D E+ K+ +  RL + Q +L +QEE  RR +R+R+ M E+LS       + ++  R L++RL +    +A L  E ++ K+  + AE R ++L+L+ R+LEG+LQR ++   + E E   L +R++SL +++ + E  +  L++  +R + ALA+ E + +  ++K+Q    +L          + + +QLQ  L +SE + R L+ERLE  + AL ++K QN  L ER+Q +Q    + E R SEL+         + QR++  +E       L  ++  LQERV ++Q +L   + ++ ++ K   +L KD++ALK++L K                                            +QL+  EQAH   L+E+ +RHRQE+ +E E LR S  Q ER LE RE+AHRQRV+ LEEQ+ TLK+QL  EM+RR
Sbjct:  140 QRLRDESRAYRLKLQAYQDSQHRQAQLVHKLQTKVLQYKKRCGEMEQQVLEKTSELEKLRLSLQTHLDSSAHRFQLSEQEH-SLDAQSKLALLEEERRRCSGLTKVNALLREQLEQANEANQALT-------ESLHEAQEEAEQRDIRLRREQEMSAS-RLGREQARVRALWRQAASLRSTFTQLRAFADRNLSDIRGEFANANRKLHVACLNLQSGINEHSAPAGLEVSA---------LEKQLKDKLKEAMQLQGRFDAEKVELNSRIVELAEMVKQLRAQNSEKDSCLAALQ--SSLDRMEVSQAEDKAEKDTLRKEISGLQMILHSIGKAVCDDGDSSSSDSPGEELPSPVPTV-----------------SSPQRDNTLISVQRALSQRQKLTQDLQTCLDAALDQAAVLRDRLQDSESECRQLEQRIQQLQQENRHAEKAGVEISRDAQRYRTSLGLITSEKGELEKHLFVAQHQLNHDQAELERLRSSSLDVQRQRDILRQQREDLERQLARERSEAERGLRTIEQLEAKHSDVRKELVTVREALSQITLQKEVLEDEKASLEKALSKAEAQNAEQELALTKLQSEEAGLRDSFEKMAALCEGLAKDKVELNRVLLQVEAEKAELSERKREAELERAAAREELALIQQELMDVVAEKRALEASHVLLQESRAGLDTELTLLQREKSSVL-EQLAQVSEQKQALMEQLSVCQRESELQTSSLQRTGREREELARDKAGLSVQLTAEQRRAKTLAQELAAARVEWESLESAVFDGQEQISALEADLSRLEGERGNLQQANEALTREVSRIQSELEQQVSQALLERQALELKLTQAERNAQRSLASAQQSHQEQLEAERKDKESVRLALTAQREQVEEQLRVEYEELRLRSRTDLQQLQEELARAQQHCTDSLLQAESHKQQALSEKEAEKTVLTERILSLQRDIETTALETERMRRDFLNKQEQDKDTAAGLQSELQQLRLHFEESLSSREISEKRLNDQIRELSLQRHEAQQEVEQLRRSVLEVEESRDGVRKELVEARAELRECVQEREAGRRESLELRRALGNESREKEAIHTSNQELRTSVKRAESENNGLKRTLEEREQRLTVLEECKSSLQQEALKVRNSMRELEKSHLQARRELQELRRKVKTLEGQCGQQEQEVGELQARLVQEEQREEEARKESFSLKQRVLESDAGREAALKEVAGLQRRVAELEEVQRVEKECQRQRD-ASLQDSQRRQREETARLEGALQEVQAELREQNVELKL----AEGRGRSLEEQLALADASRSDLEQRLSGLSSALRRTLG------IGCRARSPTPRPRGRRPSPWRNRSPE---KGSESVS-------GGPMGSVQDPSV-------SPVHGEDGKLDV--ESVQAALRNFQQELRDAQRERDDAQAQVMSLKRQLSELQAGQEKSSARAQQLKHSIKDLEQGKRDLAERLEAVQASLSLQEEAGRRGDRERRVMEEELSRLKNGLQASDAGARALQERLERVEQSEAGLGAECRRLKECWDAAEARASRLELSHRTLEGELQRSQIRSAELEAELSSLQERMSSLRRELGESEECTALLKVEGERAATALARAELQEAQLREKLQSTAAALKESCSSAGAAKEQTAQLQSTLTASELEGRTLQERLEKMREALSDSKKQNYALSERLQNLQRTQEEYELRVSELDKHTHSLQEALRQREQVVEEARADCTVLQKDRVELQERVTNLQTSLHSLQDDRTQLDKILTRLGKDKAALKRTLQK--------------------------------------------SQLSHLEQAHSQRLLEVTARHRQELELETERLRGSQQQAERALEAREKAHRQRVRCLEEQVCTLKEQLEQEMRRR 1922          
BLAST of Rootletin vs. Ensembl Cavefish
Match: si:dkey-230p4.1 (trichohyalin-like [Source:NCBI gene;Acc:103036019])

HSP 1 Score: 83.1889 bits (204), Expect = 3.786e-15
Identity = 60/176 (34.09%), Postives = 97/176 (55.11%), Query Frame = 3
Query:  441 LESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCL-----------QTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELT 935
            LESTLI+LEEEQ+++  L E N  L+ QL+Q+ ++NQ L  D+ KL+ +W R+ EE  QRE  W+ E+      +++E + L  L    ++ RRQ   +K +T++++  L+ EF+R +  L            +  S+ +  M   E  Q+ ST     D+ +L  QLR +  ELT
Sbjct:  128 LESTLIRLEEEQQRSVALVEVNALLRSQLSQSAEANQTLQDDLRKLTADWSRAVEEAGQREIDWQKEKEVLVGCVSAERARLMMLWGKAVSLRRQCHTVKTATDKDLWELRAEFSRLSSTLFSMGFPPVVPRPSVLSSSTGPMTLEELNQETSTTNHLDDQESLTQQLRSRIEELT 303          
BLAST of Rootletin vs. Ensembl Cavefish
Match: si:dkey-230p4.1 (trichohyalin-like [Source:NCBI gene;Acc:103036019])

HSP 1 Score: 83.1889 bits (204), Expect = 3.786e-15
Identity = 60/176 (34.09%), Postives = 97/176 (55.11%), Query Frame = 3
Query:  441 LESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCL-----------QTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELT 935
            LESTLI+LEEEQ+++  L E N  L+ QL+Q+ ++NQ L  D+ KL+ +W R+ EE  QRE  W+ E+      +++E + L  L    ++ RRQ   +K +T++++  L+ EF+R +  L            +  S+ +  M   E  Q+ ST     D+ +L  QLR +  ELT
Sbjct:  128 LESTLIRLEEEQQRSVALVEVNALLRSQLSQSAEANQTLQDDLRKLTADWSRAVEEAGQREIDWQKEKEVLVGCVSAERARLMMLWGKAVSLRRQCHTVKTATDKDLWELRAEFSRLSSTLFSMGFPPVVPRPSVLSSSTGPMTLEELNQETSTTNHLDDQESLTQQLRSRIEELT 303          
BLAST of Rootletin vs. Ensembl Cavefish
Match: ENSAMXT00000053516.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:18273005:18276973:-1 gene:ENSAMXG00000035105.1 transcript:ENSAMXT00000053516.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.121e-12
Identity = 47/160 (29.38%), Postives = 83/160 (51.88%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEE 644
            + L Q N++LR+RLEEE   Y+RKL  +Q+                   +++  +L  K+Q   ++T          + +  R+ + Y+   +   +        +++ L+  N  L+EQL QA+ +N+ L++DI +L+ +W ++REELEQRE  WR EE
Sbjct:   17 RSLAQQNVDLRRRLEEEQAAYKRKLTAYQEG------------------QQRQAQLVQKLQAKVFQTFIKHLQHQKPHSHQQRNCSLYETQSVCVCVCV-----SRSSSLSAVNAMLREQLEQASLANEALSQDIRRLTADWTKAREELEQREADWRREE 153          
BLAST of Rootletin vs. Ensembl Nematostella
Match: EDO42343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1K9])

HSP 1 Score: 410.609 bits (1054), Expect = 2.833e-126
Identity = 255/558 (45.70%), Postives = 393/558 (70.43%), Query Frame = 3
Query: 4332 DINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIF 6005
            +I+PE VR+ALR+F Q + +AER+RD+A  +A +L+  L E EE+    + R+Q +Q++L ++EE+++G DGRLSSAQTALM+QEETIRR ER+RKA+ EK++  D + A  E ++RQL D++   +  +++ ++E +  +  IEN E+R+T+++L KRS+EGD++R++M  ++ E E   L +R++ +LK  Q+LE ++ SLQLT+DR+++ALAKTEEE    K+K+ +L+MSL+  +   + LQ +I QLQ+AL +SE DR++++ERLE+ K A  EAK +NN+L +R+Q ++++  D++ RR ELEG  RQ   ++ Q++EAE+EL  +  KL  EK  LQER+   QR++A AE EK+E+ + H +LEKD+ AL+ +L K+ER+KL+T+E  ++   +R  LD+     E EN EL RQ+ ILQ QLAE EQ+H   L+E+ SRHRQE+ ME +  R S  Q+E+T   RERAH+QRVKGLEEQ++TLKDQL  E+Q++    Y   TR + + D   DLR  L+ SL  VA+D   +  +L+ E+++L+ES+ 
Sbjct:    4 EIDPETVRVALRDFAQSMKEAERERDEAVTRANNLQRALAELEEERTRMDQRMQSIQKSLGESEEERRGADGRLSSAQTALMLQEETIRRLERERKALNEKITALDSSLAQAEGDRRQLRDKVANLQQSESKSDQEKEAMRAQIENTESRLTKVELKKRSVEGDIERLRMLNSENEAEKIALQERIDQMLKSQQELESRATSLQLTVDRLTLALAKTEEEEMAFKNKVTELSMSLNDSNSTSQSLQERIQQLQRALTNSEHDRKIMQERLEALKNAQQEAKGRNNMLQDRMQQMKNEQADADVRRMELEGQIRQLQQILRQQKEAEEELVARIGKLQEEKRELQERLAKFQRSVAAAEQEKRELERAHVRLEKDKKALRNTLDKIEREKLETDETNTRLRDDRERLDRSSANFEHENQELHRQIQILQQQLAETEQSHARKLVEVTSRHRQEIEMEGDRARQSQGQLEKTQMARERAHKQRVKGLEEQVATLKDQLAKELQKK--QSYL--TRTAQKSDEIKDLRSKLEDSLNIVARDTIYEPTVLDRESQKLEESLV 557          
BLAST of Rootletin vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 570.081 bits (1468), Expect = 1.555e-171
Identity = 441/1193 (36.97%), Postives = 701/1193 (58.76%), Query Frame = 3
Query: 2340 SNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTY---ATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGL--NRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAH--CHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTG 5897
            S  ++    + +  LTK+K  LVVQ+TA EREN   +E + +  S+RE LE +L+DAQQ ++Q E+ +EQLE ENQ L V+ E   GE                N+  QL     Q +++ K A+ Q   +   + ++ + +    RH  + E E  + +   E +D +Q   +EK+E+   +  +Q ERD SLL AE EKQQ+LSL E EK  + EK+   Q +L ++  E +R  +E++  +EQ++  +  L+SEL+  RSQ ED    HE ++ SLN    DL    D     +      L  AEE R+ LRR+ +E  R+L + +EA E+ +RE  EL+R LC+  RE++ +  SN  LR+ ++  ETERI + RQ  + +Q++ V +E L +S++EV ELR+ L++VE++RL+ +RELQELRR +K LD +R +  +E+ +LQTR++ +E++E+E  +E F LKQK+ ET+ +RE+++++L+  Q+ +V+ E+  +S +R+ ++ ++ +R   +KL D   +L            +  + LS A+GR++A E+ + R E +K+++EF+L+S+ S+L R +G       + R+R+                         DNT    A + +G G+P+P               P+     P +++P+ +R  LR+F+Q+L DA R RDDA  Q  +L+  L+EQ+ + E AENR  QLQ +L + +E K+G+D RL+S Q  L  QE+ ++R +R+R+A+A+++   +R+  + E EK+  +++LNK R  +ARLE E K+ ++A+E AE R T+++L +RSLEG+LQR+K+ L D+E E++   +R + LL+Q+ + E +   LQ  +DR+S AL K +E  +  K K+  L+ SL   +      Q +++ LQK L   EQD+RLL+E+++ ++ ++ EAK     L ER+Q +Q +L  SE  R ELE    N Q    + QR  +  E     QK  +E+  ++ER+ ++QR +AL E EK++  +   +LEKD+ AL+ +L KVERQKLK EE + +   E++ LD+ L  +E E  E Q+Q+ +LQ  LAE EQAH  C  L+    R R E   E E LR S   +ERTL  RERAHR RVKGLEEQ+STLK+QL  EM+RR       ST     + STG
Sbjct:  431 SEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATGE-------------GKTNAENQLA----QAERD-KQALTQALSAAQLEAQQASLV----RHSLQMEHETAVRKLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSLNETCADLRSRAD-----LEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQTARESLKRELSMTQKRLVESESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGI----GASGRARSTP-----------------------DNTMGSGAVSPEGGGTPLP---------------PAQ----P-ELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEVRALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQVTLAEMEQAHSGCEGLL----RQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPP--LPST-----FTSTG 1538          

HSP 2 Score: 130.568 bits (327), Expect = 1.416e-29
Identity = 66/170 (38.82%), Postives = 108/170 (63.53%), Query Frame = 3
Query:  474 QKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHR 983
            Q++++ L+  N  L+EQL QA  +N+ L+RDI +L+ +W ++REELEQ+E  WR EE SF+ Y +SEH  L    R  + FRR   E+K+S ER++++++ E  R +  +Q +C+ LS  ++S E+   L+ E+E   +  LE QLR + +E  + Q+R + E +EL  R
Sbjct:   62 QQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSSAERDLSDMRGELVRMSHLVQVSCAGLSAVLRSQEAGTALALEQERALRDQLEQQLRGQVKETMNLQSRADAERSELSLR 231          
BLAST of Rootletin vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 564.303 bits (1453), Expect = 1.616e-168
Identity = 486/1345 (36.13%), Postives = 761/1345 (56.58%), Query Frame = 3
Query: 1917 ELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESN----------RHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRI-ALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTY---ATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGL--NRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAH--CHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTG 5897
            EL + ++K Q  +  L ++++K+ +  E L   + + ++ I QLE E++ L  +KR  EQEK  ++DELVR EQ  L L + +   +Q ++  E +   +E EL  L  E+L L E++     Q ++L  EL   + E +RS  ++    + +  LTK+K  LVVQ+TA EREN   +E + +  S+RE LE +L+DAQQ ++Q E+ +EQLE ENQ L V+ E                                  D E ++A Q ERD  A     LT+   +           RH  + E E  + +   E +D +Q   +EK+E+   +  +Q ERD SLL AE EKQQ+LSL E EK  + EK+   Q +L ++  E +R  +E++  +EQ++  +  L+SEL+  RSQ ED    HE ++ SLN    DL    D     +      L  AEE R+ LRR+ +E  R+L + +EA E+ +RE  EL+R LC+  RE++ +  SN  LR+ ++  ETERI + RQ  + +Q++ V +E L +S++EV ELR+ L++VE++RL+ +RELQELRR +K LD +R +  +E+ +LQTR++ +E++E+E  +E F LKQK+ ET+         L+  Q+ +V+ E+  +S +R+ ++ ++ +R   +KL D             A N  +R  A   + GR++A E+ + R E +K+++EF+L+S+ S+L R +G          SR  S                       DNT    A + +G G+P+P               P+     P +++P+ +R  LR+F+Q+L DA R RDDA  Q  +L+  L+EQ+ + E AENR  QLQ +L + +E K+G+D RL+S Q  L  QE+ ++R +R+R+A+A+++   +R+  + E EK+  +++LNK R  +ARLE E K+ ++A+E AE R T+++L +RSLEG+LQR+K+ L D+E E++   +R + LL+Q+ + E +   LQ  +DR+S AL K +E  +  K K+  L+ SL   +      Q +++ LQK L   EQD+RLL+E+++ ++ ++ EAK     L ER+Q +Q +L  SE  R ELE    N Q    + QR  +  E     QK  +E+  ++ER+ ++QR +AL E EK++  +   +LEKD+ AL+ +L KVERQKLK EE + +   E++ LD+ L  +E E  E Q+Q+ +LQ  LAE EQAH  C  L+    R R E   E E LR S   +ERTL  RERAHR RVKGLEEQ+STLK+QL  EM+RR       ST     + STG
Sbjct:  431 ELSLHLSKLQYEDAALRDSLTKMGNLNEGLVQDKVDLNKYILQLEEEKAVLQAQKREAEQEKLSIRDELVRQEQNRLELESSRVTLQQSLQDTEFSRVGVEAELQNLRAERLKLQEKVA----QVASLDSELSLAKGEGQRSEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETAT-------------------------------DAENQLA-QAERDKQA-----LTQALSAAQLEAQQASLVRHSLQMEHETAVRKLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSLNETCADLRSRAD-----LEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQT--------LSMTQKRLVESESGWRSCERELTAQLQEARGCEKKLQDE------------AKNLSVRAQAAQESAGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGI---GASGRASRGRSPGGRSTP----------------DNTMGSGAVSPEGGGTPLP---------------PAQ----P-ELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEVRALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQVTLAEMEQAHSGCEGLL----RQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPP--LPST-----FTSTG 1659          

HSP 2 Score: 119.013 bits (297), Expect = 3.800e-26
Identity = 83/194 (42.78%), Postives = 116/194 (59.79%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKAS 746
            + L Q N+ELR+RL+EE   YRRKL  +Q+ QQ+QAQLVQ+LQ KVLQYK++C +LE K+Q    E  K    S +        E                 EQ++++ L+  N  L+EQL QA  +N+ L+RDI +L+ +W ++REELEQ+E  WR EE SF+ Y +SEH  L    R  + FRR   E+K+S
Sbjct:  122 RSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQEKSSELEKCSDSSSSLEEALLHLEE----------------EQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSS 299          
BLAST of Rootletin vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 558.91 bits (1439), Expect = 1.479e-166
Identity = 476/1329 (35.82%), Postives = 758/1329 (57.04%), Query Frame = 3
Query: 1917 ELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGL--NRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTG 5897
            EL + ++K Q  +  L ++++K+ +  E L   + + ++ I QLE E++ L  +KR  EQEK  ++DELVR EQ  L L + +   +Q ++  E +   +E EL  L  E+L L E++     Q ++L  EL   + E +RS  ++    + +  LTK+K  LVVQ+TA EREN   +E + +  S+RE LE +L+DAQQ ++Q E+ +EQLE ENQ L V+ E   GE                N+  QL     Q +++ K A+ Q   +   + ++ + +    RH  + E E  + +   E +D +Q   +EK+E+   +  +Q ERD SLL AE EKQQ+LSL E EK  + EK+   Q +L ++  E +R  +E++  +EQ++  +  L+SEL+  RSQ ED    HE ++ SLN    DL    D ALKE+      L  AEE R+ LRR+ +E  R+L + +EA E+ +RE  EL+R LC+  RE++ +  SN  LR+ ++  ETERI + RQ  + +Q++ V +E L +S++EV ELR+ L++VE++RL+ +RELQELRR +K LD +R +  +E+ +LQTR++ +E++E+E  +E F LKQK+ ET+         L+  Q+ +V+ E+  +S +R+ ++ ++ +R   +KL D   +L            +  + LS A+GR++A E+ + R E +K+++EF+L+S+ S+L R +G                                             + G+ SP   + SP S  R     P+     P +++P+ +R  LR+F+Q+L DA R RDDA  Q  +L+  L+EQ+ + E AENR  QLQ +L + +E K+G+D RL+S Q  L  QE+ ++R +R+R+A+A+++   +R+  + E EK+  +++LNK R  +ARLE E K+ ++A+E AE R T+++L +RSLEG+LQR+K+ L D+E E++   +R + LL+Q+ + E +   LQ  +DR+S AL K +E  +  K K+  L+ SL   +      Q +++ LQK L   EQD+RLL+E+++ ++ ++ EAK     L ER+Q +Q +L  SE  R ELE    N Q    + QR  +  E     QK  +E+  ++ER+ ++QR +AL E EK++  +   +LEKD+ AL+ +L KVERQKLK EE + +   E++ LD+ L  +E E  E Q+Q+ +LQ   A    AH   L+    R R E   E E LR S   +ERTL  RERAHR RVKGLEEQ+     QL  EM+RR       ST     + STG
Sbjct:  438 ELSLHLSKLQYEDAALRDSLTKMGNLNEGLVQDKVDLNKYILQLEEEKAVLQAQKREAEQEKLSIRDELVRQEQNRLELESSRVTLQQSLQDTEFSRVGVEAELQNLRAERLKLQEKVA----QVASLDSELSLAKGEGQRSEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATGE-------------GKTNAENQLA----QAERD-KQALTQALSAAQLEAQQASLV----RHSLQMEHETAVRKLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSLNETCADLRSRADVALKELEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQT--------LSMTQKRLVESESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGI--------------------------------------GASGRASRGR-SPGGSSASPGSISRGTPLPPA----QP-ELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEVRALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQV-TASNSSAHSTGLL----RQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVWFHDSQLQQEMKRRQPP--LPST-----FTSTG 1676          

HSP 2 Score: 119.398 bits (298), Expect = 3.422e-26
Identity = 83/195 (42.56%), Postives = 117/195 (60.00%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKAST 749
            + L Q N+ELR+RL+EE   YRRKL  +Q+ QQ+QAQLVQ+LQ KVLQYK++C +LE K+Q    E  K    S +        E                 EQ++++ L+  N  L+EQL QA  +N+ L+RDI +L+ +W ++REELEQ+E  WR EE SF+ Y +SEH  L    R  + FRR   E+K+S+
Sbjct:  132 RSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQEKSSELEKCSDSSSSLEEALLHLEE----------------EQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSSS 310          
BLAST of Rootletin vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 549.28 bits (1414), Expect = 1.666e-163
Identity = 465/1332 (34.91%), Postives = 743/1332 (55.78%), Query Frame = 3
Query: 1917 ELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTY---ATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAH--CHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTG 5897
            EL + ++K Q  +  L ++++K+ +  E L   + + ++ I QLE E++ L  +KR  EQEK  ++DELVR EQ  L L + +   +Q ++  E +   +E EL  L  E+L L E++     Q ++L  EL   + E +RS  ++    + +  LTK+K  LVVQ+TA EREN   +E + +  S+RE LE +L+DAQQ ++Q E+ +EQLE ENQ L V+ E   GE                N+  QL     Q +++ K A+ Q   +   + ++ + +    RH  + E E  + +   E +D +Q   +EK+E+   +  +Q ERD SLL AE EKQQ+LSL E EK  + EK+   Q +L ++  E +R  +E++  +EQ++  +  L+SEL+  RSQ ED    HE ++ SLN    DL    D ALKE+      L  AEE R+ LRR+ +E  R+L + +EA E+ +RE  EL+R LC+  RE++ +  SN  LR+ ++  ETERI + RQ  + +Q++ V +E L +S++EV ELR+ L++VE++RL+ +RELQELRR +K LD +R +  +E+ +LQTR++ +E++E+E  +E F LKQK+ ET+         L+  Q+ +V+ E+  +S +R+ ++ ++ +R   +KL D   +L            +  + LS A+GR++A E+ + R E +K+++EF+L+S+ S+L R +G                                      DNT    A + +G G+P+P    P+                P +++P+ +R  LR+F+Q+L DA R RDDA  Q  +L+  L+EQ+ + E AENR  QLQ +L + +E K+G+D RL+S Q  L  QE+ ++R +R+R+A+A+++   +R+  + E EK+  +++LNK R  +ARLE E K+ ++A+E AE R T+++L +RSLEG+LQR+K+ L D+E E++   +R + LL+Q+ + E +   LQ  +DR+S AL K +E  +  K K+  L+ SL   +      Q +++ LQK L   EQD+RLL+    +  G    A+ Q+++                                               QK  +E+  ++ER+ ++QR +AL E EK++  +   +LEKD+ AL+ +L KVERQKLK EE + +   E++ LD+ L  +E E  E Q+Q+ +LQ  +   EQAH  C  L+    R R E   E E LR S   +ERTL  RERAHR RVKGLEEQ+STLK+QL  EM+RR       ST     + STG
Sbjct:  452 ELSLHLSKLQYEDAALRDSLTKMGNLNEGLVQDKVDLNKYILQLEEEKAVLQAQKREAEQEKLSIRDELVRQEQNRLELESSRVTLQQSLQDTEFSRVGVEAELQNLRAERLKLQEKVA----QVASLDSELSLAKGEGQRSEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATGE-------------GKTNAENQLA----QAERD-KQALTQALSAAQLEAQQASLV----RHSLQMEHETAVRKLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSLNETCADLRSRADVALKELEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQT--------LSMTQKRLVESESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGIGASGSTP------------------------------DNTMGSGAVSPEGGGTPLP----PA---------------QP-ELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQVSGSTRGGWRSLAETQHSI-----------------------------------------------QKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQVTM---EQAHSGCEGLL----RQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPP--LPST-----FTSTG 1638          

HSP 2 Score: 118.627 bits (296), Expect = 5.855e-26
Identity = 83/194 (42.78%), Postives = 116/194 (59.79%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKAS 746
            + L Q N+ELR+RL+EE   YRRKL  +Q+ QQ+QAQLVQ+LQ KVLQYK++C +LE K+Q    E  K    S +        E                 EQ++++ L+  N  L+EQL QA  +N+ L+RDI +L+ +W ++REELEQ+E  WR EE SF+ Y +SEH  L    R  + FRR   E+K+S
Sbjct:  136 RSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQEKSSELEKCSDSSSSLEEALLHLEE----------------EQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSS 313          
BLAST of Rootletin vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 544.658 bits (1402), Expect = 1.101e-161
Identity = 422/1151 (36.66%), Postives = 676/1151 (58.73%), Query Frame = 3
Query: 2463 SLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTY---ATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDR-DDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAH--CHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTG 5897
            +  S+RE LE +L+DAQQ ++Q E+ +EQLE ENQ L V+ E    EL RLR + + +  +    ++ L         E + A ++    H E+VERL    E  RH  + E E  + +   E +D +Q   +EK+E+   +  +Q ERD SLL AE EKQQ+LSL E EK  + EK+   Q +L ++  E +R  +E++  +EQ++  +  L+SEL+  RSQ ED    HE ++ SLN    DL    D     +      L  AEE R+ LRR+ +E  R+L + +EA E+ +RE  EL+R LC+  RE++ +  SN  LR+ ++  ETERI + RQ  + +Q++ V +E L +S++EV ELR+ L++VE++RL+ +RELQELRR +K LD +R +  +E+ +LQTR++ +E++E+E  +E F LKQK+ ET+ +RE+++++L+  Q+ +V+ E+  +S +R+ ++ ++ +R   +KL D   +L            +  + LS A+GR++A E+ + R E +K+++EF+L+S+ S+L R +G       + R+R+                         DNT    A + +G G+P+P               P+     P +++P+ +R  LR+F+Q+L DA R R +D F       ++L+EQ+ + E AENR  QLQ +L + +E K+G+D RL+S Q  L  QE+ ++R +R+R+A+A+++   +R+  + E EK+  +++LNK R  +ARLE E K+ ++A+E AE R T+++L +RSLEG+LQR+K+ L D+E E++   +R + LL+Q+ + E +   LQ  +DR+S AL K +E  +  K K+  L+ SL   +      Q +++ LQK L   EQD+RLL+E+++ ++ ++ EAK     L ER+Q +Q +L  SE  R ELE   + +   + QR  +  E     QK  +E+  ++ER+ ++QR +AL E EK++  +   +LEKD+ AL+ +L KVERQKLK EE + +   E++ LD+ L  +E E  E Q+Q+ +LQ       QAH  C  L+    R R E   E E LR S   +ERTL  RERAHR RVKGLEEQ+STLK+QL  EM+RR       ST     + STG
Sbjct:  573 ACRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATVELRRLRSDAENQLAQAERDKQALTQALSAAQLEAQQASRKATSEHQEEVERLALEKEVVRHSLQMEHETAVRKLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSLNETCADLRSRAD-----LEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQTARESLKRELSMTQKRLVESESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGI----GASGRARSTP-----------------------DNTMGSGAVSPEGGGTPLP---------------PAQ----P-ELDPDTLRSGLRDFLQELRDAHRQRVNDCFKHETDT-AQLEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQ-----VTQAHSGCEGLL----RQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPP--LPST-----FTSTG 1654          

HSP 2 Score: 168.318 bits (425), Expect = 4.028e-41
Identity = 111/273 (40.66%), Postives = 166/273 (60.81%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHR 983
            + L Q N+ELR+RL+EE   YRRKL  +Q+ QQ+QAQLVQ+LQ KVLQYK++C +LE K+Q    E  K                         S L+ LEEEQ++++ L+  N  L+EQL QA  +N+ L+RDI +L+ +W ++REELEQ+E  WR EE SF+ Y +SEH  L    R  + FRR   E+K+S ER++++++ E  R +  +Q +C+ LS  ++S E+   L+ E+E   +  LE QLR + +E  + Q+R + E +EL  R
Sbjct:  122 RSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQEKSSELEKC------------------------SALLHLEEEQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSSAERDLSDMRGELVRMSHLVQVSCAGLSAVLRSQEAGTALALEQERALRDQLEQQLRGQVKETMNLQSRADAERSELSLR 370          
BLAST of Rootletin vs. Planmine SMEST
Match: SMESG000071494.1 (SMESG000071494.1)

HSP 1 Score: 3619.71 bits (9385), Expect = 0.000e+0
Identity = 1980/2008 (98.61%), Postives = 1983/2008 (98.75%), Query Frame = 3
Query:   84 MSEIDYSAIVRRRXXXXXXXXXXXXXXKGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRIEMSKKSAAPNNSNRRLTAG 6107
            MSEIDYSAIVRRRIGDIDGDSSEDSSSKGLLQVNLELRKRLEEEHNEYRRKLIVFQDSQQKQAQLVQRLQKKVLQYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVRKNN                  K     DATYAAVQSAINKKSLQIQELKSKLNSSKESCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR LEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIEQLEINTERLEEELSELNREKLDLTEQIGCLQRQKSALAEELLQCRRELERSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLN+GIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNRKLKEAEEAKEHLKREINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTRVARDEEKEDEARRENFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKSPVRGRSVSPLRSRPVSPTKGFDNTYATTTDGKGSPIPRTGSPSSK+RQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDRRLLEERLESSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKR+EMSKKSAAP NSNRRLTAG
Sbjct:    1 MSEIDYSAIVRRRIGDIDGDSSEDSSSKGLLQVNLELRKRLEEEHNEYRRKLIVFQDSQQKQAQLVQRLQKKVLQYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVRKNNHQ---------------LKHRHLPDATYAAVQSAINKKSLQIQELKSKLNSSKESCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRCLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIEQLEINTERLEEELSELNREKLDLTEQIGCLQRQKSALAEELLQCRRELERSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNNGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNRKLKEAEEAKEHLKREINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTRVARDEEKEDEARRENFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKSPVRGRSVSPLRSRPVSPTKGFDNTYATTTDGKGSPIPRTGSPSSKQRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDRRLLEERLESSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRMEMSKKSAAPTNSNRRLTAG 1993          
BLAST of Rootletin vs. Planmine SMEST
Match: SMESG000071494.1 (SMESG000071494.1)

HSP 1 Score: 3618.17 bits (9381), Expect = 0.000e+0
Identity = 1983/2008 (98.75%), Postives = 1987/2008 (98.95%), Query Frame = 3
Query:   84 MSEIDYSAIVRRRXXXXXXXXXXXXXXKGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRIEMSKKSAAPNNSNRRLTAG 6107
            MSEIDYSAIVRRRIGDIDGDSSEDSSSKGLLQVNLELRKRLEEEHNEYRRKLIVFQDSQQKQAQLVQRLQKKVLQYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVRKNNRSP+              K     DATYAAVQSAINKKSLQIQELKSKLNSSKESCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR LEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIEQLEINTERLEEELSELNREKLDLTEQIGCLQRQKSALAEELLQCRRELERSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLN+GIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNRKLKEAEEAKEHLKREINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTRVARDEEKEDEARRENFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKSPVRGRSVSPLRSRPVSPTKGFDNTYATTTDGKGSPIPRTGSPSSK+RQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDRRLLEERLESSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKR+EMSKKSAAP NSNRRLTAG
Sbjct:    1 MSEIDYSAIVRRRIGDIDGDSSEDSSSKGLLQVNLELRKRLEEEHNEYRRKLIVFQDSQQKQAQLVQRLQKKVLQYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVRKNNRSPNQ------------LKHRHLPDATYAAVQSAINKKSLQIQELKSKLNSSKESCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRCLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIEQLEINTERLEEELSELNREKLDLTEQIGCLQRQKSALAEELLQCRRELERSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNNGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNRKLKEAEEAKEHLKREINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTRVARDEEKEDEARRENFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKSPVRGRSVSPLRSRPVSPTKGFDNTYATTTDGKGSPIPRTGSPSSKQRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDRRLLEERLESSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRMEMSKKSAAPTNSNRRLTAG 1996          
BLAST of Rootletin vs. Planmine SMEST
Match: SMESG000081227.1 (SMESG000081227.1)

HSP 1 Score: 1043.49 bits (2697), Expect = 0.000e+0
Identity = 782/1978 (39.53%), Postives = 1218/1978 (61.58%), Query Frame = 3
Query:  186 LELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGS-RSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNG---DTAGEI-NMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPP------------------------FADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQ--YDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCG 6014
            ++LRK+L+++H EY+RKL    D                  ++ K  EL  ++Q   ++T  +      +      +S     N+DLES + +L+EEQ K+  L +    L++QL +AT +NQ LT D+ +LSEE    + ELEQ++  W+++E +F+ +L  E + +++L    +NF+RQF ++K+S ER+++ L+    +  + L+ ACSNL  N  +  S+ Q   + E  +   LEN L +   E    +T+Y+ ++  L  +   +   ++ L  +  +K++ LT L +++NG   D    I N +D ATR LI DT+++HQALR+I+Q+V+ND D  D     +D   +  +   +        S+  N   + T P                         AD+T AAV+SA++K++LQ+Q+L SK+NS+K +  + K+Q+DD+ENERR LE Q + +R E +S  R+ DD  RE +R ++ +++   ++ +L+K R +  ++ +    ++E+LK+ N+ELQR +E L D  +D  ++LERQ KE ER  +SI+  E K SR KE++ + KE++N+  LEKEVL QE   + D+L++ E+ KAE E++ NK +T E  L +   +L S    L  + +E    I Q E E+  L  EK+ LEQEK G+++EL+R E E   L+  K    Q ++ +E + E L++ELS+LN EK  L      LQR+++AL+ ELLQ RR+ ER + +V    K+KE L KEK +L+ Q+T  E E R+ ++ I  L  ++EQL+ +LY++QQ I QLE + E LE   Q+L  K+  +  E  RL+ EF +E +K+  ++E L  +  + +KE+   ++ E+++  ED+ERL    E  R+     +EE+  +F  E DD+     ++K+E+AQEI+TIQRERDD LL AE  KQ +++LLEQEK ++ EK+ +    L++ ES+L+R + E   R +QD+  I   + +LK FR QFE    +H+ E+K+L    K+L   K Q ++E  +L + LKIAEETRDNLR+++ E   K++E E+ +E L+RE+ + KR   E ++E E +  SN+ LR+K+K  E ++ID+ RQ+ D + K+++ +EQ    ++EV + R NL+D EKAR+DV+REL+ELR  +K+LDTERGKL  EV+ LQ RVA DE KE EARRENFGLKQKV+E+EA++E + K L  + R   +LE +L SK++      +   +DY+ L +++ +L+   +    +  EL   LS  E R+S LE+ I  ++  +K  E +LA+IHS LR+LIGFRQ+   T+R+R+ S                   +  F+ +      G+   + +           S  P +      D++PEAVR+ALR+  Q +V  ER+RDD   +A++   +  E   Q + A  R+ QLQ+   + EEDKKGID RLSSAQTALMMQEETI RNER+RK++ +K+   +R  A +E+EK+ L++R++K R  ++  EEE +   KA+++AENR TQL+L +R LEG+LQR+KM   DKETE +VL DRV++L KQI DLE K+QSLQLTIDR+S+ LA+TEEE +  KDK+ QLN+SLS H   L+ +Q+K+ QLQ  L SSE DRR+L+ERLES K  L EAK QN+ L++R++  Q +L +SE+R+ E+EG  ++ + ++ QRQE EQEL  K  +   EKN L ER+NS+  +LA  E+E+++I K H K EK++++LKK+L K+E++K ++EE  ++++ +RSE D+  RRLEDEN  L RQV  LQNQLAEAEQ H   +ME+ SR + EM  E++ L+++    E+TL+ RER+HRQ+VK LEEQI+ LKDQL+ E+++R       +  KSN+   +   D++ +L+ +   ++K    D +L E E RR+ + +   G
Sbjct:  184 IQLRKQLDDDHREYKRKLAAQHD------------------HQIKQAELIKRLQ-QKFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSE--------SVIPGS------DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKR-----ELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESG 2122          
BLAST of Rootletin vs. Planmine SMEST
Match: SMESG000081227.1 (SMESG000081227.1)

HSP 1 Score: 1039.25 bits (2686), Expect = 0.000e+0
Identity = 795/1991 (39.93%), Postives = 1236/1991 (62.08%), Query Frame = 3
Query:  186 LELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYK------EKCTELESKMQFGDYETRKTKYGSPTN--NGYGSRSENPYD------NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNG---DTAGEI-NMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPP------------------------FADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQ--YDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCG 6014
            ++LRK+L+++H EY+RKL    D Q KQA+L++RLQ+K+ Q +      EK  +  SK++  +    K  + + T+  N     +EN         N+DLES + +L+EEQ K+  L +    L++QL +AT +NQ LT D+ +LSEE    + ELEQ++  W+++E +F+ +L  E + +++L    +NF+RQF ++K+S ER+++ L+    +  + L+ ACSNL  N  +  S+ Q   + E  +   LEN L +   E    +T+Y+ ++  L  +   +   ++ L  +  +K++ LT L +++NG   D    I N +D ATR LI DT+++HQALR+I+Q+V+ND D  D     +D   +  +   +        S+  N   + T P                         AD+T AAV+SA++K++LQ+Q+L SK+NS+K +  + K+Q+DD+ENERR LE Q + +R E +S  R+ DD  RE +R ++ +++   ++ +L+K R +  ++ +    ++E+LK+ N+ELQR +E L D  +D  ++LERQ KE ER  +SI+  E K SR KE++ + KE++N+  LEKEVL QE   + D+L++ E+ KAE E++ NK +T E  L +   +L S    L  + +E    I Q E E+  L  EK+ LEQEK G+++EL+R E E   L+  K    Q ++ +E + E L++ELS+LN EK  L      LQR+++AL+ ELLQ RR+ ER + +V    K+KE L KEK +L+ Q+T  E E R+ ++ I  L  ++EQL+ +LY++QQ I QLE + E LE   Q+L  K+  +  E  RL+ EF +E +K+  ++E L  +  + +KE+   ++ E+++  ED+ERL    E  R+     +EE+  +F  E DD+     ++K+E+AQEI+TIQRERDD LL AE  KQ +++LLEQEK ++ EK+ +    L++ ES+L+R + E   R +QD+  I   + +LK FR QFE    +H+ E+K+L    K+L   K Q ++E  +L + LKIAEETRDNLR+++ E   K++E E+ +E L+RE+ + KR   E ++E E +  SN+ LR+K+K  E ++ID+ RQ+ D + K+++ +EQ    ++EV + R NL+D EKAR+DV+REL+ELR  +K+LDTERGKL  EV+ LQ RVA DE KE EARRENFGLKQKV+E+EA++E + K L  + R   +LE +L SK++      +   +DY+ L +++ +L+   +    +  EL   LS  E R+S LE+ I  ++  +K  E +LA+IHS LR+LIGFRQ+   T+R+R+ S                   +  F+ +      G+   + +           S  P +      D++PEAVR+ALR+  Q +V  ER+RDD   +A++   +  E   Q + A  R+ QLQ+   + EEDKKGID RLSSAQTALMMQEETI RNER+RK++ +K+   +R  A +E+EK+ L++R++K R  ++  EEE +   KA+++AENR TQL+L +R LEG+LQR+KM   DKETE +VL DRV++L KQI DLE K+QSLQLTIDR+S+ LA+TEEE +  KDK+ QLN+SLS H   L+ +Q+K+ QLQ  L SSE DRR+L+ERLES K  L EAK QN+ L++R++  Q +L +SE+R+ E+EG  ++ + ++ QRQE EQEL  K  +   EKN L ER+NS+  +LA  E+E+++I K H K EK++++LKK+L K+E++K ++EE  ++++ +RSE D+  RRLEDEN  L RQV  LQNQLAEAEQ H   +ME+ SR + EM  E++ L+++    E+TL+ RER+HRQ+VK LEEQI+ LKDQL+ E+++R       +  KSN+   +   D++ +L+ +   ++K    D +L E E RR+ + +   G
Sbjct:  184 IQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLR-SEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSE--------SVIPGS------DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKR-----ELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESG 2153          
BLAST of Rootletin vs. Planmine SMEST
Match: SMESG000081227.1 (SMESG000081227.1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 795/1991 (39.93%), Postives = 1236/1991 (62.08%), Query Frame = 3
Query:  186 LELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYK------EKCTELESKMQFGDYETRKTKYGSPTN--NGYGSRSENPYD------NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNG---DTAGEI-NMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPP------------------------FADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQ--YDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCG 6014
            ++LRK+L+++H EY+RKL    D Q KQA+L++RLQ+K+ Q +      EK  +  SK++  +    K  + + T+  N     +EN         N+DLES + +L+EEQ K+  L +    L++QL +AT +NQ LT D+ +LSEE    + ELEQ++  W+++E +F+ +L  E + +++L    +NF+RQF ++K+S ER+++ L+    +  + L+ ACSNL  N  +  S+ Q   + E  +   LEN L +   E    +T+Y+ ++  L  +   +   ++ L  +  +K++ LT L +++NG   D    I N +D ATR LI DT+++HQALR+I+Q+V+ND D  D     +D   +  +   +        S+  N   + T P                         AD+T AAV+SA++K++LQ+Q+L SK+NS+K +  + K+Q+DD+ENERR LE Q + +R E +S  R+ DD  RE +R ++ +++   ++ +L+K R +  ++ +    ++E+LK+ N+ELQR +E L D  +D  ++LERQ KE ER  +SI+  E K SR KE++ + KE++N+  LEKEVL QE   + D+L++ E+ KAE E++ NK +T E  L +   +L S    L  + +E    I Q E E+  L  EK+ LEQEK G+++EL+R E E   L+  K    Q ++ +E + E L++ELS+LN EK  L      LQR+++AL+ ELLQ RR+ ER + +V    K+KE L KEK +L+ Q+T  E E R+ ++ I  L  ++EQL+ +LY++QQ I QLE + E LE   Q+L  K+  +  E  RL+ EF +E +K+  ++E L  +  + +KE+   ++ E+++  ED+ERL    E  R+     +EE+  +F  E DD+     ++K+E+AQEI+TIQRERDD LL AE  KQ +++LLEQEK ++ EK+ +    L++ ES+L+R + E   R +QD+  I   + +LK FR QFE    +H+ E+K+L    K+L   K Q ++E  +L + LKIAEETRDNLR+++ E   K++E E+ +E L+RE+ + KR   E ++E E +  SN+ LR+K+K  E ++ID+ RQ+ D + K+++ +EQ    ++EV + R NL+D EKAR+DV+REL+ELR  +K+LDTERGKL  EV+ LQ RVA DE KE EARRENFGLKQKV+E+EA++E + K L  + R   +LE +L SK++      +   +DY+ L +++ +L+   +    +  EL   LS  E R+S LE+ I  ++  +K  E +LA+IHS LR+LIGFRQ+   T+R+R+ S                   +  F+ +      G+   + +           S  P +      D++PEAVR+ALR+  Q +V  ER+RDD   +A++   +  E   Q + A  R+ QLQ+   + EEDKKGID RLSSAQTALMMQEETI RNER+RK++ +K+   +R  A +E+EK+ L++R++K R  ++  EEE +   KA+++AENR TQL+L +R LEG+LQR+KM   DKETE +VL DRV++L KQI DLE K+QSLQLTIDR+S+ LA+TEEE +  KDK+ QLN+SLS H   L+ +Q+K+ QLQ  L SSE DRR+L+ERLES K  L EAK QN+ L++R++  Q +L +SE+R+ E+EG  ++ + ++ QRQE EQEL  K  +   EKN L ER+NS+  +LA  E+E+++I K H K EK++++LKK+L K+E++K ++EE  ++++ +RSE D+  RRLEDEN  L RQV  LQNQLAEAEQ H   +ME+ SR + EM  E++ L+++    E+TL+ RER+HRQ+VK LEEQI+ LKDQL+ E+++R       +  KSN+   +   D++ +L+ +   ++K    D +L E E RR+ + +   G
Sbjct:  195 IQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLR-SEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSE--------SVIPGS------DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKR-----ELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESG 2164          
The following BLAST results are available for this feature:
BLAST of Rootletin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CROCC0.000e+036.45ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC1.478e-17235.60ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC2.065e-8535.02ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC21.311e-7028.12ciliary rootlet coiled-coil, rootletin family memb... [more]
CEP2501.863e-5126.61centrosomal protein 250 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Rootletin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lfi-17.485e-1824.73Lin-5 (Five) Interacting protein [Source:UniProtK... [more]
lfi-17.485e-1824.73Lin-5 (Five) Interacting protein [Source:UniProtK... [more]
lfi-17.975e-1824.73Lin-5 (Five) Interacting protein [Source:UniProtK... [more]
back to top
BLAST of Rootletin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Root3.312e-8924.02gene:FBgn0039152 transcript:FBtr0339245[more]
Root3.312e-8924.02gene:FBgn0039152 transcript:FBtr0339244[more]
Root3.312e-8924.02gene:FBgn0039152 transcript:FBtr0304161[more]
back to top
BLAST of Rootletin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crocc20.000e+031.61ciliary rootlet coiled-coil, rootletin family memb... [more]
crocc27.428e-8229.34ciliary rootlet coiled-coil, rootletin family memb... [more]
si:dkey-230p4.12.021e-1632.49si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
si:dkey-230p4.12.983e-1635.33si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
back to top
BLAST of Rootletin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgm20.000e+032.45phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1... [more]
pgm20.000e+032.45phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1... [more]
CROCC0.000e+037.57ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
pgm20.000e+031.88phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1... [more]
ENSXETT00000012563.12.894e-1633.83centrosomal protein 250 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Rootletin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crocc0.000e+035.74ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+035.45ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+035.45ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+035.45ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc21.559e-8527.16ciliary rootlet coiled-coil, rootletin family memb... [more]
back to top
BLAST of Rootletin vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CJ40|CROCC_MOUSE0.000e+035.74Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 S... [more]
sp|Q5TZA2|CROCC_HUMAN0.000e+036.45Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV... [more]
sp|H7BZ55|CRCC2_HUMAN8.533e-7228.17Putative ciliary rootlet coiled-coil protein 2 OS=... [more]
sp|Q9BV73|CP250_HUMAN8.947e-5126.61Centrosome-associated protein CEP250 OS=Homo sapie... [more]
sp|Q60952|CP250_MOUSE5.156e-4826.59Centrosome-associated protein CEP250 OS=Mus muscul... [more]
back to top
BLAST of Rootletin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182479680.000e+051.96tr|A0A267F2Q1|A0A267F2Q1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183143300.000e+051.96tr|A0A267H6I3|A0A267H6I3_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182294580.000e+051.51tr|A0A1I8FWZ5|A0A1I8FWZ5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|170380780.000e+051.00tr|A0A1S3JC29|A0A1S3JC29_LINUN rootletin-like isof... [more]
gnl|BL_ORD_ID|169843820.000e+050.90tr|A0A1S3HNJ8|A0A1S3HNJ8_LINUN rootletin-like isof... [more]
back to top
BLAST of Rootletin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crocc20.000e+032.56rootletin-like [Source:NCBI gene;Acc:103030367][more]
crocc20.000e+031.98rootletin-like [Source:NCBI gene;Acc:103030367][more]
si:dkey-230p4.13.786e-1534.09trichohyalin-like [Source:NCBI gene;Acc:103036019][more]
si:dkey-230p4.13.786e-1534.09trichohyalin-like [Source:NCBI gene;Acc:103036019][more]
ENSAMXT00000053516.11.121e-1229.38pep primary_assembly:Astyanax_mexicanus-2.0:22:182... [more]
back to top
BLAST of Rootletin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rootletin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rootletin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423432.833e-12645.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rootletin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CROCC1.555e-17136.97ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC1.616e-16836.13ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC1.479e-16635.82ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC1.666e-16334.91ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC1.101e-16136.66ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
back to top
BLAST of Rootletin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071494.10.000e+098.61SMESG000071494.1[more]
SMESG000071494.10.000e+098.75SMESG000071494.1[more]
SMESG000081227.10.000e+039.53SMESG000081227.1[more]
SMESG000081227.10.000e+039.93SMESG000081227.1[more]
SMESG000081227.10.000e+039.93SMESG000081227.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030007 ID=SMED30030007|Name=Rootletin|organism=Schmidtea mediterranea sexual|type=transcript|length=6612bp
GTTGTTTTTAAATCACTATTTTTTTTATTTCATCTGATTATAATTTTTTT
TTATTGAAATTTGTATTTTGAAATTGGTGAACAATGAGTGAGATAGATTA
TTCCGCTATTGTTCGGAGACGCATTGGAGATATCGATGGGGATTCAAGTG
AAGATTCCAGTTCAAAGGGTTTGCTTCAAGTTAACTTGGAACTGAGAAAG
CGCTTAGAGGAAGAACACAATGAGTATCGTAGAAAGCTGATAGTTTTCCA
AGACAGCCAACAGAAACAAGCGCAATTGGTTCAAAGATTGCAGAAAAAGG
TATTGCAATACAAAGAAAAATGCACGGAACTTGAATCTAAAATGCAATTT
GGCGATTATGAGACTCGAAAAACGAAGTATGGAAGTCCAACGAATAACGG
CTATGGGTCGCGTAGTGAGAATCCCTACGACAATCTGGATTTGGAGAGCA
CACTCATTAAGTTAGAAGAGGAACAAAAAAAAACAAATTATCTAACGGAG
TTCAATGAACGGCTTCAAGAACAATTAACTCAAGCAACTCAATCAAACCA
GAATTTGACGAGAGACATCAGTAAGCTTTCCGAAGAATGGCAGAGATCAA
GGGAGGAGCTTGAACAGAGAGAAAAAATTTGGCGAAATGAAGAAATGTCA
TTTAATGACTATTTAGCATCTGAGCATTCGAATCTGCAAAATTTGCAACG
CAATACGATAAATTTCCGCCGTCAATTTATAGAATTGAAAGCTTCAACTG
AACGGGAAATAAATAATTTGAAAAATGAATTCAACCGACAGGCACGCTGT
TTGCAAACTGCTTGTTCCAATCTTTCGTGCAACATGAAATCTGCAGAATC
TAAACAACAATTGAGTACTGAACGAGAAAGTCGGGACAAGTTGAATCTCG
AAAATCAACTGCGAGAAAAAAACAGAGAATTAACTGATTACCAAACTCGG
TATGAATGTGAAATGACAGAATTGCAACACCGAGTGAAAGAATTAACAGT
TCTCAGTGACAAACTGAAAATTCAAAACCTGGAAAAGGATCGAGCATTGA
CAGCTTTGCAAAGAATTAAGAATGGAGATACCGCAGGAGAAATAAATATG
GAAGACAAAGCTACAAGAGTTCTTATTGAAGACACAGAAAGTATGCATCA
AGCACTTCGAAATATTTCTCAAGTAGTACTAAATGATTCTGACTATTTCG
ATGCAGAAGACACAGGATTTGAAACAGTTCGAAAGAATAATCGTTCGCCA
AGTCCAAGGAGAAATCGTAGCGTCAGTCCTAACTCAAGATCAGCTAAAAC
ACCGCCATTTGCCGATGCAACGTATGCGGCGGTTCAGTCGGCTATAAATA
AAAAATCTCTACAGATTCAAGAGCTTAAATCAAAATTAAACAGTTCTAAA
GAGAGTTGTACAAACTTCAAAAGACAAATTGATGACAATGAAAATGAACG
TCGACGATTAGAGAATCAAGTTCTCGCCATGAGAGATGAAATTGAAAGTT
TACGACGAGATAAAGATGATAGTTTTAGAGAAGCGGATCGGTTTAAAAAT
GCTCTGAACATCACTTCAAATGAACGAAGCCAATTGGAAAAGATTCGATC
ATCACTAAACGATCAAATTGAGCAGCAACTCACAGAAATTGAACGACTTA
AGTCAGCCAATCACGAATTACAACGATTGAGAGAGGCATTGGAAGATGAG
CAAGAAGATACTAAAAAAGACTTAGAAAGACAAATTAAAGAAAGTGAAAG
ATGCCAACGATCGATTGATGTTTTGGAAGATAAAATAAGTCGATTTAAAG
AAGACGTAGTTAATTACAAAGAGGCAATTAATAAATACCAATTAGAAAAA
GAAGTATTGGTGCAAGAAAAGGATGAGATTGGTGATGCTTTAAGTCGTTG
TGAAATTTCTAAAGCCGAATTAGAAATCGAGGTGAATAAACGGCAAACTA
TTGAAGTAAATTTGGAAGAAAACATTTCAAAATTATCCTCAGAAATCGAA
GAATTGAATGATAAGCGAGCTGAAAACCACAGAACTATTAAACAGCTGGA
ACATGAAAGAAGTTCTCTTTTGAATGAAAAACGATTTTTGGAACAAGAAA
AAAGTGGTTTGAAAGATGAGCTTGTTCGATCTGAACAAGAGGCTCTTGGT
TTGTCAAATGAGAAAGCCATTCAACGTCAAAGAATCGAACAACTTGAAAT
TAATACAGAAAGATTAGAAGAAGAGTTATCGGAACTCAATCGAGAAAAGC
TAGATCTTACTGAACAAATAGGCTGTTTGCAGAGGCAGAAATCGGCTCTT
GCAGAAGAATTGTTGCAATGTCGTAGAGAATTAGAACGATCTAATAACAG
TGTCAACAACTTATCAAAAGAAAAGGAATATCTTACCAAAGAGAAAGGAG
AACTCGTCGTTCAAGTTACAGCTTGCGAAAGGGAAAATCGTCAACAGTCA
GAAGTTATTGCTTCTTTGAATTCCGATAGAGAACAACTGGAAGCTACTCT
TTATGATGCTCAACAATTAATCATTCAGTTGGAAACTCGAAAAGAGCAAT
TAGAAGGCGAAAACCAAGAGTTGATTGTGAAAAAAGAAAATCTAAATGGA
GAACTAGTCAGATTACGACAAGAGTTTCAACTAGAATACGAGAAGGTTGT
TAATTCACGAGAACAATTAAATTGCAGATATCAACAAATGGATAAAGAAT
ATAAGATGGCAATTCAACAAGAGCGAGATTCTCATGCTGAAGATGTAGAA
AGACTAACTAAGATAAACGAAAGCAATCGTCATGGATCTGAAAACGAACG
AGAAGAGCTTATTCATCGATTCAATATGGAGCGTGACGACATGATTCAAA
ATTACGAACAAGAGAAACAAGAAATGGCCCAGGAAATCATGACGATCCAA
CGAGAACGAGATGACTCATTATTAATGGCGGAAAATGAAAAGCAGCAATC
ATTGAGTTTATTAGAACAAGAAAAATGTGCAATCAATGAAAAGCTTATCA
AAACGCAATTTGAACTGCAATCGGTTGAGTCGGAATTGGATCGCATTAAA
AAGGAGTCGTCCAATCGTCAGGAGCAAGACAAACAGAACATTGCCGGCTT
GTCGAGTGAACTCAAATCATTTAGATCTCAATTTGAGGATAAATGCCAAA
ATCACGAAATGGAAGTTAAAAGCCTAAATAGTGGAATCAAGGATCTAACA
TTAATGAAAGATCAAGCTCTCAAAGAAGTCCATGATTTGCATACCGGATT
AAAAATAGCTGAAGAAACCCGTGATAATTTGCGTCGGGAAATCATGGAAA
TGAATCGGAAATTGAAAGAAGCTGAGGAAGCCAAAGAGCACTTAAAGCGT
GAAATTAATGAATTGAAACGTGGATTATGCGAAGAACAAAGGGAAAAAGA
AAATGTTATTAACTCAAATGAGAATTTGAGAAAGAAAATTAAAGATGTTG
AAACAGAAAGAATTGATTTGCACAGACAAGTAACGGATTCCAAACAAAAG
GTTGCAGTACAAGATGAACAATTGGTCAATTCCAAACAAGAGGTCAATGA
GTTAAGAAACAATCTTAAAGACGTAGAAAAAGCTCGATTAGATGTCAAAA
GAGAGTTACAAGAACTCAGACGCCATATCAAAGAGCTAGATACGGAAAGG
GGCAAATTGACTAAAGAAGTCAATGATTTGCAAACTCGTGTTGCTAGAGA
TGAAGAAAAAGAGGATGAAGCTCGTCGGGAAAATTTCGGTCTCAAACAAA
AAGTTGTTGAAACGGAAGCTTCAAGAGAAGCCGTTCGTAAAGATCTTGCT
AATGCTCAACGACATATTGTTGATTTGGAAAATGTTCTGCAGAGCAAAGA
CAGAGATTTCAGTTCCATGGTGGAATCGAGCCGCCGGGATTATAGGAAAC
TTGCTGATGCGAGAAATAGCCTGCAACAAGTATATGATACGATGGTGGCC
GATAATAATGAGCTGAGAATTGCTCTCAGTGGAGCAGAAGGTCGGGTCAG
TGCTCTGGAGTCACACATCGCACGAGTTGAAGGAGCTAAGAAAGAAATTG
AATTCAAATTGGCTTCTATCCATAGCTCATTGCGAAGGCTGATAGGATTC
CGACAGGAGAATGTAGTTACTATTCGGTCGAGAAACAACTCCAAATCTCC
AGTTAGAGGTCGATCAGTTAGTCCTCTTAGAAGTAGGCCGGTGTCGCCAA
CCAAAGGATTTGACAATACCTATGCTACTACAACTGATGGAAAAGGTAGC
CCTATCCCGCGCACAGGGTCTCCGAGTTCTAAACGAAGGCAATTATCAAG
ATCTCCGTCTAATTGCGATTTCAATCCAGTCGATATAAATCCAGAAGCAG
TTCGTCTGGCCTTGCGAGAATTCGTACAGCAGTTGGTTGATGCTGAACGA
GATAGAGATGACGCTTTTGCTCAAGCTCGCAGCCTAGAATCTCGATTGAA
AGAACAAGAAGAACAAAATGAATATGCTGAAAACCGTTTACAACAACTAC
AACAAGCTCTGTGTGATGCAGAAGAAGACAAAAAAGGCATTGATGGAAGA
TTGTCATCAGCCCAAACTGCCTTAATGATGCAAGAAGAGACTATTCGGCG
CAATGAGAGAGATAGAAAAGCAATGGCGGAAAAGTTGAGTAATTACGATA
GAACATTTGCATCCATGGAATCAGAAAAACGACAATTGGAAGATCGGTTG
AATAAATTCCGTCATCATGATGCCCGATTGGAAGAAGAACATAAGCAGAG
CAAAAAAGCTATTGAAAATGCTGAAAATAGAATAACTCAGCTTCAGCTTG
CCAAGCGATCGTTAGAAGGAGATCTTCAAAGAATGAAAATGGCGTTGACA
GATAAAGAAACAGAAACCGAAGTTTTGGATGACCGCGTAAATAGTTTACT
CAAACAAATACAAGATCTCGAGGGAAAATCTCAATCACTTCAACTAACGA
TTGACAGAATGAGTGTCGCCCTTGCAAAAACTGAGGAAGAAGGCAGTTTT
CATAAGGACAAAATGCAACAGTTGAATATGAGTTTGAGCACTCATTCACA
ACAACTGGAACAATTACAGAATAAGATTTCTCAATTACAAAAAGCACTCG
GCAGTTCAGAACAAGATCGTCGGCTCTTAGAGGAACGATTAGAAAGCTCT
AAAGGAGCATTGCATGAGGCAAAACATCAAAATAATTTGTTGATGGAAAG
AATACAAATAATTCAATCCGATTTAAATGATTCGGAAAATCGTCGATCAG
AATTGGAAGGATTAAATCGACAGAGTAACACTTTGATTGTACAAAGACAA
GAAGCTGAACAAGAACTCAATCAAAAATATCAGAAATTGAACTCGGAGAA
AAACACATTACAAGAGCGAGTGAATAGCATGCAACGAAATTTGGCTTTGG
CAGAAGCAGAAAAACAAGAAATAATAAAAAACCACGGAAAATTGGAAAAG
GATAGATCTGCCTTGAAAAAGAGTCTTGGAAAAGTTGAACGTCAGAAATT
GAAAACCGAAGAAATTGCTAGCAAAACTGTTTTTGAACGTTCAGAATTAG
ATCAAATTTTAAGGAGACTTGAAGATGAAAATTGTGAATTACAGAGACAA
GTTGGAATTCTTCAAAATCAATTAGCAGAAGCTGAGCAAGCTCACTGCCA
CCATTTGATGGAAATCAATTCCCGCCATCGCCAGGAAATGTCCATGGAAA
TGGAGCATTTGAGAGCATCGAATGTTCAAATAGAACGAACTCTAGAAGGC
AGAGAACGAGCCCACAGACAAAGAGTTAAGGGTCTGGAAGAACAGATCTC
CACCCTCAAAGACCAGCTGACTCATGAAATGCAGAGGCGGATGGATAGTG
GATATTACGAGTCTACCAGAAAGTCTAATCAATACGATTCAACTGGTGAC
TTGCGACATGTTCTGGATTCCAGTTTAACTCGAGTTGCAAAAGACCCTCA
ACTGGACGCAATGCTACTGGAAACCGAAGCCAGGCGACTCGATGAGTCGA
TATTCATGTGTGGCAGTCGTGATCAGTCTCCGACCCGGCAGAAGCGAATC
GAAATGTCAAAGAAGTCCGCAGCCCCTAACAATTCCAATCGGCGATTAAC
TGCCGGCCGTCGCAAATGAACTCGGCCTGTTCCAGTCCGTCCAGAGATGT
TATGAAGCCACTTTTTAGATGCGTGAGTGTGAGTTCGTGTTGGTGACTGA
TTCATTTTTAGTAAACAGATTCTGGATTTTTGTTTTTATTGATAGTGTAA
TTTCCTAATGCAGATCTGATAGTTGACTTGTTGTTCTTACGTATTCGGTA
TTTGTGATTCACATAGTCTGTCATTGTTACTGTGATTTATCCTCTGTGTG
ACTTTTGTGATTTACTTACTTTATTGCCCCTATAATCAATAAATGGATTT
ATCGATAGTTCAGCCCTCCCCTCCAGCCCTCGTTTTGGGATCCGTAAATT
TTGTTTCAATTGAGATCATTATAGTGATTTTATTCCTTCGAAACCAAACC
TTTGGGAGGGACATAAAATTAAATTATTGATTTTTTATTATCTTAGAAGT
GAAAGATGTTTATTTCCCAAATTAACTAATATCAATAATAACTTTAATTT
ATATCTTCATTA
back to top

protein sequence of SMED30030007-orf-1

>SMED30030007-orf-1 ID=SMED30030007-orf-1|Name=SMED30030007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2012bp
MSEIDYSAIVRRRIGDIDGDSSEDSSSKGLLQVNLELRKRLEEEHNEYRR
KLIVFQDSQQKQAQLVQRLQKKVLQYKEKCTELESKMQFGDYETRKTKYG
SPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQ
ATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSN
LQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCN
MKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHR
VKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIED
TESMHQALRNISQVVLNDSDYFDAEDTGFETVRKNNRSPSPRRNRSVSPN
SRSAKTPPFADATYAAVQSAINKKSLQIQELKSKLNSSKESCTNFKRQID
DNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQ
LEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQ
IKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIG
DALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHR
TIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQR
IEQLEINTERLEEELSELNREKLDLTEQIGCLQRQKSALAEELLQCRREL
ERSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDRE
QLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQL
EYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRH
GSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAE
NEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDK
QNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVH
DLHTGLKIAEETRDNLRREIMEMNRKLKEAEEAKEHLKREINELKRGLCE
EQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNS
KQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQ
TRVARDEEKEDEARRENFGLKQKVVETEASREAVRKDLANAQRHIVDLEN
VLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSG
AEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSR
NNSKSPVRGRSVSPLRSRPVSPTKGFDNTYATTTDGKGSPIPRTGSPSSK
RRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARS
LESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQ
EETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLE
EEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDD
RVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMS
LSTHSQQLEQLQNKISQLQKALGSSEQDRRLLEERLESSKGALHEAKHQN
NLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQ
KLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGK
VERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEA
EQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKG
LEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTR
VAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRIEMSKKSAAPNN
SNRRLTAGRRK*
back to top
Aliases
The feature 'Rootletin' has the following synonyms
Synonym
H.2.8b
crocc
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007098centrosome cycle
GO:0051297centrosome organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000054dorsal region of the epidermis
PLANA:0000055dorsal stripe
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0000088renal system
PLANA:0000087proximal tubule
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000022Category 5 cell
PLANA:0004529integumental system
Vocabulary: cellular component
TermDefinition
GO:0035253ciliary rootlet
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000007Stage 7