Rootletin

Overview
NameRootletin
Smed IDSMED30030007
Uniprot Best hitRootletin OS=Mus musculus GN=Crocc PE=1 SV=2 (E=0)
Length (bp)6612
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rootletin (SMED30030007) t-SNE clustered cells

Violin plots show distribution of expression levels for Rootletin (SMED30030007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rootletin (SMED30030007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rootletin (SMED30030007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Rootletin vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 706/1937 (36.45%), Postives = 1145/1937 (59.11%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKM--QFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXX-AKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS---------------------GLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINS-RHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE   YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE ++  + G+ E ++ +              +   + DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++         ++++A  +  ED E + Q LR+++Q VL+DS+            DA +     +        PRR+      S     +P  +D+ T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +                     GL+  L  +EQ    L  +    R                      E+  L EQ+  L RQ S   +EL Q RRE +R   ++   ++EKE L KE   L VQ+ A ERE R  SE    L  ++E LE +L++ Q+ + QLE R+EQLE E Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL +  E+     E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H  EV+ L    +DL   +D  L+E  +L T L++ E+ RD LRRE++E  RKL+E++E +E  ++E  EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E      +E  ELR  L++VE++RL+ +RELQELRR +K LD+E  +L +E+ +LQ R+A  E  E E+RRE  GL+Q++++ EAS E +R++L  AQR + + E   ++++R     +E +R   ++  D    L+   +   A+  EL + LS AEGR   LE+ +ARVE  ++  E +L  + S+LRR +G  +      R    S +                              G+G   P T   S   +  S  P+    +P D++PEAVR ALREF+Q+L  A+R+RD+   Q  +L  +L E E + + A +R +QLQ+A+ ++EE ++ +DGRLS  Q  L +QEE++RR+ER+R+A  ++++  +R+  + ESE R  +++++K + ++ +LE + ++ K+ ++ +E+R  +L+L +RSLEG+LQR ++ L+D+E + + L DRV+SL +Q+ D E K+ +LQLT++R++ ALAK EE     +DK++ L  +L+  S  L   ++K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ ++ D E +R E EG  +Q   ++ QRQE E       QKL  E+  LQER+ S+QR LA  EAEK+E+ ++  +LEKDR AL+++L KVER+KL++ E   +   E+  LD+ L   E E  E QRQ+  L+ Q+   EQ+H    +E+++ + + E+  E+E LR++  Q ERTLE RERAHRQRV+GLEEQ+STLK QL  E++R
Sbjct:  135 RGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKRCSELEQQLLERSGELEQQRLR--------------DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLR---------LQEQAA-LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRH---------------------ERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGLGRAPSPAPRPVPGSPA----------------------RDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASP-DLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSATSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQRVRGLEEQVSTLKGQLQQELRR 2003          
BLAST of Rootletin vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 567.385 bits (1461), Expect = 1.803e-171
Identity = 450/1264 (35.60%), Postives = 731/1264 (57.83%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXX-AKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS---------------------GLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGF 4100
            DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++         ++++A  +  ED E + Q LR+++Q VL+DS+            DA +     +        PRR+      S     +P  +D+ T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +                     GL+  L  +EQ       ++A+++Q               L  L  E+  L EQ+  L RQ S   +EL Q RRE +R   ++   ++EKE L KE   L VQ+ A ERE R  SE    L  ++E LE +L++ Q+ + QLE R+EQLE E Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL +  E+     E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H  EV+ L    +DL   +D  L+E  +L T L++ E+ RD LRRE++E  RKL+E++E +E  ++E  EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E      +E  ELR  L++VE++RL+ +RELQELRR +K LD+E  +L +E+ +LQ R+A  E  E E+RRE  GL+Q++++ EAS E +R++L  AQR + + E   ++++R     +E +R   ++  D    L+   +   A+  EL + LS AEGR   LE+ +ARVE  ++  E +L  + S+LRR +G 
Sbjct:   74 DLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLR---------LQEQAA-LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQ------AQEALEQQ---------------LPTLRHERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGL 1306          
BLAST of Rootletin vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 301.982 bits (772), Expect = 1.368e-84
Identity = 235/671 (35.02%), Postives = 390/671 (58.12%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKM--QFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVX-XXXXXXXXXXXXXXXXXXXXAKTPPFAD-ATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS 2105
            +GL++ ++ELR++L+EE   YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE ++  + G+ E ++ +              +   + DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++  + A           +  ED E + Q LR+++Q VL+DS+            DA +     +  +   SP  R +     + R   +P  +D +T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +
Sbjct:   29 RGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKRCSELEQQLLERSGELEQQRLR--------------DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAA----------LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEAT 675          

HSP 2 Score: 69.707 bits (169), Expect = 5.262e-11
Identity = 43/98 (43.88%), Postives = 73/98 (74.49%), Query Frame = 3
Query: 2790 ENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDK 3083
            E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+
Sbjct:  740 EAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDR 837          
BLAST of Rootletin vs. Ensembl Human
Match: CROCC2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:HGNC Symbol;Acc:HGNC:51677])

HSP 1 Score: 265.388 bits (677), Expect = 1.210e-70
Identity = 331/1177 (28.12%), Postives = 613/1177 (52.08%), Query Frame = 3
Query: 1488 EIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEEL-NDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQE-ALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERD-DMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQ--SLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRH-------HDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKE-------TETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRM 4961
            E E+LR   +    E  + + +  +   E++ LE +   L  + +    E + L++   ELQR      + +E+     ER  +  E  Q  +  LE+K+S  +E++ + +EA++  QL+++V+  E++ +  AL+R E S A+LE+ V + ++  V   ++++ +++ +E L  DK A NH  + QLE ER  L  +++ LEQE++   ++L ++EQ+ AL  +  + +Q Q   +LE   E+LE + + L REK  L EQ+G +  QK AL E+L Q  ++ E    ++    + K+ L++E+ +L+ +  A ER+ R  +E  A L  +R+ LE++L +AQQL  +L   +EQLE E +   + ++ L  E+ +L+ +++++  K+     +L  +  Q ++E + A++ +  +H E + +L +  E+       E+E  + R  +E++ +++     E++ +  EI ++++ERD+SLL  E++ QQ  +LSL E E+  ++E       EL      L+R+++E+ ++QEQ +  I+  + ELK+ ++QFED    H+ E  +L   ++DL   +    +E   L   L +A+E    LR+E+  +        E++E L RE  E +R L +E REK+ ++  N  LR  I   E E+    R   + +QK+ + +E     +QE + LR +L ++E+A  D ++EL+EL R ++ L  E  + + E ++LQ + +++             L+++  + EA  E  RK++   QR + ++E   ++  +     +  SR   + L    +S+ +         + L+  L  A  R+ +LE  +A+ EGA+++ E +L  + S+LRR +G ++++      +  S                   TKG D++ A       SP  R   P S  R  S +P       +D+    V+  LR+FVQ+L +A+R+RDD+  Q  +L SRL E E +   A++R+ QLQ+AL +AEE ++ ++G LSSA+ A  +Q+E +RR E +  A          +  +   EKR+L+++L   R        H   L ++ K  ++ + N E+R    Q A+ SLE  L++M+     +E        E E LD  +NSL +++     ++Q LQ  +  M
Sbjct:  461 EREALRGQLEAQRLEVQQCRASCKLLGREKAALEMVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRERSCRALETSQGRLQQLEEKVSGLREELASVREALSTAQLQRDVVESEREGLRSALARAECSNADLELLVRRLKSEGVEQRDSLAAMAALMEGLAQDKSALNHLAL-QLEQERDQLREQRKTLEQERARAGEQLAQAEQQLALERAERRGLQ-QACGRLEQRQEQLEGQAALLGREKAQLQEQVGQVTCQKQALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQEALERQGRLAAEEAADLRVERDSLESSLLEAQQLATKL---QEQLEEEARSAGLARQALQVEMEQLQSDWEVQEMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKE--VARCQLEQEKELVTKSAAEREALKGEIQSLKQERDESLLQLEHKMQQVMALSLKETERSLLSE-------ELSRARRTLERVQQEAQSQQEQAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLAAERGDVEREAERLRAQLTVAQEGLAALRQELQGVE-------ESREGLHREAQEARRALSDEAREKDVLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILEEAQAALQQEASALRAHLWELEQAGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEV----------LELRRQAAKAEAKHEGARKEVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRAELHSVTRKLQEASGVADALQARLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQSPWASPEQPGSP------------------TKGSDSSQALPGQQGTSPPAR---PHSPLRWPSPTPGGRSSELMDVA--TVQDILRDFVQKLREAQRERDDSRIQMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLA----------SVRAAGQEKRRLQEQLETLRQALEESRRHSQGLAKQGKLLEEQLTNLEHRC---QKAEVSLE-PLRQMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEM 1569          

HSP 2 Score: 84.3445 bits (207), Expect = 2.378e-15
Identity = 66/209 (31.58%), Postives = 105/209 (50.24%), Query Frame = 3
Query:  432 NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL 1058
            ++DLE  L +LE  ++++  L + N  L+EQL    ++N  L R+++ ++   QR + ELE R   W   +         +  +L  L R  +       EL+ +TER + +L+ +  R AR L TAC NL  N++       LS    S     L  QLR+K  E+   Q R++ E   LQ R+ E T+L +KL  QN +K + + AL
Sbjct:  147 SVDLEEALGRLEAAEERSTGLCQVNALLREQLEHMKKANDALGRELAGMTGSVQRLQGELELRR--WAQRQTRSGGL--GQPRDLLLLWRQAVVLGTDLAELRVATERGLADLQADTARTARRLHTACLNLDSNLR-------LSA---SSTASTLGQQLRDKAGEMLQLQGRWDAEKVALQARLSEQTLLVEKLTEQNEQKAKTIAAL 341          

HSP 3 Score: 62.3882 bits (150), Expect = 1.280e-8
Identity = 84/278 (30.22%), Postives = 143/278 (51.44%), Query Frame = 3
Query: 5010 KMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQ-NNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            +M  L+  LS    +  + Q+++ QLQKAL  +E+ +R +E  L S++ A    K     L +E +  +++     E RR     L  Q  TL    ++A +E  +  Q L  +   L+E++ +++        +K E+      LE  R        ++E++ LK EE  ++   E+ +LDQ L  L  E     RQ   LQ Q+ E EQAH   L ++ ++H+++++ E E L  +  Q  + LE +E  H+Q+VK LEEQ+++LK+QL  E+Q R
Sbjct: 1390 QMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLASVRA--AGQEKRR-----LQEQLETL----RQALEESRRHSQGLAKQGKLLEEQLTNLEHR-----CQKAEV-----SLEPLR--------QMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQEWTHQQQVKVLEEQVASLKEQLDQEVQWR 1638          
BLAST of Rootletin vs. Ensembl Human
Match: CEP250 (centrosomal protein 250 [Source:HGNC Symbol;Acc:HGNC:1859])

HSP 1 Score: 203.756 bits (517), Expect = 1.704e-51
Identity = 269/1011 (26.61%), Postives = 506/1011 (50.05%), Query Frame = 3
Query:  309 YKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNL----------ENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL-QRIKNGDTAGEINMEDKAT--RVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELN-DKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIME 3299
            Y+  C ELE +++           G P    + +  E   D L     L++LEEEQ++   L E N +L+  + +A   N+ L  D+ KL+ +W R+R+EL ++E  W+ E+  F  YL  EH  L +L R  + FRR F+E+K++T+R++  LK E  R +  L T C  L+   +S E     S   + R+   L          E +  E+++EL   +++ + E  ELQ RV EL+ L  + + QN + ++ + AL + ++  +T     ME +A+  R   E+  S+ Q +++I+QV++ + D   A+ +G E   + + S   + +               AD     V+S + ++   +Q+L+ +L   +E+    ++Q D  E E +       A+R  ++ L  ++D    +    +  ++  S ER  L+K R  L  Q+E    E  RL+  N ELQ   ++ + ++E+ +++L   ++E ER Q  +  LE K S    +++  +EA+    LE E+L QE+ E+  AL+R E S AEL    N  +T   +L     KLS+  E L  DK   N + + QLE E  S+ +     EQ ++ L+ +L  +E+    L  +      ++++ E     L+ +L ++  EK ++ +++   + Q+ A   +L Q  +E +R    +    +EKE L +EK  L V++ A ER+ +  +E +  L+S +E LE++L++AQQ    +E  K QLE + Q +   KE + GE+  L+ E   E  +    R+    +  Q ++E K A++Q++ +H ++V +L +  E  R   + E  + +   ++ER+ M    E   +E   E+  IQ +R++    AE+   Q     E+E+ ++ E L++TQ EL     +L+R++++   ++ ++++    L ++L+  + + ++  + H  ++ +L      L   K    K+V DL + L   ++++  + +E+ E
Sbjct:   66 YRSWCQELEKRLEA---------TGGPIPQRWENVEEPNLDEL-----LVRLEEEQQRCESLAEVNTQLRLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNG--SGRMDGREPAQLLLLLAKTQELEKEAHERSQELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNEDYEKMIKALRETVEILETNHTELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNI-AQGSGHENSLELDSSIFSQFDYQD------------ADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQQQHDQWEEEGK-------ALRQRLQKLTGERDTLAGQTVDLQGEVDSLSKERELLQKAREELRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVKLSALNEALALDKVGLNQQLL-QLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALE--SLEREKM--ELEMRLKEQQTEMEAIQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQE 1035          
BLAST of Rootletin vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:RefSeq peptide;Acc:NP_508848])

HSP 1 Score: 92.4337 bits (228), Expect = 3.859e-18
Identity = 113/457 (24.73%), Postives = 230/457 (50.33%), Query Frame = 3
Query: 4479 ENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFR------HHDARL---EEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNM-SLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQL 5819
            E R + ++  L DAEE+++ ++ RL SA+T L  QEE +++ + +R+ M  K+   +      E++ R L ++L   R      H D R    +EE   S +          QL+   R  + D  + ++ +   E+E ++L +++  L   ++  + K Q ++   D++   L K E   S   +  + +++ S ++H  QL  L++++   Q  L  +   ++ LE  L + +  + + K + + +  R+  +Q  L D+   ++ +E        ++   +  E +L Q+ +   +EK    + +  ++R LA  E E++   +     +K++  L K +  +E +K +T+    +T  +R  +++ L  +E EN EL +    LQ Q+A+ E  + + ++E+ ++ R+E   ++  +R    QIE+ +E RER HR R+K LE+QI+ L+DQL
Sbjct: 1778 ETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTDIRSLRDKEEQWDSSRF---------QLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAE---SVENELRKTIDIQSKTSHEYQL--LKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQL 2220          
BLAST of Rootletin vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:RefSeq peptide;Acc:NP_508848])

HSP 1 Score: 92.0485 bits (227), Expect = 5.158e-18
Identity = 113/457 (24.73%), Postives = 230/457 (50.33%), Query Frame = 3
Query: 4479 ENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFR------HHDARL---EEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNM-SLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQL 5819
            E R + ++  L DAEE+++ ++ RL SA+T L  QEE +++ + +R+ M  K+   +      E++ R L ++L   R      H D R    +EE   S +          QL+   R  + D  + ++ +   E+E ++L +++  L   ++  + K Q ++   D++   L K E   S   +  + +++ S ++H  QL  L++++   Q  L  +   ++ LE  L + +  + + K + + +  R+  +Q  L D+   ++ +E        ++   +  E +L Q+ +   +EK    + +  ++R LA  E E++   +     +K++  L K +  +E +K +T+    +T  +R  +++ L  +E EN EL +    LQ Q+A+ E  + + ++E+ ++ R+E   ++  +R    QIE+ +E RER HR R+K LE+QI+ L+DQL
Sbjct: 1705 ETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTDIRSLRDKEEQWDSSRF---------QLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAE---SVENELRKTIDIQSKTSHEYQL--LKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQL 2147          
BLAST of Rootletin vs. Ensembl Fly
Match: Rootletin (Rootletin [Source:FlyBase gene name;Acc:FBgn0039152])

HSP 1 Score: 325.865 bits (834), Expect = 3.302e-89
Identity = 489/2036 (24.02%), Postives = 1003/2036 (49.26%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYG-------SPTNNGYGSRS-------------------ENPYDNLDLESTLI------------KLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTG----FETVXXXXXXXXXXXXXXXXXXXXXAKTP---------PFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQL--NCRYQQMDKEYKMA-----IQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRS-------QFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEG------LNRQSN-----TLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSL-------GKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLA--EAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM 6008
             LL+ N ELR+RL +E + YRR+L  ++ +Q  QA LV RLQ K+ QY+++C++LE +M    +ET K   G        PTN    S S                       D +D    L+            KLEEE ++   +   N  L++QL ++ ++N+ LT D+ KL+ +W   R+EL  +E  ++ EE +F DY  SEH+ L  + R  +  +R F E++ + + E+  +  E N   + +  + + ++  ++ A+       ++  R    L+NQL          + +YE    E+  R + L  L ++LK                K  D   +   +        ++ E ++ ++R I+Q V+ D++  D    AE TG       + ++  S       + S      K+P          FA+ T +AVQ+A++K  L + +++ K  ++ E+    K Q++ +E  ++ L  ++  + ++++S      +  +E +  +  L+    ++ Q E  R+ +N   E   ++ E+++    +LQ+  +++E++++  + +++R +K+    + ++   ED+ SR +E+ ++ +E +N+  L +++L Q++ E  + ++  E  K++LE +++K    + +L+E   KLS+     +D+       +++ + ER  L  +      E   LK EL   ++  L L  +     ++++ L++  E++ ++L+ + R++ D+  Q+  + R+K AL EEL++ R+ LE++  + + L++  E + K+  E  V +   E++  + +E++A+L S++E LE+ L+D    +   E R+ QLE + QE +V++E+L   + RL++E +    K   ++ QL    R  + D   K+A      ++    H E++ +L       R+  E   ++ +      +DD I+  ++    +   + ++ ++ +++L+ AE+EKQQ+L +  ++K A+ E+L     +L++ +  LDR ++E++ R E+ +  IA L  E+   R+       + E+  +  E+++ SL    + L  + +       +L   +++ E+  ++   E+ +  RK KE E   + L++E+ + +R L +   E++    SN+ LR  +K VE+ + +  R + ++ QK++  ++   + + E   L   LK+ E       ++L   +  +++   E  +  +   +LQ ++  + E ++ A++E   +K+++ + EA+  A R++L  A+      E+   +++++ +  +E  R   ++L D +++L+           EL+  L GAEGR+ AL+  ++ VE  K++ E KL+S+  +LRR+ G + +  V +  R  S                   ++ F            SP    G         +RS S C   P+D++P+ VR  +R  + Q+   ER++DD  +Q  + + +L++  +Q    + +L +LQ  L + +E+K  ++       +A+   EE ++    + + + E+L+  +   A+   E  Q E+RL K R   ++L+ E +Q ++ +   E R ++L+L + ++EGDL R++MAL +K+     + +R+ +  + +  LE +  +L+ T+D++   L K+    +  + +++ L   LS      +  ++K+  +QK+L ++E ++R+L ERL+S++  L+E +      ++  Q +Q  + D E +RS LE        N++S      T        E+EL+++ +    EK+ L+ ++ ++Q  +   E +++   K  G    DR+    S        G+ +  +       +        LD  +  +E E  +L+ +V  L+  LA  E+E A C   M  N   +    ++ +  R++ +  E+ L+ RE++HRQ+V  LE QIS L++QL  E +RR    Y   + K+N+      LR  L  SL  V++ P +D  LLE+E+RRLD ++ M
Sbjct:   90 ALLRQNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERM----HETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVD--DVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEINCVGKDINGSNATVAFAVQQAKRAADDELKQSQRSNDELQNQL-------ATLKVQYESARHEIMERDQRLLELMNQLK----------------KLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREADAEVTGGVMQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVVIDLHEKDTHRLNELLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKIANLQACAEEAAKRHGEEILQL-------RNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSE-------ELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQNNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGIQVDGSVNLSHRLLSP------------------SRRF------------SPSRSCGDYD------NRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRKMKISAIQALEEKLKHRNDECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLRIAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKS--KFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYDVGGGNAGGGSFNCGLDHSV--IEQETRDLRLKVRRLETLLAEKESELARCKARM--NDSAKCHDGLDGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQ--YILRSSKANR--EMQHLRSTLGDSLRNVSQHP-VDPHLLESESRRLDSAVSM 2035          
BLAST of Rootletin vs. Ensembl Fly
Match: Rootletin (Rootletin [Source:FlyBase gene name;Acc:FBgn0039152])

HSP 1 Score: 325.865 bits (834), Expect = 3.302e-89
Identity = 489/2036 (24.02%), Postives = 1003/2036 (49.26%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYG-------SPTNNGYGSRS-------------------ENPYDNLDLESTLI------------KLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTG----FETVXXXXXXXXXXXXXXXXXXXXXAKTP---------PFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQL--NCRYQQMDKEYKMA-----IQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRS-------QFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEG------LNRQSN-----TLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSL-------GKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLA--EAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM 6008
             LL+ N ELR+RL +E + YRR+L  ++ +Q  QA LV RLQ K+ QY+++C++LE +M    +ET K   G        PTN    S S                       D +D    L+            KLEEE ++   +   N  L++QL ++ ++N+ LT D+ KL+ +W   R+EL  +E  ++ EE +F DY  SEH+ L  + R  +  +R F E++ + + E+  +  E N   + +  + + ++  ++ A+       ++  R    L+NQL          + +YE    E+  R + L  L ++LK                K  D   +   +        ++ E ++ ++R I+Q V+ D++  D    AE TG       + ++  S       + S      K+P          FA+ T +AVQ+A++K  L + +++ K  ++ E+    K Q++ +E  ++ L  ++  + ++++S      +  +E +  +  L+    ++ Q E  R+ +N   E   ++ E+++    +LQ+  +++E++++  + +++R +K+    + ++   ED+ SR +E+ ++ +E +N+  L +++L Q++ E  + ++  E  K++LE +++K    + +L+E   KLS+     +D+       +++ + ER  L  +      E   LK EL   ++  L L  +     ++++ L++  E++ ++L+ + R++ D+  Q+  + R+K AL EEL++ R+ LE++  + + L++  E + K+  E  V +   E++  + +E++A+L S++E LE+ L+D    +   E R+ QLE + QE +V++E+L   + RL++E +    K   ++ QL    R  + D   K+A      ++    H E++ +L       R+  E   ++ +      +DD I+  ++    +   + ++ ++ +++L+ AE+EKQQ+L +  ++K A+ E+L     +L++ +  LDR ++E++ R E+ +  IA L  E+   R+       + E+  +  E+++ SL    + L  + +       +L   +++ E+  ++   E+ +  RK KE E   + L++E+ + +R L +   E++    SN+ LR  +K VE+ + +  R + ++ QK++  ++   + + E   L   LK+ E       ++L   +  +++   E  +  +   +LQ ++  + E ++ A++E   +K+++ + EA+  A R++L  A+      E+   +++++ +  +E  R   ++L D +++L+           EL+  L GAEGR+ AL+  ++ VE  K++ E KL+S+  +LRR+ G + +  V +  R  S                   ++ F            SP    G         +RS S C   P+D++P+ VR  +R  + Q+   ER++DD  +Q  + + +L++  +Q    + +L +LQ  L + +E+K  ++       +A+   EE ++    + + + E+L+  +   A+   E  Q E+RL K R   ++L+ E +Q ++ +   E R ++L+L + ++EGDL R++MAL +K+     + +R+ +  + +  LE +  +L+ T+D++   L K+    +  + +++ L   LS      +  ++K+  +QK+L ++E ++R+L ERL+S++  L+E +      ++  Q +Q  + D E +RS LE        N++S      T        E+EL+++ +    EK+ L+ ++ ++Q  +   E +++   K  G    DR+    S        G+ +  +       +        LD  +  +E E  +L+ +V  L+  LA  E+E A C   M  N   +    ++ +  R++ +  E+ L+ RE++HRQ+V  LE QIS L++QL  E +RR    Y   + K+N+      LR  L  SL  V++ P +D  LLE+E+RRLD ++ M
Sbjct:   90 ALLRQNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERM----HETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVD--DVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEINCVGKDINGSNATVAFAVQQAKRAADDELKQSQRSNDELQNQL-------ATLKVQYESARHEIMERDQRLLELMNQLK----------------KLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREADAEVTGGVMQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVVIDLHEKDTHRLNELLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKIANLQACAEEAAKRHGEEILQL-------RNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSE-------ELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQNNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGIQVDGSVNLSHRLLSP------------------SRRF------------SPSRSCGDYD------NRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRKMKISAIQALEEKLKHRNDECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLRIAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKS--KFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYDVGGGNAGGGSFNCGLDHSV--IEQETRDLRLKVRRLETLLAEKESELARCKARM--NDSAKCHDGLDGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQ--YILRSSKANR--EMQHLRSTLGDSLRNVSQHP-VDPHLLESESRRLDSAVSM 2035          
BLAST of Rootletin vs. Ensembl Fly
Match: Rootletin (Rootletin [Source:FlyBase gene name;Acc:FBgn0039152])

HSP 1 Score: 325.865 bits (834), Expect = 3.302e-89
Identity = 489/2036 (24.02%), Postives = 1003/2036 (49.26%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYG-------SPTNNGYGSRS-------------------ENPYDNLDLESTLI------------KLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD----AEDTG----FETVXXXXXXXXXXXXXXXXXXXXXAKTP---------PFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQL--NCRYQQMDKEYKMA-----IQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRS-------QFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEG------LNRQSN-----TLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSL-------GKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLA--EAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM 6008
             LL+ N ELR+RL +E + YRR+L  ++ +Q  QA LV RLQ K+ QY+++C++LE +M    +ET K   G        PTN    S S                       D +D    L+            KLEEE ++   +   N  L++QL ++ ++N+ LT D+ KL+ +W   R+EL  +E  ++ EE +F DY  SEH+ L  + R  +  +R F E++ + + E+  +  E N   + +  + + ++  ++ A+       ++  R    L+NQL          + +YE    E+  R + L  L ++LK                K  D   +   +        ++ E ++ ++R I+Q V+ D++  D    AE TG       + ++  S       + S      K+P          FA+ T +AVQ+A++K  L + +++ K  ++ E+    K Q++ +E  ++ L  ++  + ++++S      +  +E +  +  L+    ++ Q E  R+ +N   E   ++ E+++    +LQ+  +++E++++  + +++R +K+    + ++   ED+ SR +E+ ++ +E +N+  L +++L Q++ E  + ++  E  K++LE +++K    + +L+E   KLS+     +D+       +++ + ER  L  +      E   LK EL   ++  L L  +     ++++ L++  E++ ++L+ + R++ D+  Q+  + R+K AL EEL++ R+ LE++  + + L++  E + K+  E  V +   E++  + +E++A+L S++E LE+ L+D    +   E R+ QLE + QE +V++E+L   + RL++E +    K   ++ QL    R  + D   K+A      ++    H E++ +L       R+  E   ++ +      +DD I+  ++    +   + ++ ++ +++L+ AE+EKQQ+L +  ++K A+ E+L     +L++ +  LDR ++E++ R E+ +  IA L  E+   R+       + E+  +  E+++ SL    + L  + +       +L   +++ E+  ++   E+ +  RK KE E   + L++E+ + +R L +   E++    SN+ LR  +K VE+ + +  R + ++ QK++  ++   + + E   L   LK+ E       ++L   +  +++   E  +  +   +LQ ++  + E ++ A++E   +K+++ + EA+  A R++L  A+      E+   +++++ +  +E  R   ++L D +++L+           EL+  L GAEGR+ AL+  ++ VE  K++ E KL+S+  +LRR+ G + +  V +  R  S                   ++ F            SP    G         +RS S C   P+D++P+ VR  +R  + Q+   ER++DD  +Q  + + +L++  +Q    + +L +LQ  L + +E+K  ++       +A+   EE ++    + + + E+L+  +   A+   E  Q E+RL K R   ++L+ E +Q ++ +   E R ++L+L + ++EGDL R++MAL +K+     + +R+ +  + +  LE +  +L+ T+D++   L K+    +  + +++ L   LS      +  ++K+  +QK+L ++E ++R+L ERL+S++  L+E +      ++  Q +Q  + D E +RS LE        N++S      T        E+EL+++ +    EK+ L+ ++ ++Q  +   E +++   K  G    DR+    S        G+ +  +       +        LD  +  +E E  +L+ +V  L+  LA  E+E A C   M  N   +    ++ +  R++ +  E+ L+ RE++HRQ+V  LE QIS L++QL  E +RR    Y   + K+N+      LR  L  SL  V++ P +D  LLE+E+RRLD ++ M
Sbjct:   90 ALLRQNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERM----HETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVD--DVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEINCVGKDINGSNATVAFAVQQAKRAADDELKQSQRSNDELQNQL-------ATLKVQYESARHEIMERDQRLLELMNQLK----------------KLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREADAEVTGGVMQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVVIDLHEKDTHRLNELLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKIANLQACAEEAAKRHGEEILQL-------RNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSE-------ELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQNNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGIQVDGSVNLSHRLLSP------------------SRRF------------SPSRSCGDYD------NRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRKMKISAIQALEEKLKHRNDECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLRIAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKS--KFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYDVGGGNAGGGSFNCGLDHSV--IEQETRDLRLKVRRLETLLAEKESELARCKARM--NDSAKCHDGLDGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQ--YILRSSKANR--EMQHLRSTLGDSLRNVSQHP-VDPHLLESESRRLDSAVSM 2035          
BLAST of Rootletin vs. Ensembl Zebrafish
Match: crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:ZFIN;Acc:ZDB-GENE-131121-625])

HSP 1 Score: 606.29 bits (1562), Expect = 4.025e-180
Identity = 604/1911 (31.61%), Postives = 1054/1911 (55.15%), Query Frame = 3
Query:  210 EEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYD---NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLAS-EHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATR-VLIEDTESMHQALRNISQVVLNDS--DYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQ-----SKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIP--RTGSPSSKRRQLSRSPSN---------------CDFNPV-----DINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            EE   YR KL  +Q+SQ +QAQLVQ+LQ K+LQYK++C  LE ++     E+ K +    ++    +     ++   +LD+++ L  L++EQK+ + L++ N  L+EQL QA ++NQ LT       E  Q++R+E EQR+   R E +  N    S E   +++L R     R  F +L+A  +R +++L+ E+   +  L+ AC NL       E+ +  S    S     LE QLR+K RE    Q R++ E  EL  R+ EL  +  +L+ QN EK+  L AL+   N +       ED+A R  L  +  S+HQ L NI+QVV  +   D     +  F +    + S                +  P       AVQ A+ ++  Q ++L++ L +S+E     ++Q+   E++ R LE ++  ++ E + L R ++DS R+A+R++N+L I ++E+ +LE+  S++  Q+E   TE E L+S++ ++QR R+ L  ++ED ++ L R+  ESER + +++ LE + S  ++++V  KEA+++  L+KEVL  E   +  ALS+ E   AE E+ + K ++ +  L+++++K+ +  E L   + E +R + Q E E++ L   +R  E E+   ++EL R +QE L L+ EK         L+     L+ E + L REK  + EQ     +QK A+ E+L  C RE+E S   +    KE++ L ++K  L VQ+T+ +R+++  ++ +A+L ++RE LE++L D Q+L   LE  +++L+GEN  L    ++L  EL  ++ E + +  + +  ++ L  +  Q ++  +  +   + SH E +    K  E        +RE+   +   E  ++     +  Q++ +++  +Q+   +SLL AE+ KQQ LS  E EK  + E++I  + ++++   E DR++++  ++QEQDK   +GL +EL + RS+FE+   + E+  +SLN  I++L+     A +E   L   L   EE+RD  R+E++E +R+L+E  + K+  +RE  +LKR L +  REKE +  SN  LR  +K VE E   L R   +  Q++ V +E   + +QEV +LR N++++EK+RL  +RELQELRR +K L+ +  +  +E++D+Q R+ ++E++E+E R+E F L+QKV+E+EA +EA  K+ A  QRHI +LE   Q      + RD +S+ +S  +   ++A    +LQ+      A   E  ++++ AE R   LE  +A+ +  ++++E +L  ++S+LRR +G R+                                            G+ SP P  R  SPS  R   +RSP                 C  +P      +++ +AV++ L  F Q+L D +++RD++ AQ  SL  +++  +   E +   +Q L+Q++ + EE K+ +   L   Q +L++++E ++R E   + M E+L+   ++   +E+E + L+D+L + +  +  LE E ++ K+  E  + R  +L L +R LEG+LQR ++  T+ E E   L +R+N+L +++ D E ++  L++  +R++ ALA  E + S  KDK+Q L  SL+  +      +++  QLQ+AL +SE ++++++E+L+ ++ AL  ++ QN+ L ER+Q +Q    + E + SEL+   R     + QRQ+AEQE  +    L  + + LQE+V ++Q      + EK ++ +   +L KDRS+LK++L KVE  + K E        ER + +Q +R LE+E  E Q ++  LQ+Q++  E  H   L+E+++RH+QE+ +E E +R S  Q ER LE RE+AHRQRV  LEEQ+STLK+QL  EM+RR
Sbjct:  126 EEGRSYRLKLQAYQESQHRQAQLVQKLQAKLLQYKKRCGNLEQQVLEKTSESEKLRLSLQSHLDSSAHRLQRFEQEHSLDVQNKLALLDDEQKRCSGLSQVNALLREQLEQANETNQALT-------ESLQKARDEAEQRDTRLRRE-LEMNTSRNSREQVRVRSLWRQVAFLRSSFTQLRAFADRSLSDLQAEYAATSHRLRVACLNL-------EASKSQSCTTASNGVSALETQLRDKLREAMQLQARFDAEKVELSSRILELGEMVKQLRAQNSEKESNLIALR--SNLNKMETNRSEDRAERDALRSEISSLHQILHNINQVVSGEVSRDCSSKHEHSFISAGSISSSQ---------------REGPLI-----AVQKALLQRQTQTEDLQACLEASQEQVVTLQKQLHVEEDKTRTLEKRLQELQQENQLLERAEEDSTRDAERYRNSLGIITSEKGELERQLSAMQQQLECTQTEQEGLRSSSLDVQRQRDLLRQQREDLERQLARERSESERGRHTLEQLEARYSDVRKELVTLKEALSQLSLQKEVLEDENRSLAQALSKAEAQNAEQELALTKLRSEDAGLQDSLAKMGALSEGLAKDKVELNRLLLQAEAEKAELGERRREAELERMAAREELARLQQELLDLTAEKRALEASHNYLQEAKMTLDAEYNLLQREKSSVQEQHAQASKQKQAVQEQLNACHREMELSAALLQKTYKERDELARDKANLTVQLTSEQRKSKALAQDLAALRAERESLESSLLDRQELASSLEAIRDRLDGENASLQQANKSLTRELSSVQSELEQQMSRALQEKQALELKLAQAERNAQEMLITTQQSHQEQLHTERKHKERMHAELCAQREQAESQLRAECKELRIQSRRVLQQLQEDLAKLQQHCTESLLQAESHKQQVLSEKEAEKATLIERIITLERDMEAAALEKDRMRRDFLSKQEQDKDTASGLQAELHNLRSRFEESLSSREVSERSLNEQIRELSTQWQGAHQEAERLKRELSEVEESRDTGRKELIEAHRELRECLQDKDEQRREGLDLKRALGDAVREKEAINTSNHELRTALKRVEFENNSLKRVGEEKDQRLTVLEECKSSLQQEVLKLRTNMRELEKSRLQARRELQELRRQVKTLEGQCTQQGQELSDMQARLTQEEQREEEMRKETFTLRQKVLESEAGKEAALKEAAGLQRHIAELEEAHQQEKELQQQRD-ASLQDSQLKQREEVARLEGALQESQ----AQLREFGLSVNLAEARAQGLEEQLAQNDAKRRDLEHRLNVLNSTLRRTLGSRR--------------------------------------------GRQSPTPGERGRSPSPWR---TRSPVKGEIISDETGVGGLPVCSLSPSRREDGELDLDAVQMLLHSFQQELRDTQKERDESHAQVHSLSKQVENLQANQERSNTCIQMLRQSIRELEEGKRELAKHLEGMQASLVLRDEAVQRGETQNRIMNEELAKMKKSQLIIETEAKALQDKLERSQASEESLEAERRRLKETCEAVDARAARLDLKRRGLEGELQRAQLRTTEMEAEASSLQERLNNLRRELGDSEERAALLKVECERLATALAHKELQESQLKDKLQALTASLTDSNASAGTARDQAVQLQRALSASEHNQKMVQEKLDKTREALTHSRKQNHDLSERLQSLQRSQEECELKVSELDKQTRVLQETVRQRQQAEQEAQESCLLLQEQNSQLQEQVATLQTTAHRLQGEKSDLERTLLRLGKDRSSLKRTLEKVEHNRQKKEVEILHGEREREQQEQKIRNLEEELNETQAEIHTLQSQISILEHTHSQRLLEVSARHKQELDLESERMRDSQQQTERALEAREKAHRQRVHCLEEQVSTLKEQLEQEMKRR 1947          
BLAST of Rootletin vs. Ensembl Zebrafish
Match: ENSDART00000102348.4 (pep:novel chromosome:GRCz10:9:12934265:12983197:1 gene:ENSDARG00000020834.10 transcript:ENSDART00000102348.4 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 1.479e-16
Identity = 90/277 (32.49%), Postives = 144/277 (51.99%), Query Frame = 3
Query:  201 RLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQ--------ARCLQTACSNLSCNMKSAESKQQLSTERE--SRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTV 1001
            RL+EE  E+R+KL   ++ + +QA L+ +LQ KVL Y+ +C  LE +             G         R      +  LESTLI+LEEEQ+++  L+E +  L+ QL+Q+T++N+ L  D+ KL+ +W ++ EE+ Q+E  W+ E+     Y+  EHS L  L    +  RRQ   LK +T++++  LK +F+R         A  L       + ++  + S Q LST +   S D LN E     K+ EL   +   E E  EL++R+ EL +
Sbjct:   61 RLDEEQREWRKKLREGREREARQALLIHKLQHKVLDYRARCQALEQQA-----------VGEERELRIRERILRDERSDTLESTLIRLEEEQQRSLGLSEVSALLRSQLSQSTEANEALRDDLRKLTADWSKAVEEVVQKEIDWQKEKEVLTGYIGKEHSRLMTLWGRVVTLRRQCHSLKTATDKDLWELKADFSRLSSSLLSVWASPLSAPKLTHNSSLSQSTSAQPLSTTQGPLSLDDLNHEQTDERKSSEL---KADIESETLELRNRITELNM 323          
BLAST of Rootletin vs. Ensembl Zebrafish
Match: ENSDART00000139377.1 (pep:novel chromosome:GRCz10:9:12934388:12944454:1 gene:ENSDARG00000020834.10 transcript:ENSDART00000139377.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 7.016e-16
Identity = 65/184 (35.33%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  201 RLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTE 752
            RL+EE  E+R+KL   ++ + +QA L+ +LQ KVL Y+ +C  LE +   G+    + +     +     RS+       LESTLI+LEEEQ+++  L+E +  L+ QL+Q+T++N+ L  D+ KL+ +W ++ EE+ Q+E  W+ E+     Y+  EHS L  L    +  RRQ   LK +T+
Sbjct:   61 RLDEEQREWRKKLREGREREARQALLIHKLQHKVLDYRARCQALEQQA-VGEERELRIRERILRDE----RSDT------LESTLIRLEEEQQRSLGLSEVSALLRSQLSQSTEANEALRDDLRKLTADWSKAVEEVVQKEIDWQKEKEVLTGYIGKEHSRLMTLWGRVVTLRRQCHSLKTATD 233          
BLAST of Rootletin vs. Ensembl Xenopus
Match: crocc (ciliary rootlet coiled-coil, rootletin [Source:Xenbase;Acc:XB-GENE-996807])

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 596/1480 (40.27%), Postives = 957/1480 (64.66%), Query Frame = 3
Query: 1407 CTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALK-EVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGF-RQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPS-SKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
              + ++Q+ DNENERR LE ++  ++ E + +   K+D+ R+  R +N +   + E+  LEK   +L +++  Q  E E+L+ AN +LQR R+ L++E+ED  +D ER ++  +R  ++ + LE K+S  ++++V  KE+++K  LE+EV   E+ ++  ALS+ E   AELE+ +N+++T E +L + +SK+S+  E L   + E  R I QLE ER+ L  +K  +EQEK+ ++DELVR EQE L L  E+      ++ +E N E+L +E+  L +E+  L EQ+G + RQ++ L+E+L+Q RR++E  +  +   S+EKE L K+KG LVVQ+TA ERE+R  +E IA L +++E LE  L++AQQ +I + +RKEQLE E+Q L + KE+L GE+  +R++ + E  K+   +E L+ +  QM++E ++ ++ E+ +H EDVERL++     R   E+E+EEL+HR   ER++++  +E E++EM++EI  +Q+ERD+SLL AE EKQQ+LS+ E EK +++EKL   Q  L  +  EL+R K++S  RQEQD+  I  L+SELK  R Q E+    H+ E+K LN   ++++  ++ A + EV +L T L + E+ RD +RRE++E +R+++E +E  E  K+E  EL+R L +E +EKE V  SNE LR  ++  E+ERI L R   + +Q+++V +E    S++EVN+LR++L+DVE++RL+ +RELQ+LRR +K LD E  K ++++ ++Q R++  E++E+E+RR+NF LKQK++ETEA REA RK+L+  QR + ++E     ++R+    ++ +R + +KL D   +L+        ++ +L + LS +EGRV  LE+ ++R+EG K+E+EFKL S+HS+LRR +G  R     +   R  S                     G      +   GK   +   GSP  SK  +   SP+  +    DI+PE VR ALR+F+Q+L D ER+RD+   Q  +    L E E + + A  R+QQLQ+ L + EE K+ +DG+L   QT L++QEET+RR ER+RK   EK ++ +R+  + E E+R  +D++NK + ++A+ E E ++ K+ ++ +E+R T+L+L++R LEG+LQR K+ L D+E E + +  R+ +L +Q+ D EG+  +LQL ++R++  LAK +E  +  K+K+Q L  +LS  +       +K++QLQK L  SE +RR+L+ERLE+++ A+ E K QN  LME+ Q+++ +  + E +R+ELEG  RQ   ++ QRQE+E    +  QKL  E+  LQER+  +QR +   E+EK+E+ ++  +LEKD++ALKK+L KVER+KLKT E   +   E+  LD+ L  +E E  E QRQV +L+ Q+A+ EQ H   LME  +RHRQE+ +E+E LR + +Q ERTL+ RERAHRQR++GLEEQISTLKDQL  E++R
Sbjct:   15 VGSLRKQLSDNENERRALEQKIQQLQQERDVMGGAKEDAERDVTRLRNHIEQLNGEKGALEKSLQNLQEELNGQRQENEKLQLANSDLQRQRDLLQEEKEDVCRDRERALQNVDRGHKAQEQLEVKLSALRKELVVVKESLHKCSLEREVSEAERVDVSQALSKAETRLAELELTLNRQRTEEASLRDALSKMSALNESLAQDKTELSRIIAQLEEERAHLQGQKHEVEQEKASIRDELVRLEQEKLELDTERFGLDNSLQAMEQNREKLLQEVQALRKERGQLQEQLGQVSRQRNMLSEDLVQSRRDVELQSECLLRASREKEELMKDKGSLVVQLTASERESRALAEEIAVLRTEKEALETALFEAQQQLIHVTSRKEQLEVESQNLRLNKESLQGEIGSVRRQMEAEISKLERDKEALSQQLNQMEQEAQVTLRNEQRAHGEDVERLSQEKNELRLELESEKEELVHRLTQEREELVARHEMEREEMSEEIAALQQERDESLLQAEFEKQQALSVKESEKASLSEKLSHAQHGLSGLSLELERHKRDSQIRQEQDRGTILALNSELKGLRGQLEEALVLHDRELKGLNDKSREVSKHRESAQREEVEELKTQLCVVEDARDAVRRELIEAHRRVREGQELLEGHKKENMELRRALGDEAKEKEAVQKSNEELRGAVRRAESERISLKRSNEEKEQRLSVLEEARGASEKEVNDLRSSLRDVERSRLEARRELQDLRRQLKLLDDESIKRSRDMAEVQARLSTYEQREEESRRDNFTLKQKLMETEAGREAARKELSALQRKVAEVEGEFGVRERELQGSLDEARGNEKKLLDNTRNLEIKLQAAQEESGQLGLRLSASEGRVHGLEAELSRLEGLKREVEFKLGSLHSALRRTLGIGRAGRTPSPAYRGRS---------------------GSPKRRFSPLKGKFREL---GSPDRSKTPERPPSPTRGEQLVADIDPEVVRAALRDFLQELRDTERERDELRTQLGTSNRHLAEMEAERDGALTRVQQLQKVLSECEEAKRNVDGKLGGLQTTLILQEETLRRYERERKLAQEKAASLERSLQAAEGEQRAAQDKMNKIKANEAKYENERRRLKEVLDASESRNTKLELSRRGLEGELQRHKLVLADREAEMQEMQQRMEALQRQLSDSEGRVGTLQLCVERLNSTLAKAQESETSLKEKVQSLTGALSDSNCTSASSHDKLNQLQKVLTGSEHERRILQERLEAARQAVAEGKKQNVALMEQNQVLRDEQAEGELQRAELEGQVRQMQEILRQRQESEGASLRNVQKLQEEREVLQERLCGLQRAVVQLESEKREVERSSMRLEKDKNALKKTLDKVEREKLKTAEDTLRLSAEKGRLDRSLTTVEQELAEAQRQVQLLEAQMADMEQTHSQSLMETATRHRQELQLEIERLRNAQIQAERTLDARERAHRQRIRGLEEQISTLKDQLQQELRR 1470          
BLAST of Rootletin vs. Ensembl Xenopus
Match: ENSXETT00000026525.3 (pep:novel scaffold:JGI_4.2:GL172691.1:3390468:3459259:1 gene:ENSXETG00000012154.3 transcript:ENSXETT00000026525.3 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 617/1928 (32.00%), Postives = 1086/1928 (56.33%), Query Frame = 3
Query:  168 GLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQ--QLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINME---DKATRVLIEDTES-MHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRR--DKDDSFREA-----------------------DRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGE-LVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSD-----LNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            G  +  L+LR+R  EE   Y+RKL  +Q+ QQ+QAQLVQRLQ KVLQYK +C ELE ++     E+ + +     +  +         +L+L + L +L+EEQ++++ L + N  L+EQ+ Q   +N+ LT +I +L+ +  +S E+L+QRE  WR E  ++  YL++EHS +  L R     R QF++++  TER +  +K + +R +R + TAC NL  N++ ++S     L T R       LE QLR+K R++   Q++++ E  EL  RV EL++ ++KL  +N +K++        K+    G I+ +   D+ +R L    +  M   +R+++      ++ F  E++G +T+++         +     +S + +      A   ++ S I ++S        +   + ++  N  ++  D E E   L +++ A RD +E  ++  +K+    EA                        R +N++ + + E+  +E+   ++  + E  L E ERLK+ N EL R REALE+++E+  ++ +R  KE ER QR  + LE+K+S  K+D+V  +E++++  LE++VL  EK+ +  ALS+ E S+AELE+ +N+  +    L ++++K+ +  E L   +   +R I QLE ER++L  ++R  E   + LK++    E E   L  ++    +R  + E   +R EE+L  +++E+  L +Q+         L ++L + RRE++   +++   ++  E LT +  EL VQ+ A E E ++  E  A L + +E LE+TLY+ Q+   QLE R+EQLEGE   L + K++L  E L  LRQ+      KV      +  +  Q ++  ++++  +   H + V+RL +  ES R     ++++ + R   E++D++ + E  KQ+++ EI+ +Q ER++SLL  E+EKQ++L L E EK +++EKL+ TQ EL   + E++R ++E+  +QEQDK ++  + SELK+ +S FED    H  E K+L   +K L+  ++   KEV +L T L++AE++RD+LRR+I+E+ R L+E EE  E  ++E  EL+R + +  RE+E +  SN  LR  IK +E+ER  L   + + +Q+++V  E    +++E   LR  L+DVE++ ++ +R+LQELRR +K L  E  +  +EV +LQ R+ ++E+KE ++RRE+  L+Q++ E+E+ REA R+++   Q+H+  LE+  + ++++    +  SR   ++L +A  SLQ+      +++ + R+ L   E RV ALE+ +++ + +++E E  +  ++S+LRR IG R  +    R+ +++K                      D+++ +  +G+ +P  R  SP       SRSP      P ++ PE V+ ALR+F+Q+L D +R+RD+A  Q  SL  +L++     E  +++ Q+LQ+ L D +E ++G + RL +A T + + ++ +R +E +R+A  E++   + +    E E R  +DRL++ R+ + R E E K  ++ +E +ENR T+L+L KRSLEG+L+R +M+L ++E E + L +R + L +Q++D E +  SLQ  + R+++AL++ ++     ++K Q L  +L   +     LQ  +S+LQ AL ++EQDRR+L+ERL+S + AL ++K  N  L + IQ  Q       LN  E +    + L +       ++  A  E+ +K + L  +K              A  E +KQEI  +   LEK  + L+ +L KV+R++L+ E  A +   E+ +L   +  L  +  E QRQ   LQ Q+ E E++H   LME++ RHRQE+  E     +   Q+E TLE RER+HRQRV+GLEEQI++L++QL  E++RR
Sbjct:  120 GETEAVLDLRQRFHEEEMAYKRKLSAYQEGQQRQAQLVQRLQDKVLQYKRRCRELEQQLLEKTSESEQQRLAKMMDQNH---------SLELNNALTRLDEEQQRSSSLAQVNNTLREQMEQLKTTNEKLTEEIKRLTSDLHKSHEDLDQREAEWRKERRNYTFYLSNEHSGILTLWRKAAALRSQFLDMRGITERGLAEIKTDISRSSRRMHTACLNLDSNLRLSQSAAGASLHTAR-------LEQQLRDKVRQMMQLQSQWDAEKVELNSRVSELSLQTEKLVRENSKKEKE-------KDELAQGSISFDSARDQESRSLDSARDPDMQYTIRSLA------TNIFFQENSGCDTLQELEGVREECDSLQQVLSSITQQDS----AKPHSISSPIRRRSPTRMRSPQRSELALKAVQNVLQRHQDREKE---LHSELAAARDSLEQTKKQQEKNQHVSEAHTEELKKENKEINTILESVKQELQRCQNSIELLTREKEDMEESLQTIKQKAEGSLLETERLKAVNAELLRQREALEEQKEELNRERDRSQKELERGQRIQEQLEEKVSILKKDLVTVRESLSQTALERDVLQGEKEAVASALSKAESSRAELELALNQMHSERATLTDSLAKMGALNEGLAQDKVALNRVILQLEGERAALHEDRRAGEANCAALKEQQEALEHEVSQLQADRVGLERRCREAEEKHKRQEEQLLGVHKERGKLQDQLAQANTLVQTLQDQLKESRREMDLQGSALQRAAQRMEELTSQNAELGVQLAALEDERQEHEEEFAQLRAQKESLESTLYETQRRAAQLEDRREQLEGEIHTLTLVKQSLQEEALAGLRQQ------KVT-----VELQLAQTEQAAQLSLSNQSQQHQDTVDRLKREKESLRLTMIADKQDSVQRLEKEKEDLLFDRENVKQKLSAEILRLQEEREESLLKVESEKQKALLLKETEKNSLSEKLMNTQRELSDTKMEMERCRREAQIKQEQDKTSLDNVLSELKALQSDFEDAVSAHSKENKNLRDRMKQLSQERESLNKEVEELRTQLRLAEDSRDSLRRDIIEVQRLLREKEEICESQRKETLELRRDVGDLTRERETLQKSNTELRACIKKIESERSSLQVAMEEKQQRISVLQEGKSCAEREAAHLRATLRDVERSHIEARRQLQELRRQVKTLGGESSQKEQEVAELQARIQQEEQKEQQSRRESLELRQRITESESEREAARREILTLQQHLSALESSSRQREKELEQRLSESRAGEQRLQEACKSLQEQLQRCTSESGDSRLQLGAFEARVRALEAELSKSQASRREAESHVNGLYSALRRTIGVRGRSPSPRRALSSTKGEAPIF--------------SLDSSHGSPMEGRVTPSSRGVSPDR-----SRSP-----YP-ELEPELVKQALRDFMQELRDTQRERDEAGIQVLSLRRQLEDSINSCERLQSQQQKLQRQLADLQEGQRGTEERLGTAHTEMRLLQDNLRHSEAERQASGERIMELEHSLRICEDENRDFQDRLSRARNAENRQELECKGLREVLEASENRGTELELRKRSLEGELERTRMSLAEREAEVQTLQERAHHLQEQLKDSEDREASLQTEVQRLNLALSRAQDGERQLQEKSQGLTQALGEATAGRGNLQEDVSRLQGALTAAEQDRRVLQERLDSVRQALSDSKRHNLRLSQTIQEQQQQLEEMHLNCRELQAQL-QDLQQVQQQREEEQGAALLEVQEKLKMLQGDK--------------AQVELDKQEIQHSAVLLEKGNNTLRATLDKVKREQLRIEGEAQRLSVEKEQLSHSVISLRKDLAEAQRQNQYLQEQMTEMERSHTQRLMEVSLRHRQELDSESNRAHSIQQQVESTLESRERSHRQRVRGLEEQINSLQEQLEQEVRRR 1960          
BLAST of Rootletin vs. Ensembl Xenopus
Match: ENSXETT00000051541.3 (pep:novel scaffold:JGI_4.2:GL173371.1:61376:84366:1 gene:ENSXETG00000023904.3 transcript:ENSXETT00000051541.3 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.125e-16
Identity = 45/133 (33.83%), Postives = 78/133 (58.65%), Query Frame = 3
Query:  426 YDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNL 824
            +   +LE  L KLEEEQ++   L   N  L+E L    ++N+ L  D+ KL+ +W  + +EL+ +E  W  E   +N  +  EHS L  +    + FRR F ELK++TER++++++ +++R    +Q+ CS+L
Sbjct:   50 HGETELERALQKLEEEQQRCENLAAVNALLREDLGHTQEANKVLCNDMHKLTADWTSALQELKHKENDWEQEREHYNSLMKGEHSRLLRIWTEVVTFRRHFRELKSATERDLSSVRADWSRCLCLIQSCCSSL 182          
BLAST of Rootletin vs. Ensembl Xenopus
Match: ENSXETT00000051536.2 (pep:novel scaffold:JGI_4.2:GL173371.1:61373:82267:1 gene:ENSXETG00000023904.3 transcript:ENSXETT00000051536.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.197e-16
Identity = 45/133 (33.83%), Postives = 78/133 (58.65%), Query Frame = 3
Query:  426 YDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNL 824
            +   +LE  L KLEEEQ++   L   N  L+E L    ++N+ L  D+ KL+ +W  + +EL+ +E  W  E   +N  +  EHS L  +    + FRR F ELK++TER++++++ +++R    +Q+ CS+L
Sbjct:   51 HGETELERALQKLEEEQQRCENLAAVNALLREDLGHTQEANKVLCNDMHKLTADWTSALQELKHKENDWEQEREHYNSLMKGEHSRLLRIWTEVVTFRRHFRELKSATERDLSSVRADWSRCLCLIQSCCSSL 183          
BLAST of Rootletin vs. Ensembl Xenopus
Match: ENSXETT00000051537.2 (pep:novel scaffold:JGI_4.2:GL173371.1:60614:84366:1 gene:ENSXETG00000023904.3 transcript:ENSXETT00000051537.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.359e-16
Identity = 45/133 (33.83%), Postives = 78/133 (58.65%), Query Frame = 3
Query:  426 YDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNL 824
            +   +LE  L KLEEEQ++   L   N  L+E L    ++N+ L  D+ KL+ +W  + +EL+ +E  W  E   +N  +  EHS L  +    + FRR F ELK++TER++++++ +++R    +Q+ CS+L
Sbjct:   89 HGETELERALQKLEEEQQRCENLAAVNALLREDLGHTQEANKVLCNDMHKLTADWTSALQELKHKENDWEQEREHYNSLMKGEHSRLLRIWTEVVTFRRHFRELKSATERDLSSVRADWSRCLCLIQSCCSSL 221          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 692/1936 (35.74%), Postives = 1136/1936 (58.68%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE + YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE   Q  D  T   +           R  +   + DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:  137 RGLVRQSVELRRQLQEEQSSYRRKLQAYQEGQQRQAQLVQRLQAKILQYKKQCSELEK--QLMDRSTELEQQ----------RLRDTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1995          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 654/1845 (35.45%), Postives = 1079/1845 (58.48%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:   52 DLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 654/1845 (35.45%), Postives = 1079/1845 (58.48%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:   52 DLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 654/1845 (35.45%), Postives = 1079/1845 (58.48%), Query Frame = 3
Query:  438 DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:   52 DLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin vs. Ensembl Mouse
Match: Crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:MGI Symbol;Acc:MGI:3045962])

HSP 1 Score: 313.153 bits (801), Expect = 1.477e-85
Identity = 386/1421 (27.16%), Postives = 742/1421 (52.22%), Query Frame = 3
Query:  432 NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL----QRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFD-AEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKT--PPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELN-DKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGL-SNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDF-SSMVESSR----------RDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVD--INPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMA 4628
            ++DLE  L +LE  Q+++  L++ N  L++QL    ++N  L R++++ +     S   L+++ ++  ++ +S       +  ++  L R     +    EL+ASTER + +++ +  R A+ L  AC NL  +++       L+    + D   LE +LRE+ RE+   Q ++  E   LQ R+ E T+L +KL +Q  + +RA+  L    QR+K+  + G++ +++     L ++ ES+H  L +I +V  +D+   + A  +  E      R  SP R+ S       A+T  P        AVQ+AI ++  + QEL+ +L SS+E     + Q+     E R  +  +     E E L    +   +EA   + ++++   E+  LE     L  + + +  E ++L+  N EL+R      +++ +  +  ER ++E E  Q  ++ LE+K+S  ++++   +EA++  QL++++L  EK+ +  AL++ E   A+LE+ V + +   +  +++++K+++ +E L+ DK   NH  + QLE ER  L  +++ L+QE++G++++L ++ Q+ LGL   E+   ++    LE   + LE+++  L +E   L EQ+G +  +K AL ++L Q  ++ E   + +     EK  L++E+ +L+ +  A ER +   ++  A L ++R  LE +L++AQ+L  QL+T++EQLEG+ +   + +  L  E+ RL+ ++++   K+     QL  +  Q ++E ++A++++  +H ED+ RL +  +     S  E +E   R+  ++ +++     +++ +  EI  +++ERD+SLL  E+E QQ+LSL + EK  +++       EL     EL+R ++E+ N+Q Q +  +  ++ EL++ + QFE+    H+ E  +L   ++++   +    +E  +L   L +A E    LR+E+       +  +             +R L +E +EK+ + +SN  LR  I   E E+  L R   + +QK+ +  E  V +++E  ELR  L+++E+A+ D +R+LQE  R ++ L+ E  +  +EV+DLQ +V+RD +   +  +E+  L+++V E +A+ + V+K++   ++ + ++E   +++ +     + ES R          R  RKL +A N          AD+  L+ +L  A  RV  LE  +A+ EGA+   E +L  + S+L   +G +  N++    R +S                   T G   T       + SP  R+ SP       +R PS    +P    I+   VR ALR+ VQ L++A+++RD++  Q  +L S+L E E +    ++R++QLQ+ L DAEE ++  +  L SAQ A  +Q+E ++R E +  A A
Sbjct:  146 SMDLEEALSRLEASQQRSMGLSQVNTLLRQQLEHMQKANDTLARELTRATH----SLVHLQRKLELQESQRLSLR-----QPRDILPLWRQAKALQTHLAELRASTERGLTDVQADMTRTAQRLHMACLNLDSHLR-------LTASSMTSD---LEQRLREQAREMLQLQGQWAAEKVALQARLSEQTLLVEKLSVQKEQGERAILTLKSDIQRLKSRRSGGQLAVDE-----LRDEVESLHHVLASIKEVAQSDAMCPELAWSSSIEVREAQARLRSPPRSVSPHQRMSPARTSSPTSLHPALQAVQAAIERRQQREQELRLRLESSQEEAAGLREQLSGYRQELRTSQRLLQDRAQEHEDLLGQLEAQRQEAQLSQASVHLLEREKEALETTMEELRAKADIREAETQKLEVTNAELRRSLLLRAEQKAELAQQSERSLRELEASQGRVEQLEEKVSGLRKELATSREALSSMQLQRDILETEKESLHGALAQAESGNADLELLVTRLKAEGMEQQDSLAKMAALLEGLSQDKGTLNHLAL-QLEQERDQLREQQKMLQQEQAGMREQLTQTGQQ-LGLIRAERRSLKETCGHLEQKQDHLEKQVVLLGQENAQLREQVGQVTNKKQALEKQLAQSLQDQEAQMDILQEALHEKNTLSEERAQLLAKQEALERHSELVTKEAADLRAERNSLENSLFEAQRLTTQLQTQQEQLEGKAEAAQLARRALQVEIERLKSDWEVRETKLQLHLGQLQQQAAQQEQEAQLALERQELAHTEDLARLHR-EKDTLSLSLAEEKEAAARWMEQQKELLTRSAADREALQGEIQNLKQERDESLLQLEHEMQQALSLKDAEKSLLSK-------ELSGAHRELERARQEAQNQQVQAEATVTTMTKELRTLQVQFEEAISTHQREADTLREKLREIAAERSSVRREAEELQAQLNVAHERLAELRQELQASEESREGLQREALGA-------RRALEDEVQEKDVLQHSNTELRASIHRAEQEKASLKRSKEEQEQKLLLLQEAQVAAQKEAYELRTRLQELERAQRDTRRKLQERHRQVRTLEAENQRKRQEVSDLQAQVSRDAQHRQKNLQESLELQRQVAEAQAAHDGVQKEVLGLRQKLAEVEASGETRAKQLEGHLCESQRAEQTLQAELCRITRKLQEASNQ---------ADS--LQRSLDNACSRVHVLEQELAKAEGARCNAEAQLGRLWSTLCSGLG-QSRNLLASPKRPHSP------------------TTGSSQTRPGRQ--RTSPPTRSYSP-------ARWPSPVPVDPKSEVIDVAFVRDALRDLVQGLLEAQQERDNSGIQVANLSSQLSEAERERLRLQSRVEQLQRDLADAEEGQRRAESALQSAQAARALQKEALQRLETEHLASA 1486          
BLAST of Rootletin vs. UniProt
Match: sp|Q8CJ40|CROCC_MOUSE (Rootletin OS=Mus musculus GN=Crocc PE=1 SV=2)

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 692/1936 (35.74%), Postives = 1136/1936 (58.68%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKR--------------FLEQ-------EKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSN---CDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE + YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE   Q  D  T   +           R  +   + DL+S L++LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W RS +ELEQRE +WR EE SFN Y +SEHS L  L R  +  RRQ  E+K  TER++  L  E  R +R +Q     LS ++  AESK + + E++   +  LE QL+ K    ++L   Q + + +  +L  RV EL +  + L+ QN EKD+        L AL+ ++         ++++ T +  ED E + Q LR+++Q  L+D++            D  D              PR +     + R   +P  +D+ T   + SA++K+ LQ+Q+++ +  +S+E   + ++Q+ D+E ERR LE Q+  +RD+  +  + ++D+ REA R ++A  + S E+  L         Q ++   E+E+L++A  EL+R    LED QED+ ++  R  +E ER  R ++ LE K S   +++V  +EA++   L+++VL  EK E+ +AL++ E  +A+LE+ + K +  E +L +++SK+S+  E L   + E +R I QLE E+ +LL  ++               LEQ       E+ GL+  L  +EQ    L  +  + R                      E+  L EQ+  L RQ S   +EL Q  RE +R   ++   ++EKE + KE+  L V++ A ERE R  SE    L  ++E LE++L+D Q+ + QLE R+EQLE ++Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL    E+     + ER +L  +   ER++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H   VK L     +L   ++  ++E  +L T L++ E+TRD LRRE++E  RK ++++++ E  ++E +EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E  V+  +E  ELR +L++VE++RL+ +RELQELRR +K LD++ G+L +E+ DLQ R+A  E  E E+RRE  GL+Q++++ E+S EA++++L  +QR + + E   ++++R     +E +R   ++L D+  SL+   + + A+ +EL + LS AEGR   LE  +ARVE  ++  E +L  + S+LRR +G           R +S                   +   +     + DG  SP P   SP S+       PS        P D++PEAVR ALR+F+Q+L  A+R+RD+   Q  +L  +L E E + ++A +R +QLQ+A+ ++EE  +  D RLS AQ  L +QEE++RR++R+ +A  ++++  +R+  + ESE R  +++++K +  +A+LE + ++ K+ ++ +E+R  +L+L +R+LEG+LQR ++ L D+E   + L DRV+SL +Q+ D E K+ +LQLT++R+S ALAK EE     + K+Q L  +L+  S  L   Q+K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ +L   E +R + EG  +Q    + QRQE E    +  QKL  E+  LQER+ S+QR LA  EAEK+++ ++  + +KDR AL+K+L KVER+KL++ E   +   ER  LD+ L   E +  E Q+Q+  L+ Q+  A + + + +       + E+  E+E LR++ VQ ERTLE RERAHRQRV GLEEQ+STLK QL  E++R
Sbjct:  137 RGLVRQSVELRRQLQEEQSSYRRKLQAYQEGQQRQAQLVQRLQAKILQYKKQCSELEK--QLMDRSTELEQQ----------RLRDTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLR---------LQEQTT-LDTEDGEGLQQTLRDLAQAALSDTESGVQLSSSERTADTSDGSLRGFSGQRTPTPPRHSPGRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVERQGLQGSLCVAEQAREALEQQILVLR---------------------SERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL---------GRVSS-------------------SPAREAPAGGSGDGLSSPSPLEYSPRSQ------PPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1995          
BLAST of Rootletin vs. UniProt
Match: sp|Q5TZA2|CROCC_HUMAN (Rootletin OS=Homo sapiens GN=CROCC PE=1 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 706/1937 (36.45%), Postives = 1145/1937 (59.11%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKM--QFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREK---NRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRA-------LTALQRIKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD----------YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXX-AKTPPFADA-TYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKS---------------------GLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINS-RHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            +GL++ ++ELR++L+EE   YRRKL  +Q+ QQ+QAQLVQRLQ K+LQYK++C+ELE ++  + G+ E ++ +              +   + DLES LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI K++ +W R R+ELE RE  WR EE SFN Y ++EHS L  L R  + FRR   E+K  TER++  L  E  R +R +Q A   LS  ++ AES+ + + E+++  +  LE QLR+K    ++L   Q + + +  +L  RV EL +   +L+ QNLEKD+        L AL+ ++         ++++A  +  ED E + Q LR+++Q VL+DS+            DA +     +        PRR+      S     +P  +D+ T A + SA++K+ LQ+Q+++ +  +S++     ++Q+ D+E+ERR LE Q+  +RD+ +   +  +D+ RE  R ++A  + S E+S L         Q E+   E E+L++A  EL+R R+ LE+EQED  +D  R  +E ER  R ++ LE K S   +++V  +EA+++  L++++L  EK E+ +AL++ E  + ELE+ + K +  E +L++++SKLS+  E L   + + +R + QLE E+S+L   +R  EQE +                     GL+  L  +EQ    L  +    R                      E+  L EQ+  L RQ S   +EL Q RRE +R   ++   ++EKE L KE   L VQ+ A ERE R  SE    L  ++E LE +L++ Q+ + QLE R+EQLE E Q L++ KE L GEL  LRQ+     EK    +E +  +  Q ++E + +++++R +H ED++RL +  E+     E ER +L  +   E+++++   E EK+E+++EI  +Q+ERD+ LL+AE+EKQQ+LSL E EK A++EKL+ T+  L ++  E++R K+++ +RQEQD+  +  L+SEL+  R+Q E+    H  EV+ L    +DL   +D  L+E  +L T L++ E+ RD LRRE++E  RKL+E++E +E  ++E  EL+R L E  +E+E +  SNE LR  +K  E+ERI L     D +QK+A+ +E      +E  ELR  L++VE++RL+ +RELQELRR +K LD+E  +L +E+ +LQ R+A  E  E E+RRE  GL+Q++++ EAS E +R++L  AQR + + E   ++++R     +E +R   ++  D    L+   +   A+  EL + LS AEGR   LE+ +ARVE  ++  E +L  + S+LRR +G  +      R    S +                              G+G   P T   S   +  S  P+    +P D++PEAVR ALREF+Q+L  A+R+RD+   Q  +L  +L E E + + A +R +QLQ+A+ ++EE ++ +DGRLS  Q  L +QEE++RR+ER+R+A  ++++  +R+  + ESE R  +++++K + ++ +LE + ++ K+ ++ +E+R  +L+L +RSLEG+LQR ++ L+D+E + + L DRV+SL +Q+ D E K+ +LQLT++R++ ALAK EE     +DK++ L  +L+  S  L   ++K   LQKAL + E DR++L+ERL++++ AL EA+ Q++ L E++Q ++ ++ D E +R E EG  +Q   ++ QRQE E       QKL  E+  LQER+ S+QR LA  EAEK+E+ ++  +LEKDR AL+++L KVER+KL++ E   +   E+  LD+ L   E E  E QRQ+  L+ Q+   EQ+H    +E+++ + + E+  E+E LR++  Q ERTLE RERAHRQRV+GLEEQ+STLK QL  E++R
Sbjct:  135 RGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKRCSELEQQLLERSGELEQQRLR--------------DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLR---------LQEQAA-LETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRH---------------------ERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGLGRAPSPAPRPVPGSPA----------------------RDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASP-DLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSATSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQRVRGLEEQVSTLKGQLQQELRR 2003          
BLAST of Rootletin vs. UniProt
Match: sp|H7BZ55|CRCC2_HUMAN (Putative ciliary rootlet coiled-coil protein 2 OS=Homo sapiens GN=CROCC2 PE=5 SV=3)

HSP 1 Score: 265.388 bits (677), Expect = 6.215e-70
Identity = 331/1177 (28.12%), Postives = 613/1177 (52.08%), Query Frame = 3
Query: 1488 EIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEEL-NDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQE-ALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERD-DMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQ--SLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRH-------HDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKE-------TETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRM 4961
            E E+LR   +    E  + + +  +   E++ LE +   L  + +    E + L++   ELQR      + +E+     ER  +  E  Q  +  LE+K+S  +E++ + +EA++  QL+++V+  E++ +  AL+R E S A+LE+ V + ++  V   ++++ +++ +E L  DK A NH  + QLE ER  L  +++ LEQE++   ++L ++EQ+ AL  +  + +Q Q   +LE   E+LE + + L REK  L EQ+G +  QK AL E+L Q  ++ E    ++    + K+ L++E+ +L+ +  A ER+ R  +E  A L  +R+ LE++L +AQQL  +L   +EQLE E +   + ++ L  E+ +L+ +++++  K+     +L  +  Q ++E + A++ +  +H E + +L +  E+       E+E  + R  +E++ +++     E++ +  EI ++++ERD+SLL  E++ QQ  +LSL E E+  ++E       EL      L+R+++E+ ++QEQ +  I+  + ELK+ ++QFED    H+ E  +L   ++DL   +    +E   L   L +A+E    LR+E+  +        E++E L RE  E +R L +E REK+ ++  N  LR  I   E E+    R   + +QK+ + +E     +QE + LR +L ++E+A  D ++EL+EL R ++ L  E  + + E ++LQ + +++             L+++  + EA  E  RK++   QR + ++E   ++  +     +  SR   + L    +S+ +         + L+  L  A  R+ +LE  +A+ EGA+++ E +L  + S+LRR +G ++++      +  S                   TKG D++ A       SP  R   P S  R  S +P       +D+    V+  LR+FVQ+L +A+R+RDD+  Q  +L SRL E E +   A++R+ QLQ+AL +AEE ++ ++G LSSA+ A  +Q+E +RR E +  A          +  +   EKR+L+++L   R        H   L ++ K  ++ + N E+R    Q A+ SLE  L++M+     +E        E E LD  +NSL +++     ++Q LQ  +  M
Sbjct:  461 EREALRGQLEAQRLEVQQCRASCKLLGREKAALEMVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRERSCRALETSQGRLQQLEEKVSGLREELASVREALSTAQLQRDVVESEREGLRSALARAECSNADLELLVRRLKSEGVEQRDSLAAMAALMEGLAQDKSALNHLAL-QLEQERDQLREQRKTLEQERARAGEQLAQAEQQLALERAERRGLQ-QACGRLEQRQEQLEGQAALLGREKAQLQEQVGQVTCQKQALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQEALERQGRLAAEEAADLRVERDSLESSLLEAQQLATKL---QEQLEEEARSAGLARQALQVEMEQLQSDWEVQEMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKE--VARCQLEQEKELVTKSAAEREALKGEIQSLKQERDESLLQLEHKMQQVMALSLKETERSLLSE-------ELSRARRTLERVQQEAQSQQEQAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLAAERGDVEREAERLRAQLTVAQEGLAALRQELQGVE-------ESREGLHREAQEARRALSDEAREKDVLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILEEAQAALQQEASALRAHLWELEQAGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEV----------LELRRQAAKAEAKHEGARKEVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRAELHSVTRKLQEASGVADALQARLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQSPWASPEQPGSP------------------TKGSDSSQALPGQQGTSPPAR---PHSPLRWPSPTPGGRSSELMDVA--TVQDILRDFVQKLREAQRERDDSRIQMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLA----------SVRAAGQEKRRLQEQLETLRQALEESRRHSQGLAKQGKLLEEQLTNLEHRC---QKAEVSLE-PLRQMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEM 1569          

HSP 2 Score: 84.3445 bits (207), Expect = 1.222e-14
Identity = 66/209 (31.58%), Postives = 105/209 (50.24%), Query Frame = 3
Query:  432 NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL 1058
            ++DLE  L +LE  ++++  L + N  L+EQL    ++N  L R+++ ++   QR + ELE R   W   +         +  +L  L R  +       EL+ +TER + +L+ +  R AR L TAC NL  N++       LS    S     L  QLR+K  E+   Q R++ E   LQ R+ E T+L +KL  QN +K + + AL
Sbjct:  147 SVDLEEALGRLEAAEERSTGLCQVNALLREQLEHMKKANDALGRELAGMTGSVQRLQGELELRR--WAQRQTRSGGL--GQPRDLLLLWRQAVVLGTDLAELRVATERGLADLQADTARTARRLHTACLNLDSNLR-------LSA---SSTASTLGQQLRDKAGEMLQLQGRWDAEKVALQARLSEQTLLVEKLTEQNEQKAKTIAAL 341          

HSP 3 Score: 62.3882 bits (150), Expect = 6.578e-8
Identity = 84/278 (30.22%), Postives = 143/278 (51.44%), Query Frame = 3
Query: 5010 KMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQ-NNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRR 5840
            +M  L+  LS    +  + Q+++ QLQKAL  +E+ +R +E  L S++ A    K     L +E +  +++     E RR     L  Q  TL    ++A +E  +  Q L  +   L+E++ +++        +K E+      LE  R        ++E++ LK EE  ++   E+ +LDQ L  L  E     RQ   LQ Q+ E EQAH   L ++ ++H+++++ E E L  +  Q  + LE +E  H+Q+VK LEEQ+++LK+QL  E+Q R
Sbjct: 1390 QMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLASVRA--AGQEKRR-----LQEQLETL----RQALEESRRHSQGLAKQGKLLEEQLTNLEHR-----CQKAEV-----SLEPLR--------QMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQLQAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQEWTHQQQVKVLEEQVASLKEQLDQEVQWR 1638          
BLAST of Rootletin vs. UniProt
Match: sp|Q9BV73|CP250_HUMAN (Centrosome-associated protein CEP250 OS=Homo sapiens GN=CEP250 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 8.758e-51
Identity = 269/1011 (26.61%), Postives = 506/1011 (50.05%), Query Frame = 3
Query:  309 YKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNL----------ENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL-QRIKNGDTAGEINMEDKAT--RVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELN-DKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIME 3299
            Y+  C ELE +++           G P    + +  E   D L     L++LEEEQ++   L E N +L+  + +A   N+ L  D+ KL+ +W R+R+EL ++E  W+ E+  F  YL  EH  L +L R  + FRR F+E+K++T+R++  LK E  R +  L T C  L+   +S E     S   + R+   L          E +  E+++EL   +++ + E  ELQ RV EL+ L  + + QN + ++ + AL + ++  +T     ME +A+  R   E+  S+ Q +++I+QV++ + D   A+ +G E   + + S   + +               AD     V+S + ++   +Q+L+ +L   +E+    ++Q D  E E +       A+R  ++ L  ++D    +    +  ++  S ER  L+K R  L  Q+E    E  RL+  N ELQ   ++ + ++E+ +++L   ++E ER Q  +  LE K S    +++  +EA+    LE E+L QE+ E+  AL+R E S AEL    N  +T   +L     KLS+  E L  DK   N + + QLE E  S+ +     EQ ++ L+ +L  +E+    L  +      ++++ E     L+ +L ++  EK ++ +++   + Q+ A   +L Q  +E +R    +    +EKE L +EK  L V++ A ER+ +  +E +  L+S +E LE++L++AQQ    +E  K QLE + Q +   KE + GE+  L+ E   E  +    R+    +  Q ++E K A++Q++ +H ++V +L +  E  R   + E  + +   ++ER+ M    E   +E   E+  IQ +R++    AE+   Q     E+E+ ++ E L++TQ EL     +L+R++++   ++ ++++    L ++L+  + + ++  + H  ++ +L      L   K    K+V DL + L   ++++  + +E+ E
Sbjct:   66 YRSWCQELEKRLEA---------TGGPIPQRWENVEEPNLDEL-----LVRLEEEQQRCESLAEVNTQLRLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNG--SGRMDGREPAQLLLLLAKTQELEKEAHERSQELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNEDYEKMIKALRETVEILETNHTELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNI-AQGSGHENSLELDSSIFSQFDYQD------------ADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQQQHDQWEEEGK-------ALRQRLQKLTGERDTLAGQTVDLQGEVDSLSKERELLQKAREELRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVKLSALNEALALDKVGLNQQLL-QLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALE--SLEREKM--ELEMRLKEQQTEMEAIQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQE 1035          
BLAST of Rootletin vs. UniProt
Match: sp|Q60952|CP250_MOUSE (Centrosome-associated protein CEP250 OS=Mus musculus GN=Cep250 PE=1 SV=4)

HSP 1 Score: 194.512 bits (493), Expect = 5.047e-48
Identity = 268/1008 (26.59%), Postives = 494/1008 (49.01%), Query Frame = 3
Query:  309 YKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKL--------NLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQR---IKNGDTAGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIME 3299
            Y+  C +LE +++                 G   +     +  +LE  LI+LEEEQ++   L E N  L+  + +A   N+ L  D+ KL+ +W R+R+EL ++E  WR E+  F  YL  EH  L NL R  + FRR F+++K++T+R++  LK E  R +  L T C  L+   +S ES     TE     +L         LE +  EK++EL   ++  + E  ELQ RV EL+ L  + + QN + ++ + AL+    I   + A  +  E   +R   E+  S+ Q ++ I+Q + +     + EDT  ++    +   S     S          P   D     VQS + ++   +Q+L+ +L+  +E+ +  ++Q D  E E R       A+R++++ L  ++D    +    +  ++  S ER  L+K R  L  Q+E    E  RL+  N ELQ   ++ + E+ + +++L   ++E ER Q ++  LE K S    +++  +EA+   +LE E+L QE+ E+  AL+R E S  EL    N  +    +L     KL +  E L   + E ++ + QLE E  SL +     EQ +S L+ +L  +E+    L  +K     ++++ E     L+ EL     EK +L +++     Q+      L Q  ++ ER   ++    +EKE L +E+  L V++ A ER+ +  +E +  L S +EQLE+ L++AQQ    ++  K QLE + Q +I  KE + GE+  L+ E   E  +     + +  +  Q ++E + ++++++ +H E+V RL +  E  R   + E ++ +     ER ++     +++ EM  E +  QRE + S   A++   Q     E+E+ ++ E L++TQ EL     +L+R++++   ++ ++++    L ++L+  + + ++  Q H  ++ +      DL        K+V DL + L   ++++  ++ EI E
Sbjct:   65 YRSWCQDLEKRLE--------------ATGGLIPQRWESVEEPNLEQLLIRLEEEQQRCESLVEVNTELRLHMEKADVVNKALQEDVEKLTVDWSRARDELVRKESQWRMEQEFFKGYLRGEHGRLLNLWREVVTFRRHFLKMKSATDRDLTELKAEHARLSGSLLTCCLRLTLRAQSRESSGSGRTEESEPARLLLLVAKTQALEKEAHEKSQELMQLKSHGDLEKAELQDRVTELSALLTQSQKQNEDYEKMVKALRETMEILETNHAELMEHEASLSRNAQEEKLSLQQVIKAITQALAS----VEEEDTVTQSSGHEDSLQSDCNGLSQFD-------PQDPDRALTLVQSVLTRRQQAVQDLRQQLSGCQEAMSFLQQQHDQWEEEGR-------ALREKLQKLTGERDALAGQTVGLQGEVDSLSRERELLQKARGELQQQLEVLEQEAWRLRRMNMELQLQGDSAQGEKLEQQEELHLAVRERERLQETLVGLEAKQSESLSELLTLREALESSRLEGELLKQERVEVAAALARAEQSIVELSGSENSLKAEVADLRAAAVKLGALNEALALDKVELNQQLLQLEQENQSLCSRVEAAEQLRSALQVDLAEAERRREALWEKKTQLETQLQKAEEAGAELQAELRGTREEKEELKDKLSEAHHQQETATAHLEQLHQDAERQEETLARAVQEKEALVRERAALEVRLQAVERDRQDLTEHVLGLRSAKEQLESNLFEAQQQNSVIQVTKGQLEVQIQTIIQAKEVIQGEVKCLKLELDAERTRAEQEWDAVARQLAQAEQEGQASLERQKVAHEEEVNRLQEKWEKERSWLQQELDKTLETLERERAELETKLREQQTEM--EAIRAQREEERS--QADSALYQMQLETEKERVSLLETLLRTQKELADASQQLERLRQDMKIQKLKEQETTGMLQAQLQETQQELKEAAQQHRDDLAAFQKDKLDLQ-------KQVEDLMSQLVAHDDSQRLVKEEIEE 1029          

HSP 2 Score: 51.9878 bits (123), Expect = 8.631e-5
Identity = 36/112 (32.14%), Postives = 54/112 (48.21%), Query Frame = 3
Query: 4239 GKGSPIPRTGSPSSKRRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTAL 4574
            G G   P    P   +   SR        P  ++PEAV LAL++  Q +  A + RDD   Q + L  RL + E Q     + LQ LQ+ L  ++E+K   +GR +S ++ L
Sbjct: 1197 GGGDSAPTLWGPDPDQNGASRLFKRWSL-PTALSPEAVALALQKLHQDVWKARQARDDLRDQVQKLVQRLTDTEAQKSQVHSELQDLQRQLSQSQEEKSKWEGRQNSLESEL 1307          
BLAST of Rootletin vs. TrEMBL
Match: tr|A0A1I8FWZ5|A0A1I8FWZ5_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 1714.51 bits (4439), Expect = 0.000e+0
Identity = 1039/2017 (51.51%), Postives = 1444/2017 (71.59%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTE--LES---KMQFGDYETRKTKYGSPTNNGYGSRSENPYDNL-DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDT------------AGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD-YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENV---VTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNT--YATTTDGKGSPIPRTGSPSSKRRQLSRS--PSNCDF-NPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM-------CGSRDQSPTRQKRIEMSKKSAAPNN--SNRRLTAG 6107
            +GL+Q+N++LRKRL++E   Y+RKL  +Q+ QQ+QAQLVQ+LQ KVL YK+K +E  LE+   K Q   ++     Y    ++    RS    D+  DLES LI+LEEEQ+++  L   N  L+EQL QATQ NQ+LT D+ +LSE++QR+R +LE+RE  WR+EE SF++Y +SEH+ L +L RN ++FRRQF ELK + ER++NN KNE  RQ+R +  AC NL+ N+KSAE++  ++ ++E   + NLE+ LRE+ REL D Q ++E    +L  RV EL+V ++KLK Q  EKDR L+ LQR+++               A     +D ATR LIE+TE+MHQ+LR+I+Q V++D+D Y D  D G     +        R        + +++P FAD+TY+AVQ+A+NK++LQ+QEL+ KL S+K++  N +RQ+D++ENERRRLE+QVL +R+E+++++R + DS R+ +R K+AL     ERSQLEK+RS+LN+QIE    +++RL+ AN ELQR R+ LED++ D KKDL+RQ+KE+ERCQR ID LE+K+S  K D+V  KE +N+  LEKEVL QEK E+ DALSR E++KAELE+E+NK ++ E  L + + K+ S  E L   + E ++ +   E+E++ L  EK+ LEQEK G+++EL+R EQE + L NEKA   Q +E  E++ E+LE+EL  +NRE+L+L EQ+  + RQK ALAEELL  RRE ER++N+V  ++KEKE LTKEKGELVVQ+TACERE R+  E+ + L +D++QLE  L++AQ+LI+QLETRK QLEGENQELI+KKENLN E+ R+ +EF++E +K+   RE L  + QQM+++ K A+ QE+ SH +D+ERLTK  ++ R   EN+R+E+IH+ NMER++M+ ++E+E++++  EI   QRERD+SL++AEN+KQQ+LS++EQEK  I E+L  T  ELQ+V SELDR ++E++ +Q+QDK+ I  L+ ELK FR QFE   + HE EV+ LN  I +LT  ++ A +EV +L   L++AE+ RDNLRRE+++ NR+++E EEA +  KREI ELKR L EE R +E V  SNE LRKK                    ++ V +EQ     +EV +LR NL++VEKAR++ KRELQELRR +K LDTERGKL KEV DLQ+RVA DEEK++E RRENFGLKQKVVETEASREA+RK+L N++R   DLE  L+SK RDF+  +E +R++ R+L DAR+ LQ   +   A+NNELR AL GAEGR++ALE+ +AR +  KKE+E+KLASIHSS+RRLIGFRQ+N      +R R+ S +     +           TKGFD +  +ATT +G+GSPIPR+GSP+++ R   RS  PS  D  N  DI+PEAVRLALR+FVQQLV+ ER+RDDA A ARSLE R+ E EE  +  E R QQL + LC+ EEDKKGIDGRL+SAQTALM+QEETIRRNER++KA+ +K+S  +R  + +E+EKRQL+++LNK + HDAR EE+ K  K+++++ ENR TQL+L KR+LEGDLQRM++AL DK+ E +VL DRV++L KQI DLE K+QSLQLTI+R+SV+LAKTEE+GS  KD++QQLN S+S  +  ++ LQ ++ QLQKAL SSE DRR+L+ERL+++  A++EAKHQN+ L+ER+Q +Q +L D+E+RR++LE  NRQ+N+L+ Q+QEAEQEL QK  K N E+  +QERV S+QR LA  E EK+EI K+  +LEKD++ALKK+L KVER++++TEE ASK+ F R ELD  LRRLE+EN  LQRQV  LQ+ LAEAEQAH   LM++ ++HR+E   E+E L+A  +  ERTLE RER HRQRVKGLEEQ++TLKDQL  E++RR     + S           D+R +LDSSL  V++DP LDA L + E+RRLDE++ +        G R  SP+R      + +S+ P+   +  RL+ G
Sbjct:  131 RGLMQMNMDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKKVSESDLENQRLKTQLRSFKQSNDSYQFKLDSETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRDFSDAG-----RGRSVSPVGRGGRSPAGRQRSRSPAFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLNAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQEMIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKK--------------------RIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEDARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRSPSPMRGRSPSPARRSRPNSP---------TKGFDGSQPFATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDLQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAAMNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEDSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDKVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRR---NQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALDLHNAFPGGAGKRAGSPSRLGGAGGALRSSTPSGRPAGMRLSRG 2110          
BLAST of Rootletin vs. TrEMBL
Match: tr|K1QGF9|K1QGF9_CRAGI (Rootletin OS=Crassostrea gigas GN=CGI_10027502 PE=4 SV=1)

HSP 1 Score: 1533.85 bits (3970), Expect = 0.000e+0
Identity = 994/2026 (49.06%), Postives = 1415/2026 (69.84%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGD--YETRKTKYGSPT------NNGYGSRSEN---------------------------PYD---------NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQR-IKNGDT-AGEINMED----KATRVLIEDTESMHQALRNISQVVLNDSDYFDAED-------TGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSP--SSKRRQLSRSPSNCDF------NPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESI-FMCGSRDQSPTRQK 6044
            K L+Q N+ELR++LE+EH  Y+RKL  +QD QQ+QAQLVQ+LQ K+LQYK+KCT+LE  M+  D  Y+    KY          N    SR++N                            Y          N+DLE+TLIKLEEEQ+++  L   N  L+EQL QAT +NQ+LT DI KL+++WQ +REEL+ +E+ WR+EE SFN+Y ++EH  L  L R  + FRR F +LK +TER++++++N+  R +R + +AC NL+ N+++++++ Q+  +RE  D+  ++NQLREKNRE+++ Q+RY+    EL  +V ELT++++KLKIQ  E+D+++  LQR I N +T  GE    D       R +  +TE++H ALRNI++ V+ND+D FD E+       +   ++  + R+ SP            +++P  ADAT++AVQ+A+NK+ LQ+ E ++KL +S++     ++Q+DD +NERRR+E Q+L ++++++ LRR+++D+ R+ DR KNAL++T  E+SQLEKIR+ LN+QIE    E E+L++AN +LQR R+ LEDE++D  KD ERQ+KE++RC R ID LE K S  KE++V+ KEA+N+  L+KEVL Q+K E+ DALS+ E+ KAELE+E+NK +T E  L++ + K+ +  E L   + E ++ I Q+E E++SL  EK  LE EK+G+K+EL       L LS    + RQ++          EEE+  LNREK D+ EQ+  + RQK ALAEELLQ RRE+ER N +   ++KEKE LT++KGEL+VQVTA ERENRQQSEVI+SL S+++ LE+ LY++QQ   QL  RKEQLEGENQELI++KENL  E+ RL +E + + EK    +E L  R  Q +++  +A+ QE+ +H +DVERL K  E  RH  E ER+E +H+  ME+++++  +++E++++ +E+  +QRERD+ LLMAEN+KQQ++SLLEQEK  + EK      EL ++  E +R+K+E   RQEQDK N+  L+ EL++ R QFED C NH+ E+K L + I+DL   ++ AL+EV DL T LK+ EE RDN+RR++++ NRK++E EE  E +++++ ELKR L +E REKE     N+ LR  IK  E E+ +L+R + D +Q+ ++ +EQ  N ++E  +LR +L++VEKARL+ +RELQ+LRR +K LD ER KL KEVNDLQ RVA+DEEKE+E RR  F LKQKVVETEASREAVRK+LAN QR + +L +  + K++D+   +E SRR  RKL D R +L+   +   A+  EL++ LSG+EGRV+ALE+ +AR+EGAK+++EFKL+SI SSL+R IGFRQE     R+R+    PVR RS SP RSRP SP+KGF+NTYATTT+G+GSPIPRTGSP  S    ++SR  S   F      N +D++PEAVR+ALR+FVQQL  AER+RDDA A  RS+  +LKE EE+ +  E R Q LQ++L D EEDK+GID RL+SAQTALM+QEETIRRNER+RK M +K+++ +R+ A+ ++EKRQ E+++ K + ++ R +E  K  K A++ AENR T+L+L +RSL+GDLQR K+ + DKETE +VL DR+ +L KQIQ LE KSQSLQLTIDR+S  L KTEEE S  K+++Q LN++LS +   + +LQ++ISQLQK L SSE DRR+L+ERL+S++ AL+EAK QN+ L+ER+Q +Q+++ DS+ RR+ELEG  RQS+T++VQRQE EQ+LNQ  QK++SEK  L ERV  + R +A  E EK E+ ++  +LEKD+SALKK+L KVER+KL+TEEIASK+V E+  LD+ L RLED+N +LQ+QV  LQ QLAEAEQ H   L+++ +RHR E  ME E LR++  Q ER LE RERAHR +VKGLEE ++TLKDQL  EM++R    Y   +R +   D   D+R VLD+S+T V +D  LD +LLETE R+LD+S+ F      QS  R++
Sbjct:   51 KNLVQQNIELRRKLEDEHASYKRKLQAYQDGQQRQAQLVQKLQAKLLQYKKKCTDLEDAMRNKDFHYQFANQKYKKKCEDFEAENGDLKSRNDNLKLVLQYKHKCSDLEDQIESKLQSTEESYKKSLEASESRNMDLENTLIKLEEEQQRSASLAHVNAMLREQLDQATAANQSLTSDIHKLTQDWQAAREELDIKEREWRDEEQSFNEYFSAEHGRLLALWRQVVAFRRSFGDLKTATERDLSHVRNDVTRASRSMHSACLNLAANVRNSDTQSQVLLDRERSDRAAIDNQLREKNREISELQSRYDAHSYELNAKVNELTMMNEKLKIQLEERDKSINTLQRQINNLETRLGERTSYDLPETDTARQIRGETEALHDALRNIAEAVINDADEFDGEEGRRSISPSRARSISPSARARSPMLRDRSKSPMARSRSPALADATFSAVQAALNKRQLQLSEARAKLRASQDHNAAIRKQMDDLDNERRRMELQILQLKEDVDILRREREDTSRDRDRVKNALSLTGTEKSQLEKIRNELNEQIEMMQQENEKLQAANTDLQRQRDQLEDEKDDVTKDKERQVKENDRCHRVIDQLEHKNSTIKEELVSTKEALNRALLDKEVLEQQKSEVSDALSKAELQKAELELEINKAKTEEATLKDALLKMQAMNEGLGQDKVELNKIIMQMEAEQASLTGEKDALEMEKTGIKEELT------LELSE---MTRQQL----------EEEIQALNREKGDIQEQLSSVSRQKQALAEELLQARREVERQNQNYVKVAKEKEMLTQDKGELIVQVTATERENRQQSEVISSLRSEKDSLESALYESQQSESQLNVRKEQLEGENQELILRKENLQSEINRLIKEKEADLEKFDRIKEDLQRRLTQFERDMSLALTQEKQAHEDDVERLVKEREQQRHEFETERDENVHQNAMEKEELLNRFDREREDLQEELANLQRERDNQLLMAENDKQQTMSLLEQEKSTLAEKNNTLTMELANINVEYERLKREYLARQEQDKNNMNALNQELRNLRGQFEDTCMNHQKEIKDLTNQIRDLERQREAALREVADLKTQLKLVEEARDNVRRDLIDSNRKVREEEEMLELMRKDMVELKRNLNDEVREKELFSKINDELRGTIKKNEGEKTELNRDLCDHRQRCSILEEQKANVQKEAADLRASLREVEKARLEARRELQDLRRQVKMLDGERSKLGKEVNDLQARVAKDEEKEEEGRRHAFDLKQKVVETEASREAVRKELANLQRKMGELIDESRLKEKDYQMALEDSRRAERKLEDQRRNLEINLENTNAEAAELKLRLSGSEGRVNALEAQLARIEGAKQDVEFKLSSIVSSLKRTIGFRQE---MPRARS----PVRSRSQSPRRSRPNSPSKGFENTYATTTEGRGSPIPRTGSPERSGSPHRMSRGASPIRFDRTGEVNALDVDPEAVRMALRDFVQQLAGAERERDDALANVRSMAIQLKELEEEKDRTERRHQILQKSLGDVEEDKRGIDSRLASAQTALMLQEETIRRNERERKVMTDKINSLERSLAAADTEKRQQEEKIAKLKANEMRNDENRKALKMALDEAENRCTKLELGRRSLDGDLQRFKLVMNDKETENQVLQDRIEALNKQIQGLESKSQSLQLTIDRLSTNLQKTEEEESNQKERVQSLNLTLSDNQAIINELQDRISQLQKGLTSSEHDRRVLQERLDSTRQALNEAKKQNHGLLERVQGLQNEVADSDVRRAELEGQLRQSHTMLVQRQEREQDLNQNIQKISSEKQLLHERVQELSRQMANLETEKSEMERSSARLEKDKSALKKTLDKVEREKLRTEEIASKSVMEKGNLDRTLNRLEDDNTDLQKQVQQLQAQLAEAEQQHAQRLIDLTTRHRAETEMETERLRSAQTQAERMLETRERAHRAKVKGLEETVATLKDQLATEMRKRQQ--YI--SRSARTGDEIRDIRSVLDNSMTNVMRDQSLDPLLLETETRKLDDSMNFERSYPSQSAPRRR 2046          
BLAST of Rootletin vs. TrEMBL
Match: tr|A0A1I8IN59|A0A1I8IN59_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 1478.38 bits (3826), Expect = 0.000e+0
Identity = 934/1856 (50.32%), Postives = 1298/1856 (69.94%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTE--LES---KMQFGDYETRKTKYGSPTNNGYGSRSENPYDNL-DLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDT------------AGEINMEDKATRVLIEDTESMHQALRNISQVVLNDSD-YFDAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTI------------RSRNNSKXXXXXXXXXXXXXXXXXXTK--------------------------------GFDNTYATTTDGK-----GS-PIPRT----GSP-------SSKRRQLSR--SPSNCDF-NPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGK 5483
            +GL+Q+N++LRKRL++E   Y+RKL  +Q+ QQ+QAQLVQ+LQ KVL YK+K +E  LE+   K Q   ++     Y    ++    RS    D+  DLES LI+LEEEQ+++  L   N  L+EQL QATQ NQ+LT D+ +LSE++QR+R +LE+RE  WR+EE SF++Y +SEH+ L +L RN ++FRRQF ELK + ER++NN KNE  RQ+R +  AC NL+ N+KSAE++  ++ ++E   + NLE+ LRE+ REL D Q ++E    +L  RV EL+V ++KLK Q  EKDR L+ LQR+++               A     +D ATR LIE+TE+MHQ+LR+I+Q V++D+D Y D  D G     +        R        + +++P FAD+TY+AVQ+A+NK++LQ+QEL+ KL S+K++  N +RQ+D++ENERRRLE+QVL +R+E+++++R + DS R+ +R K+AL     ERSQLEK+RS+LN+QIE    +++RL+ AN ELQR R+ LED++ D KKDL+RQ+KE+ERCQR ID LE+K+S  K D+V  KE +N+  LEKEVL QEK E+ DALSR E++KAELE+E+NK ++ E  L + + K+ S  E L   + E ++ +   E+E++ L  EK+ LEQEK G+++EL+R EQE + L NEKA   Q +E  E++ E+LE+EL  +NRE+L+L EQ+  + RQK ALAEELL  RRE ER++N+V  ++KEKE LTKEKGELVVQ+TACERE R+  E+ + L +D++QLE  L++AQ+LI+QLETRK QLEGENQELI+KKENL  E+ R+ +EF++E +K+   RE L  + QQM+++ K A+ QE+ SH +D+ERLTK  ++ R   EN+R+E IH+ NMER++M+ ++E+E++++  EI   QRERD+SL++AEN+KQQ+LS++EQEK  I E+L  T  ELQ+V SELDR ++E++ +Q+QDK+ I  L+ ELK FR QFE   + HE EV+ LN  I +LT  ++ A +EV +L   L++AE+ RDNLRRE+++ NR+++E EEA +  KREI ELKR L EE R +E V  SNE LRKK                  KQ++ V +EQ     +EV +LR NL++VEKAR++ KRELQELRR +K LDTERGKL KEV DLQ+RVA DEEK++E RRENFGLKQKVVETEASREA+RK+L N++R   DLE  L+SK RDF+  +E +R++ R+L DAR+ LQ   +   A+NNELR AL GAEGR++ALE+ +AR +  KKE+E+KLASIHSS+RRLIGFRQ+N  +             RSR NS +  R     P +    +  K                                G     A   +G      GS P   T    GSP       +++ R   R  SPS  D  N  DI+PEAVRLALR+FVQQLV+ ER+RDDA A ARSLE R+ E EE  +  E R QQL + LC+ EEDKKGIDGRL+SAQTALM+QEETIRRNER++KA+ +K+S  +R  + +E+EKRQL+++LNK + HDAR EE+ K  K+++++ ENR TQL+L KR+LEGD+QRM++AL DK+ E +VL DRV++L KQI DLE K+QSLQLTI+R+SV+LAKTEE+GS  KD++QQLN S+S  +  ++ LQ ++ QLQKAL SSE DRR+L+ERL+++  AL+EAKHQN+ L+ER+Q +Q +L D+E+RR++LEG NRQ+N+L+ Q+QEAEQEL QK  K N E+  +QERV S+QR LA  E EK+EI K+  +LEKD++ALKK+L K
Sbjct:  236 RGLMQMNMDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKKVSESDLENQRLKTQLRSFKQSNDSYQFKLDSETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRDFSDAG-----RGRSVSPVGRGGRSPAGRQRSRSPAFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLTAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQETIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKK------------------KQRIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEEARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRSPSPMRGRSPSPARRSRPNSPTKGRSGEQQPQQQPHNALRKPTSLLNLHRSRPGSNANSPQQQQQQQLRYSAAGGPGYRAAAPNGPANCFDGSQPFATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDMQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAALNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEGSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDK 2068          

HSP 2 Score: 436.032 bits (1120), Expect = 4.270e-120
Identity = 282/690 (40.87%), Postives = 403/690 (58.41%), Query Frame = 3
Query: 4209 FDNT--YATTTDGKGSPIPRTGSPSSKRRQLSRS--PSNCDF-NPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQ-----------------------------------IQDLEGKSQSLQLTID-------RMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKAL-----------GSSEQDXXXXXXXXXSSK---GALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAE--AEKQEIIKNHGKLEKDRSALKKSLG----------KVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFM-------CGSRDQSPTR 6038
            FD +  +ATT +G+GSPIPR+GSP+++ R   RS  PS  D  N  DI+PEAVRLALR+FVQQLV+ ER+RDDA A ARSLE R+ E EE  +  E R QQL + LC+ EEDKKGIDGRL+SAQTALM+QEETIRRNER++KA+ +K+S  +R  + +E+EKRQL+++LNK + HDAR EE+ K  K+++++ ENR TQL+L KR+LEGD+QRM++AL DK+ E +VL DRV++L KQ                                   +Q L G    +  TID       ++  AL  +E +    ++++   + +L+    Q  QL  ++  LQ  L           GS+ Q   LL ++ E+ +     L++A  +   + ER+Q +Q  L   EN + E+E   + ++ L   +   ++ L++ +     E  +L    +     L + +   E    ++       D S +  S            +VER++++TEE ASK+ F R ELD  LRRLE+EN  LQRQV  LQ+ LAEAEQAH   LM++ ++HR+E   E+E L+A  +  ERTLE RER HRQRVKGLEEQ++TLKDQL  E++RR     + S           D+R +LDSSL  V++DP LDA L + E+RRLDE++ +        G R  SP+R
Sbjct: 1639 FDGSQPFATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDMQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAALNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEGSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIE---KSASRLEKDKTALKKTLDKPHHCGQGESRSLVHCRHCGGLVLLVRQYCPEHGPFVETPADFCDDLSLIDTSEAIKCSRTPPPRQVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRR---NQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALDLHNAFPGGAGKRAGSPSR 2322          
BLAST of Rootletin vs. TrEMBL
Match: tr|A0A183JY49|A0A183JY49_9TREM (Uncharacterized protein OS=Schistosoma curassoni PE=4 SV=1)

HSP 1 Score: 1167.14 bits (3018), Expect = 0.000e+0
Identity = 797/1913 (41.66%), Postives = 1223/1913 (63.93%), Query Frame = 3
Query:  183 NLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNGDT------AGEINMEDKATRVLIEDTESMHQALRNISQVVLND----SDYFDAEDTGF-------ETVXXXXXXXXXXXXXXXXXXXXXAKTPP----------FADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSR-SPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQR 5837
            N +L+++L+EE + Y+++L  +Q+ QQ+Q  LVQRLQ KVLQYKEKC  LE K+Q  D E +  K G   N              + E+TL++LEEEQ++ + L   N  L+EQL QAT +NQ L+ D+ ++ E+  R R+ LE+RE  WRNEE +FNDY   EH  L  L R  +  RRQF+E++   EREI + + E +R +R  Q+AC N + N+++ E++  ++ E+E  +K  LE++L E  R   + + +   ++ +   ++  L    D+L  Q  +KDR + +LQR++ G T        +IN  D ++R L+E+T++++Q LR+ISQ VLND    S+ F   ++ F            N +  +   + S +       +PP          + D+  +AVQ+A+ K+ LQ+ EL +KLN++K+ C + K Q+DD+ENERR LE Q++ MR E++++RR+K+D  RE  R    +    NER+ LE++ ++ +D+++   +E+ER+++A +EL++ R+ LE E    ++D ER ++ESERCQR ID LE+++S  +E+  N + A+ K +LE E+  +E  +I DALSR E  KAE E E+ + ++ E  L E++SK  S++EE ++KR+     ++  E E + L ++ R  + ++S LK+EL++ E +   L  EK    Q +   E   ERLEEE++ LNREKL++TEQ+  + RQK+ L  EL+Q  R+ ER  + +  L++EKE LTKEKGEL  QVTA  RE  Q  +++ +   + E L+A  Y A+Q I+QLET+++ LE E QE  +K+ENL  EL R + + Q E E+ + +REQ +   Q+ + E + A++  +++   ++ RL       R  S+ E  +L         D+I   EQ+KQ+   E+M +QRE+D+  L  E EKQ  LS  EQE+  +NE+L  +  +++ +ESE+DRIK+E+S R E+D    A L+ ELK FR  +E+ C  HE  +KS  +    L   +D A  EV++L   + + EE RD L++ I E++R+LKE +EA+E L++EI +L+R L E QR+++N   + ENL K+++ +ETER++ +R +TD +Q+++  +EQ     +E+ ELR+++++ EK RLDV+R+LQE+RR +K++ ++  + TK++ ++Q+R+ R+EEK +E R+EN  LKQ+  E +ASR  +RK+L+ ++R I DL+ +L S++R++   V+ +  +Y +L D RN L+   + +  D  E+R+ALSGAEGRVS LE+ +A+ E  +++  +KLA IHSSLRRLIG+   N    RS+  S+                   +      +       SP+ + G   SK   +SR  PS+  FN  D++PEAVRLALR+FVQ+    +RD +DA AQ  SL SRL EQ EQ E    RL QLQQALC+AE DKKG+DGRLS+ QTALM+QEET+R+NERDRK MA+K+S  +R  +++E+E+ + ++++   R   AR EEE + S++A+++AEN ITQL++ +RSLEG+LQR+KM ++DKE E ++L+DR  +L KQIQDLE KSQSLQLT+DR+S ALAKTEE  S  KDK+QQLN SLS H+Q + +LQ +++ LQKAL +SE DRR+++ERL++++  LHE KHQN    ERIQ +QS+L D+E RR ELE   RQ+N  + +RQE EQELN++ Q L  E+  L +RV+ +QRNL   E  +  ++++   LEKDR  LK+ L K ER+K + EEI +K   +R+EL+  LRRLE+EN   ++Q+  LQ++L E EQAH  HL E+ SRHR E  +E+E LR    Q ER LE RERAH+QRV+ LE+Q+++LKDQL  E  R
Sbjct:   30 NRDLKRKLDEELSTYKQRLSAYQEGQQRQTNLVQRLQSKVLQYKEKCRTLELKLQIADTENQNRKAGMDENTA------------EYEATLLRLEEEQQRASTLAGVNSMLREQLDQATHANQTLSSDLQRIKEDASRLRDVLERREAEWRNEEAAFNDYFTMEHGRLLALWRAVVACRRQFVEVRGQVEREIGSARVELSRVSRICQSACENFASNLRTMEARNMVTLEQEKNEKKKLEHELDELTRNCENVRQQTNGQIEQANQKITNLINQIDELNKQLSDKDRTIDSLQRLRTGQTLCGRKEGADIN--DPSSRALVEETQALYQTLRDISQSVLNDEIVPSEAFGGVESCFHQSRSRSPCYASNPKMITNSFHNSRAGAYGRTGSPPPPVNSTSACYWGDSALSAVQAALRKRGLQVSELTAKLNNTKDQCDSVKHQLDDSENERRNLERQLMNMRAELDNIRREKEDMGREVKRITANVQTLDNERADLERLHTNTSDELKSLQSELERVQNAYNELRKNRDTLEGELNCAQRDAERCLRESERCQRCIDTLEERLSAEREEGTNLRSALQKAKLEAEIKAKELADIQDALSRAETRKAEQEAEIVRLRSDEAALGEHLSKCQSKLEEASNKRSILQSQLRNQEAEYNQLASDYRNADADRSSLKEELIQMESQKNELIYEKNSISQSLTMSEAARERLEEEITSLNREKLEITEQLNAVTRQKNGLTNELIQKNRDYERIRDVIGRLNREKEDLTKEKGELSTQVTALSRELNQTCDLLVASKKEHENLDADYYQAKQQIMQLETKRDLLENELQEQNLKRENLLVELKRTQADLQHEIERGLQAREQASQALQKREDELQGAMKLSKEAAEIEISRLRNQLTECRQLSDKELRDLTLNHKEAIKDLINQSEQDKQDFDNELMKLQREKDEITLAYEAEKQNLLSFNEQERVNLNERLNHSLQQIKGLESEIDRIKREASARHERDDMAKADLTRELKEFRQHYEETCALHEQAMKSAQAKSAQLATERDLARNEVNELKMQINLIEEVRDGLQKNISEISRRLKETDEARETLRKEIIDLRRTLAETQRDRDNQEEAKENLVKRVQSLETERVEQNRVLTDQQQQISAFEEQKCADSKEIGELRSSVRESEKGRLDVRRDLQEVRRQLKDMQSDHERQTKDLMEMQSRITREEEKNEELRQENTVLKQRNGEIDASRSKLRKELSTSERRICDLQELLSSREREYKQAVDHANCEYHRLTDTRNQLEATAEALSNDLAEVRLALSGAEGRVSTLEAQLAKSESIRRDFAYKLACIHSSLRRLIGY---NQCRHRSKTPSRVRDSTSVSP---------VRKLKTGTSPINSRDNSPV-KDGVSDSKLSNVSRVYPSDGSFNASDLDPEAVRLALRDFVQKYSSVKRDYEDAQAQITSLHSRLNEQAEQTEQWARRLHQLQQALCEAEADKKGVDGRLSTTQTALMLQEETLRQNERDRKIMADKISQLERQISAIENERHEDQEKIMHLRQTGARFEEERRLSRRALDDAENHITQLEVTRRSLEGELQRLKMCISDKEAENQMLEDRCQNLCKQIQDLESKSQSLQLTVDRLSTALAKTEELESASKDKIQQLNSSLSDHNQTILELQERLAHLQKALTNSEHDRRIIQERLDNTRSVLHEQKHQNQQSCERIQSLQSELADAELRRGELENQVRQTNNTLDKRQENEQELNKQLQTLLKERQELFDRVSCLQRNLTDVENMRDHLMRSSTHLEKDRHNLKRHLEKAEREKQQNEEIVNKNNLDRTELEITLRRLEEENSNRRKQIQFLQSKLVEMEQAHAKHLNELASRHRAESELELERLRCGKAQAERALEARERAHKQRVRALEDQLASLKDQLIVEANR 1915          
BLAST of Rootletin vs. TrEMBL
Match: tr|A0A151MJ79|A0A151MJ79_ALLMI (Uncharacterized protein OS=Alligator mississippiensis GN=Y1Q_0023267 PE=4 SV=1)

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 803/1922 (41.78%), Postives = 1258/1922 (65.45%), Query Frame = 3
Query:  165 KGLLQVNLELRKRLEEEHNEYRRKLIVFQDSXXXXXXXXXXXXXXXXXYKEKCTELESKMQFGDYETRKTKYGSPTNNGYGSRS--ENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTAL-QRIKNGDTAG---EINMEDKATRVLIEDTESMHQALRNISQVVLNDSDYF----------DAEDTGFETVXXXXXXXXXXXXXXXXXXXXXAKTPPFADATYAAVQSAINKKSLQIQXXXXXXXXXXXXCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIXXXXXXXXXXXXXXXXXXXXXXDLTEQIGCLQRQKSAXXXXXXXXXXXXXXSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNXXXXXXXXXXXXXXXXINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTXXXXXXXXXXXXXXXNFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVV---TIRSRNNSKXXXXXXXXXXXXXXXXXXTKGFDNTYATTTDGKGSPIPRTGSPSSKRRQLSR--SPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDXXXXXXXXXSSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYEST 5867
            K L Q N+ELR+RL+EE   Y+RKL  +Q+ QQ+QAQLVQ+LQ KVLQYK+KC E+E ++     E  + +  S  +    SR   E  + N DLE+ LI+LEEEQ+++  L + N  L+EQL QA  +NQ L+ DI KL+ +W ++R+ELEQRE  WR EE SFN Y ++EHS L  L R  + FRR F E+K  TER+++ L ++ ++ +R +  +C NLS N++ +ES    + E+++     +E QL++K R++   Q + + E  EL  RV EL+ + + LK QN EK++A  AL Q+++  + A    +  +E +    L  ++E + Q LR+++Q VL+D+D            DA D+        +        R+ SP  RS+     +D+T AAV SA+ K+ LQ+Q+++SK  +S++  ++ +RQ+ +++ ERR LE ++L ++DE++   R ++D+ ++  RF+ ++++  +E+S LE+   +L   +E    E E+L+ AN +LQR R+ LEDE++D  KD +R  KE ER  + ++ LE K S  K++++  KE +N+  LEKEV   EK  + +ALS+ E+S+AELE+ +NK +  E +L +++SK+SS  E L   + E +R + QLE E+ +LL +K+ +EQEK  L++ELVR EQE L L+ +K    + ++  E + ++LE +L  L RE+  L EQ+G L RQK+A +EEL Q RRE +R   ++   +KEKE L KEK  L VQ+TA ERENR  +E IA L S+++ LE TL++ QQ + QL TRKEQLE +NQ L + KE L  E+   R++ + +  ++   +E L  +  Q ++E ++ ++ ++ +H ED++RL +  E+ R   E E+EE +HR   ERD+++  YE EK+E+++EI  +Q+ERD+SLL+AENEKQQ+LSL E EK  ++EKL   Q  L  V  E++R K+++ +RQEQD+  I GL+SELK+ R++FE+    HE EVK L+   KDL+  ++ +++EV +L T L++ E+ RD +RR+++E +RK++E+ E  E  ++EI +L+R L +E +EKE + +SN+ LR  +K  E++RI L R   + +QK+++ +E      +E  +LR++L++VE++RL+ +RELQELRR IK LD+E  K +KEV +LQ RVA DE++E+E RRE+FGLKQK+VE+EASRE+ +K+L N QR + ++E   + +++D    +E +R + +KL D   +L+   D   A+ +EL + LS AEGRV  LE+ + RVEG K+++EFKL S+HS+LRR +G  +        IR R++S   +               +    +  ++ TDG  SP+P+ GSP S+     R  SPS  +    DI+P+ VR ALR+F+Q+L + +R+RDD  A+  SL  +L E E   + A  R+Q LQ+ + ++EE ++G+DG+LSSAQTALM+QEET+RRN+R+RKA+ +K++  +R+  S +SE+R  ++++ K + ++A+LE + ++ K+ ++ AE+R T+++L +RSL+G+LQRMK+ L+D+E E +VL DR + L +Q+ D E K+ +LQ+++DR+++ L K EE  S  KDK+Q L+ +L+  S   +  + K+ QLQKAL +SE DRR+L+ERL++++ A+ EAK QN  L +RIQ ++++  + E ++ ELEG  RQ   L+ QRQE E    +  QKL  +K+ LQER+ S+QR LA  E+EK+E  ++  +LEKD++ALKK+L KVER+KLKT E + +   E+  LD+ L  +E E  + QRQ+ +L+ QLAE EQ+    L+E  +RHRQE+ +E+E LR S VQ ERTLE RERAHRQRVKGLEEQI TLKDQL  E+ RR    Y  S+
Sbjct:  165 KSLAQQNVELRRRLDEEQAAYKRKLQAYQEGQQRQAQLVQKLQAKVLQYKKKCGEVEQQLLEKSTELEQQRLTSQLDM-TDSRLCLEEEHSN-DLENALIRLEEEQQRSASLAQVNAMLREQLDQANTANQALSEDIRKLTADWTKARDELEQREVEWRREEESFNTYFSNEHSRLLTLWRKVVGFRRHFSEMKTMTERDLSELSSQVSKASRTIHASCLNLSSNLRLSESSAGAALEKQALLLAQIEEQLKDKVRDMIQLQVKCDMEKAELSARVTELSAMVESLKTQNAEKEKAAEALTQKLETLEAARAQEQAVLEAEEIEALRTESELLQQTLRDLAQAVLSDTDSAIQLTGTERTPDASDS---EATGLSLRGLSSSLRTPSPLRRSSPRRSLSDSTLAAVHSALQKRQLQVQDIRSKYEASQDLVSSLRRQLGESDGERRSLEQKILQLKDEVDCSSRAREDAQQDVGRFRASVDLLGSEKSALERSLQALQQHVESLRQENEKLQLANADLQRQRDNLEDEKDDVAKDKDRAQKEVERGHKQLEQLEVKKSSLKKELILVKETLNRATLEKEVSENEKVGLEEALSKAEVSRAELELAINKLKAEEASLRDSLSKMSSLNEGLAQDKTELNRILIQLEEEKVALLEQKQGVEQEKISLREELVRLEQEKLDLATQKQGLGRSLQAAEQSRDKLERDLLVLQRERGQLQEQLGQLSRQKTAASEELAQARREQDRHGEALLRAAKEKEGLMKEKASLAVQLTASERENRGLAEEIAGLRSEKDALETTLFEIQQQLSQLATRKEQLEADNQALFLAKETLQVEMAGARKQLEADVTRLERDKELLAQKLSQTEQEAQVTLRNKQAAHEEDMDRLQREKETQRLELEAEKEEALHRLVQERDELLARYEAEKEELSEEIAALQQERDESLLLAENEKQQALSLKESEKTILSEKLTGVQQSLAGVTLEMERQKRDAMSRQEQDRSTINGLTSELKNLRARFEEAIAAHEREVKGLHEQAKDLSRQRESSVREVEELKTQLRMVEDARDGIRRDLIEAHRKVRESLEGHELQRKEIQDLRRSLSDEAKEKEAMQHSNQELRAAVKRAESDRISLKRANEEKEQKMSILEEARAAVGKEAADLRSSLQEVERSRLEARRELQELRRQIKMLDSENTKKSKEVAELQARVAVDEQREEETRRESFGLKQKIVESEASRESAKKELHNLQRKLSEVEGDFRLREKDLLGSLEEARGNEKKLLDNARNLEIKLDNAQAEASELSLRLSAAEGRVHGLEAELVRVEGLKRDVEFKLGSLHSALRRTMGVSRGGRAPSPAIRGRSSSPKRLF--------------SPPRGDAASSPTDGHASPMPQAGSPGSRPLSPERPFSPSRSEQLVADIDPDVVRAALRDFLQELRETQRERDDLRARLSSLTRQLAEMESDRDSASARVQHLQKLVAESEEGRRGMDGKLSSAQTALMLQEETLRRNDRERKALLDKVATLERSLQSADSERRTTQEKITKMKANEAKLEADKRRLKEILDAAESRCTKVELLRRSLDGELQRMKLVLSDREMEIQVLQDRGDMLQRQVTDSEMKASALQMSVDRLTLTLGKAEESESSLKDKVQSLSAALTESSAGTDSAEEKVLQLQKALTASEHDRRVLQERLDAARQAVSEAKKQNGTLADRIQGLKTEQAELELQKEELEGQVRQQQELLRQRQEGESLALRGQQKLQEDKHLLQERLGSLQRALAQLESEKREAERSSLRLEKDKTALKKTLDKVEREKLKTREDSLRLSAEKGRLDRSLTTVEQELADAQRQIQLLEAQLAEMEQSQSQSLLETATRHRQELQVEIERLRGSQVQAERTLEARERAHRQRVKGLEEQICTLKDQLQQEL-RRYQPHYPASS 2066          
The following BLAST results are available for this feature:
BLAST of Rootletin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
CROCC0.000e+036.45ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC1.803e-17135.60ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC1.368e-8435.02ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC21.210e-7028.12ciliary rootlet coiled-coil, rootletin family memb... [more]
CEP2501.704e-5126.61centrosomal protein 250 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Rootletin vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 2
Match NameE-valueIdentityDescription
lfi-13.859e-1824.73Lin-5 (Five) Interacting protein [Source:RefSeq p... [more]
lfi-15.158e-1824.73Lin-5 (Five) Interacting protein [Source:RefSeq p... [more]
back to top
BLAST of Rootletin vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 3
Match NameE-valueIdentityDescription
Rootletin3.302e-8924.02Rootletin [Source:FlyBase gene name;Acc:FBgn003915... [more]
Rootletin3.302e-8924.02Rootletin [Source:FlyBase gene name;Acc:FBgn003915... [more]
Rootletin3.302e-8924.02Rootletin [Source:FlyBase gene name;Acc:FBgn003915... [more]
back to top
BLAST of Rootletin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 3
Match NameE-valueIdentityDescription
crocc24.025e-18031.61ciliary rootlet coiled-coil, rootletin family memb... [more]
ENSDART00000102348.41.479e-1632.49pep:novel chromosome:GRCz10:9:12934265:12983197:1 ... [more]
ENSDART00000139377.17.016e-1635.33pep:novel chromosome:GRCz10:9:12934388:12944454:1 ... [more]
back to top
BLAST of Rootletin vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
crocc0.000e+040.27ciliary rootlet coiled-coil, rootletin [Source:Xen... [more]
ENSXETT00000026525.30.000e+032.00pep:novel scaffold:JGI_4.2:GL172691.1:3390468:3459... [more]
ENSXETT00000051541.31.125e-1633.83pep:novel scaffold:JGI_4.2:GL173371.1:61376:84366:... [more]
ENSXETT00000051536.21.197e-1633.83pep:novel scaffold:JGI_4.2:GL173371.1:61373:82267:... [more]
ENSXETT00000051537.21.359e-1633.83pep:novel scaffold:JGI_4.2:GL173371.1:60614:84366:... [more]
back to top
BLAST of Rootletin vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Crocc0.000e+035.74ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+035.45ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+035.45ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+035.45ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc21.477e-8527.16ciliary rootlet coiled-coil, rootletin family memb... [more]
back to top
BLAST of Rootletin vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CJ40|CROCC_MOUSE0.000e+035.74Rootletin OS=Mus musculus GN=Crocc PE=1 SV=2[more]
sp|Q5TZA2|CROCC_HUMAN0.000e+036.45Rootletin OS=Homo sapiens GN=CROCC PE=1 SV=1[more]
sp|H7BZ55|CRCC2_HUMAN6.215e-7028.12Putative ciliary rootlet coiled-coil protein 2 OS=... [more]
sp|Q9BV73|CP250_HUMAN8.758e-5126.61Centrosome-associated protein CEP250 OS=Homo sapie... [more]
sp|Q60952|CP250_MOUSE5.047e-4826.59Centrosome-associated protein CEP250 OS=Mus muscul... [more]
back to top
BLAST of Rootletin vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A1I8FWZ5|A0A1I8FWZ5_9PLAT0.000e+051.51Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|K1QGF9|K1QGF9_CRAGI0.000e+049.06Rootletin OS=Crassostrea gigas GN=CGI_10027502 PE=... [more]
tr|A0A1I8IN59|A0A1I8IN59_9PLAT4.270e-12050.32Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|A0A183JY49|A0A183JY49_9TREM0.000e+041.66Uncharacterized protein OS=Schistosoma curassoni P... [more]
tr|A0A151MJ79|A0A151MJ79_ALLMI0.000e+041.78Uncharacterized protein OS=Alligator mississippien... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 33..52
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..11
score: 0.517
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 44..61
NoneNo IPR availableTMHMMTMhelixcoord: 20..39
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableCOILSCoilCoilcoord: 415..491
NoneNo IPR availableCOILSCoilCoilcoord: 1232..1259
NoneNo IPR availableCOILSCoilCoilcoord: 786..880
NoneNo IPR availableCOILSCoilCoilcoord: 1428..1476
NoneNo IPR availableCOILSCoilCoilcoord: 142..187
NoneNo IPR availableCOILSCoilCoilcoord: 625..771
NoneNo IPR availableCOILSCoilCoilcoord: 67..87
NoneNo IPR availableCOILSCoilCoilcoord: 1519..1623
NoneNo IPR availableCOILSCoilCoilcoord: 1892..1919
NoneNo IPR availableCOILSCoilCoilcoord: 1141..1217
NoneNo IPR availableCOILSCoilCoilcoord: 213..233
NoneNo IPR availableCOILSCoilCoilcoord: 972..999
NoneNo IPR availableCOILSCoilCoilcoord: 1106..1133
NoneNo IPR availableCOILSCoilCoilcoord: 263..290
NoneNo IPR availableCOILSCoilCoilcoord: 911..945
NoneNo IPR availableCOILSCoilCoilcoord: 1645..1791
NoneNo IPR availableCOILSCoilCoilcoord: 295..315
NoneNo IPR availableCOILSCoilCoilcoord: 1057..1098
NoneNo IPR availableCOILSCoilCoilcoord: 499..596
NoneNo IPR availableCOILSCoilCoilcoord: 32..59
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 417..478
e-value: 6.5E-4
score: 19.3
NoneNo IPR availablePFAMPF15035Rootletincoord: 50..239
e-value: 3.1E-48
score: 164.2
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1094..1331
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1428..1648
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..28
score: 0.601
NoneNo IPR availableCOILSCoilCoilcoord: 116..118
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..11
score: 0.528
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.696
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 7..29

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0035253ciliary rootlet
Vocabulary: biological process
TermDefinition
GO:0051297centrosome organization
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000007Stage 7
PLANA:0000008Stage 8
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000022Category 5 cell
PLANA:0000087proximal tubule
PLANA:0004529integumental system
PLANA:0000034definitive epidermis
PLANA:0000088renal system
PLANA:0000020protonephridia
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030007 ID=SMED30030007|Name=Rootletin|organism=Schmidtea mediterranea sexual|type=transcript|length=6612bp
GTTGTTTTTAAATCACTATTTTTTTTATTTCATCTGATTATAATTTTTTT
TTATTGAAATTTGTATTTTGAAATTGGTGAACAATGAGTGAGATAGATTA
TTCCGCTATTGTTCGGAGACGCATTGGAGATATCGATGGGGATTCAAGTG
AAGATTCCAGTTCAAAGGGTTTGCTTCAAGTTAACTTGGAACTGAGAAAG
CGCTTAGAGGAAGAACACAATGAGTATCGTAGAAAGCTGATAGTTTTCCA
AGACAGCCAACAGAAACAAGCGCAATTGGTTCAAAGATTGCAGAAAAAGG
TATTGCAATACAAAGAAAAATGCACGGAACTTGAATCTAAAATGCAATTT
GGCGATTATGAGACTCGAAAAACGAAGTATGGAAGTCCAACGAATAACGG
CTATGGGTCGCGTAGTGAGAATCCCTACGACAATCTGGATTTGGAGAGCA
CACTCATTAAGTTAGAAGAGGAACAAAAAAAAACAAATTATCTAACGGAG
TTCAATGAACGGCTTCAAGAACAATTAACTCAAGCAACTCAATCAAACCA
GAATTTGACGAGAGACATCAGTAAGCTTTCCGAAGAATGGCAGAGATCAA
GGGAGGAGCTTGAACAGAGAGAAAAAATTTGGCGAAATGAAGAAATGTCA
TTTAATGACTATTTAGCATCTGAGCATTCGAATCTGCAAAATTTGCAACG
CAATACGATAAATTTCCGCCGTCAATTTATAGAATTGAAAGCTTCAACTG
AACGGGAAATAAATAATTTGAAAAATGAATTCAACCGACAGGCACGCTGT
TTGCAAACTGCTTGTTCCAATCTTTCGTGCAACATGAAATCTGCAGAATC
TAAACAACAATTGAGTACTGAACGAGAAAGTCGGGACAAGTTGAATCTCG
AAAATCAACTGCGAGAAAAAAACAGAGAATTAACTGATTACCAAACTCGG
TATGAATGTGAAATGACAGAATTGCAACACCGAGTGAAAGAATTAACAGT
TCTCAGTGACAAACTGAAAATTCAAAACCTGGAAAAGGATCGAGCATTGA
CAGCTTTGCAAAGAATTAAGAATGGAGATACCGCAGGAGAAATAAATATG
GAAGACAAAGCTACAAGAGTTCTTATTGAAGACACAGAAAGTATGCATCA
AGCACTTCGAAATATTTCTCAAGTAGTACTAAATGATTCTGACTATTTCG
ATGCAGAAGACACAGGATTTGAAACAGTTCGAAAGAATAATCGTTCGCCA
AGTCCAAGGAGAAATCGTAGCGTCAGTCCTAACTCAAGATCAGCTAAAAC
ACCGCCATTTGCCGATGCAACGTATGCGGCGGTTCAGTCGGCTATAAATA
AAAAATCTCTACAGATTCAAGAGCTTAAATCAAAATTAAACAGTTCTAAA
GAGAGTTGTACAAACTTCAAAAGACAAATTGATGACAATGAAAATGAACG
TCGACGATTAGAGAATCAAGTTCTCGCCATGAGAGATGAAATTGAAAGTT
TACGACGAGATAAAGATGATAGTTTTAGAGAAGCGGATCGGTTTAAAAAT
GCTCTGAACATCACTTCAAATGAACGAAGCCAATTGGAAAAGATTCGATC
ATCACTAAACGATCAAATTGAGCAGCAACTCACAGAAATTGAACGACTTA
AGTCAGCCAATCACGAATTACAACGATTGAGAGAGGCATTGGAAGATGAG
CAAGAAGATACTAAAAAAGACTTAGAAAGACAAATTAAAGAAAGTGAAAG
ATGCCAACGATCGATTGATGTTTTGGAAGATAAAATAAGTCGATTTAAAG
AAGACGTAGTTAATTACAAAGAGGCAATTAATAAATACCAATTAGAAAAA
GAAGTATTGGTGCAAGAAAAGGATGAGATTGGTGATGCTTTAAGTCGTTG
TGAAATTTCTAAAGCCGAATTAGAAATCGAGGTGAATAAACGGCAAACTA
TTGAAGTAAATTTGGAAGAAAACATTTCAAAATTATCCTCAGAAATCGAA
GAATTGAATGATAAGCGAGCTGAAAACCACAGAACTATTAAACAGCTGGA
ACATGAAAGAAGTTCTCTTTTGAATGAAAAACGATTTTTGGAACAAGAAA
AAAGTGGTTTGAAAGATGAGCTTGTTCGATCTGAACAAGAGGCTCTTGGT
TTGTCAAATGAGAAAGCCATTCAACGTCAAAGAATCGAACAACTTGAAAT
TAATACAGAAAGATTAGAAGAAGAGTTATCGGAACTCAATCGAGAAAAGC
TAGATCTTACTGAACAAATAGGCTGTTTGCAGAGGCAGAAATCGGCTCTT
GCAGAAGAATTGTTGCAATGTCGTAGAGAATTAGAACGATCTAATAACAG
TGTCAACAACTTATCAAAAGAAAAGGAATATCTTACCAAAGAGAAAGGAG
AACTCGTCGTTCAAGTTACAGCTTGCGAAAGGGAAAATCGTCAACAGTCA
GAAGTTATTGCTTCTTTGAATTCCGATAGAGAACAACTGGAAGCTACTCT
TTATGATGCTCAACAATTAATCATTCAGTTGGAAACTCGAAAAGAGCAAT
TAGAAGGCGAAAACCAAGAGTTGATTGTGAAAAAAGAAAATCTAAATGGA
GAACTAGTCAGATTACGACAAGAGTTTCAACTAGAATACGAGAAGGTTGT
TAATTCACGAGAACAATTAAATTGCAGATATCAACAAATGGATAAAGAAT
ATAAGATGGCAATTCAACAAGAGCGAGATTCTCATGCTGAAGATGTAGAA
AGACTAACTAAGATAAACGAAAGCAATCGTCATGGATCTGAAAACGAACG
AGAAGAGCTTATTCATCGATTCAATATGGAGCGTGACGACATGATTCAAA
ATTACGAACAAGAGAAACAAGAAATGGCCCAGGAAATCATGACGATCCAA
CGAGAACGAGATGACTCATTATTAATGGCGGAAAATGAAAAGCAGCAATC
ATTGAGTTTATTAGAACAAGAAAAATGTGCAATCAATGAAAAGCTTATCA
AAACGCAATTTGAACTGCAATCGGTTGAGTCGGAATTGGATCGCATTAAA
AAGGAGTCGTCCAATCGTCAGGAGCAAGACAAACAGAACATTGCCGGCTT
GTCGAGTGAACTCAAATCATTTAGATCTCAATTTGAGGATAAATGCCAAA
ATCACGAAATGGAAGTTAAAAGCCTAAATAGTGGAATCAAGGATCTAACA
TTAATGAAAGATCAAGCTCTCAAAGAAGTCCATGATTTGCATACCGGATT
AAAAATAGCTGAAGAAACCCGTGATAATTTGCGTCGGGAAATCATGGAAA
TGAATCGGAAATTGAAAGAAGCTGAGGAAGCCAAAGAGCACTTAAAGCGT
GAAATTAATGAATTGAAACGTGGATTATGCGAAGAACAAAGGGAAAAAGA
AAATGTTATTAACTCAAATGAGAATTTGAGAAAGAAAATTAAAGATGTTG
AAACAGAAAGAATTGATTTGCACAGACAAGTAACGGATTCCAAACAAAAG
GTTGCAGTACAAGATGAACAATTGGTCAATTCCAAACAAGAGGTCAATGA
GTTAAGAAACAATCTTAAAGACGTAGAAAAAGCTCGATTAGATGTCAAAA
GAGAGTTACAAGAACTCAGACGCCATATCAAAGAGCTAGATACGGAAAGG
GGCAAATTGACTAAAGAAGTCAATGATTTGCAAACTCGTGTTGCTAGAGA
TGAAGAAAAAGAGGATGAAGCTCGTCGGGAAAATTTCGGTCTCAAACAAA
AAGTTGTTGAAACGGAAGCTTCAAGAGAAGCCGTTCGTAAAGATCTTGCT
AATGCTCAACGACATATTGTTGATTTGGAAAATGTTCTGCAGAGCAAAGA
CAGAGATTTCAGTTCCATGGTGGAATCGAGCCGCCGGGATTATAGGAAAC
TTGCTGATGCGAGAAATAGCCTGCAACAAGTATATGATACGATGGTGGCC
GATAATAATGAGCTGAGAATTGCTCTCAGTGGAGCAGAAGGTCGGGTCAG
TGCTCTGGAGTCACACATCGCACGAGTTGAAGGAGCTAAGAAAGAAATTG
AATTCAAATTGGCTTCTATCCATAGCTCATTGCGAAGGCTGATAGGATTC
CGACAGGAGAATGTAGTTACTATTCGGTCGAGAAACAACTCCAAATCTCC
AGTTAGAGGTCGATCAGTTAGTCCTCTTAGAAGTAGGCCGGTGTCGCCAA
CCAAAGGATTTGACAATACCTATGCTACTACAACTGATGGAAAAGGTAGC
CCTATCCCGCGCACAGGGTCTCCGAGTTCTAAACGAAGGCAATTATCAAG
ATCTCCGTCTAATTGCGATTTCAATCCAGTCGATATAAATCCAGAAGCAG
TTCGTCTGGCCTTGCGAGAATTCGTACAGCAGTTGGTTGATGCTGAACGA
GATAGAGATGACGCTTTTGCTCAAGCTCGCAGCCTAGAATCTCGATTGAA
AGAACAAGAAGAACAAAATGAATATGCTGAAAACCGTTTACAACAACTAC
AACAAGCTCTGTGTGATGCAGAAGAAGACAAAAAAGGCATTGATGGAAGA
TTGTCATCAGCCCAAACTGCCTTAATGATGCAAGAAGAGACTATTCGGCG
CAATGAGAGAGATAGAAAAGCAATGGCGGAAAAGTTGAGTAATTACGATA
GAACATTTGCATCCATGGAATCAGAAAAACGACAATTGGAAGATCGGTTG
AATAAATTCCGTCATCATGATGCCCGATTGGAAGAAGAACATAAGCAGAG
CAAAAAAGCTATTGAAAATGCTGAAAATAGAATAACTCAGCTTCAGCTTG
CCAAGCGATCGTTAGAAGGAGATCTTCAAAGAATGAAAATGGCGTTGACA
GATAAAGAAACAGAAACCGAAGTTTTGGATGACCGCGTAAATAGTTTACT
CAAACAAATACAAGATCTCGAGGGAAAATCTCAATCACTTCAACTAACGA
TTGACAGAATGAGTGTCGCCCTTGCAAAAACTGAGGAAGAAGGCAGTTTT
CATAAGGACAAAATGCAACAGTTGAATATGAGTTTGAGCACTCATTCACA
ACAACTGGAACAATTACAGAATAAGATTTCTCAATTACAAAAAGCACTCG
GCAGTTCAGAACAAGATCGTCGGCTCTTAGAGGAACGATTAGAAAGCTCT
AAAGGAGCATTGCATGAGGCAAAACATCAAAATAATTTGTTGATGGAAAG
AATACAAATAATTCAATCCGATTTAAATGATTCGGAAAATCGTCGATCAG
AATTGGAAGGATTAAATCGACAGAGTAACACTTTGATTGTACAAAGACAA
GAAGCTGAACAAGAACTCAATCAAAAATATCAGAAATTGAACTCGGAGAA
AAACACATTACAAGAGCGAGTGAATAGCATGCAACGAAATTTGGCTTTGG
CAGAAGCAGAAAAACAAGAAATAATAAAAAACCACGGAAAATTGGAAAAG
GATAGATCTGCCTTGAAAAAGAGTCTTGGAAAAGTTGAACGTCAGAAATT
GAAAACCGAAGAAATTGCTAGCAAAACTGTTTTTGAACGTTCAGAATTAG
ATCAAATTTTAAGGAGACTTGAAGATGAAAATTGTGAATTACAGAGACAA
GTTGGAATTCTTCAAAATCAATTAGCAGAAGCTGAGCAAGCTCACTGCCA
CCATTTGATGGAAATCAATTCCCGCCATCGCCAGGAAATGTCCATGGAAA
TGGAGCATTTGAGAGCATCGAATGTTCAAATAGAACGAACTCTAGAAGGC
AGAGAACGAGCCCACAGACAAAGAGTTAAGGGTCTGGAAGAACAGATCTC
CACCCTCAAAGACCAGCTGACTCATGAAATGCAGAGGCGGATGGATAGTG
GATATTACGAGTCTACCAGAAAGTCTAATCAATACGATTCAACTGGTGAC
TTGCGACATGTTCTGGATTCCAGTTTAACTCGAGTTGCAAAAGACCCTCA
ACTGGACGCAATGCTACTGGAAACCGAAGCCAGGCGACTCGATGAGTCGA
TATTCATGTGTGGCAGTCGTGATCAGTCTCCGACCCGGCAGAAGCGAATC
GAAATGTCAAAGAAGTCCGCAGCCCCTAACAATTCCAATCGGCGATTAAC
TGCCGGCCGTCGCAAATGAACTCGGCCTGTTCCAGTCCGTCCAGAGATGT
TATGAAGCCACTTTTTAGATGCGTGAGTGTGAGTTCGTGTTGGTGACTGA
TTCATTTTTAGTAAACAGATTCTGGATTTTTGTTTTTATTGATAGTGTAA
TTTCCTAATGCAGATCTGATAGTTGACTTGTTGTTCTTACGTATTCGGTA
TTTGTGATTCACATAGTCTGTCATTGTTACTGTGATTTATCCTCTGTGTG
ACTTTTGTGATTTACTTACTTTATTGCCCCTATAATCAATAAATGGATTT
ATCGATAGTTCAGCCCTCCCCTCCAGCCCTCGTTTTGGGATCCGTAAATT
TTGTTTCAATTGAGATCATTATAGTGATTTTATTCCTTCGAAACCAAACC
TTTGGGAGGGACATAAAATTAAATTATTGATTTTTTATTATCTTAGAAGT
GAAAGATGTTTATTTCCCAAATTAACTAATATCAATAATAACTTTAATTT
ATATCTTCATTA
back to top

protein sequence of SMED30030007-orf-1

>SMED30030007-orf-1 ID=SMED30030007-orf-1|Name=SMED30030007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2012bp
MSEIDYSAIVRRRIGDIDGDSSEDSSSKGLLQVNLELRKRLEEEHNEYRR
KLIVFQDSQQKQAQLVQRLQKKVLQYKEKCTELESKMQFGDYETRKTKYG
SPTNNGYGSRSENPYDNLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQ
ATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSN
LQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCN
MKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHR
VKELTVLSDKLKIQNLEKDRALTALQRIKNGDTAGEINMEDKATRVLIED
TESMHQALRNISQVVLNDSDYFDAEDTGFETVRKNNRSPSPRRNRSVSPN
SRSAKTPPFADATYAAVQSAINKKSLQIQELKSKLNSSKESCTNFKRQID
DNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQ
LEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQ
IKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIG
DALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHR
TIKQLEHERSSLLNEKRFLEQEKSGLKDELVRSEQEALGLSNEKAIQRQR
IEQLEINTERLEEELSELNREKLDLTEQIGCLQRQKSALAEELLQCRREL
ERSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDRE
QLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQL
EYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRH
GSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAE
NEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDK
QNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNSGIKDLTLMKDQALKEVH
DLHTGLKIAEETRDNLRREIMEMNRKLKEAEEAKEHLKREINELKRGLCE
EQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNS
KQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQ
TRVARDEEKEDEARRENFGLKQKVVETEASREAVRKDLANAQRHIVDLEN
VLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSG
AEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSR
NNSKSPVRGRSVSPLRSRPVSPTKGFDNTYATTTDGKGSPIPRTGSPSSK
RRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARS
LESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQ
EETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLE
EEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDD
RVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMS
LSTHSQQLEQLQNKISQLQKALGSSEQDRRLLEERLESSKGALHEAKHQN
NLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQ
KLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGK
VERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEA
EQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKG
LEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQYDSTGDLRHVLDSSLTR
VAKDPQLDAMLLETEARRLDESIFMCGSRDQSPTRQKRIEMSKKSAAPNN
SNRRLTAGRRK*
back to top
Aliases
The feature 'Rootletin' has the following synonyms
Synonym
H.2.8b
crocc