Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30029987
Length (bp)685
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase M60 domain-containing protein (SMED30029987) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30029987) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029987

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30029987h1SMcG0015805 SmedASXL_005560SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30029987h1SMcG0015805 SmedASXL_017335SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30029987h1SMcG0015805 dd_Smed_v4_13583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029987h1SMcG0015805 dd_Smed_v4_13583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029987h1SMcG0015805 dd_Smed_v4_15156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029987h1SMcG0015805 dd_Smed_v4_15156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029987h1SMcG0015805 dd_Smed_v4_14792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029987h1SMcG0015805 dd_Smed_v4_14792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029987h1SMcG0015805 dd_Smed_v4_13376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029987h1SMcG0015805 dd_Smed_v4_13376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30029987h1SMcG0015805 dd_Smed_v6_13376_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30029987h1SMcG0015805 dd_Smed_v6_13583_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30029987h1SMcG0015805 dd_Smed_v6_15156_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30029987h1SMcG0015805 dd_Smed_v6_13583_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S6KMG4 (Peptidase M60 domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.284e-117
Identity = 182/228 (79.82%), Postives = 204/228 (89.47%), Query Frame = 1
Query:    1 LQILNIFNVDXXXXXXXXXXXXXXEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            LQILNIFNVDF N+F S SS +N+EMPDSMFS++LIGLED++ RMLLNHDYL+SKA L+ GL+  + +SML+NSK+   LI IIKKYE LLKWICPCDVQKATD NDRKLIRF GE++KNQ LAYSNFKAPCGDLFPGDFVASPPKVTV+LNL+G+TPST+NPIGYYLEAGSTLEYN+I SSGSWAISVGCHTDNLPDSL  WARYPSI +YRIPIS  GHIYSAFGG
Sbjct:  347 LQILNIFNVDFLNTFISWSSPINSEMPDSMFSDNLIGLEDILSRMLLNHDYLLSKASLLNGLMSKYPASMLNNSKLSVILIAIIKKYESLLKWICPCDVQKATDLNDRKLIRFFGELLKNQALAYSNFKAPCGDLFPGDFVASPPKVTVRLNLVGITPSTDNPIGYYLEAGSTLEYNIIVSSGSWAISVGCHTDNLPDSLAGWARYPSITVYRIPISGIGHIYSAFGG 574          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S6KMG0 (Peptidase M60 domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.819e-45
Identity = 86/227 (37.89%), Postives = 133/227 (58.59%), Query Frame = 1
Query:    4 QILNIFNVDXXXXXXXXXXXXXXEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            +I+N+FN+    ++ +  S     + DS F+E+ + L+  + +++ N+DYL+     +   +      +++N+K+ +     +KKY+ L+ +ICPC    ATD +DR +I   G   K+Q LA+S +K PC DLFP DF ++P    V L + G    T  PIGYYL AG TL+Y +  S+G W ISVGCH+D L +   EW RYP I    +P+S +G I+S FGG
Sbjct:  356 KIMNMFNIASDTTYFTFGSSGEYTIKDSDFTEEFLDLKVRLRKLVDNYDYLLENGQFLLNSMNKMPPKIIENAKLDDVSKDFLKKYDYLISYICPCKDDPATDVSDRSIISIFGLFAKSQGLAHSKYKLPCIDLFPMDFKSAPKLKQVVLEVFGEIAYTRIPIGYYLPAGETLKYKIQASTGKWGISVGCHSDILGEKRSEWYRYPDIYTNSVPLSEEGTIFSPFGG 582          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A448WAZ0 (Peptidase M60 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS739 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.624e-8
Identity = 50/181 (27.62%), Postives = 80/181 (44.20%), Query Frame = 1
Query:  208 MLDNSKMPEYLITIIKKYEKLLKWICPCDV---------QKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPK--VTVKLNL-IGVTPSTE-NPIGYYLEAGSTLEYNVI------GSSGS---WAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            ++ +      +  ++ +Y  L+ ++ PC           Q +     R  I     ++    L Y+  K P    FPGDF   P     T +L L +  T S E +  G+Y  AG+T EY V       GS      W++ +GCHTD L + L  W R+P I  +R+P+   G +++  GG
Sbjct:  224 LIQSESTSSLIANLLTRYSSLMDYVAPCPSRPFRGLTRGQPSLPLPHRHAILNFNRLVFAPSLRYTGLKLPGVSQFPGDFPTRPAHGLRTSQLFLEVNHTVSGEKHTTGFYAPAGATFEYEVAFVEPPGGSEDEPIGWSLEIGCHTDRL-EPLARWDRFPVIT-HRVPLELHGVVFTPVGG 402          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A448WDR5 (Peptidase M60 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS2683 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.583e-7
Identity = 47/169 (27.81%), Postives = 77/169 (45.56%), Query Frame = 1
Query:  202 SSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNF---KAPC-GDL-FPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSG---SWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            +S  +N++  E L   + KY   +    PC   +A     ++ +R    ++  Q   +S     K P  G L FPGDF      V++ + L+ + P    P G Y +A     Y +I  +G    + + +GCH+DN+ DS   W R+P I+  R      G  +S +GG
Sbjct:   17 TSTFENNEFQEELNKFLDKYYYFISERAPC---QARPFKSKENLREKTALLNYQNAIFSQIGPRKRPIPGYLNFPGDFAGPAEPVSLTIKLVQLHPDEFIPTGAYAKAMVEFYYKIIDRAGPIMDYTMIIGCHSDNIEDSTI-WKRWPKISHSRQLSKESGTYWSPYGG 181          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042174.1 (SMESG000042174.1)

HSP 1 Score: 434.106 bits (1115), Expect = 2.144e-147
Identity = 225/228 (98.68%), Postives = 226/228 (99.12%), Query Frame = 1
Query:    1 LQILNIFNVDXXXXXXXXXXXXXXEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            LQILNIFNVDFRNSFTSSSSVVNTEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKV VKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPIS+KGHIYS FGG
Sbjct:  348 LQILNIFNVDFRNSFTSSSSVVNTEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVIVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISDKGHIYSGFGG 575          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042174.1 (SMESG000042174.1)

HSP 1 Score: 433.335 bits (1113), Expect = 2.931e-147
Identity = 225/228 (98.68%), Postives = 226/228 (99.12%), Query Frame = 1
Query:    1 LQILNIFNVDXXXXXXXXXXXXXXEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            LQILNIFNVDFRNSFTSSSSVVNTEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKV VKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPIS+KGHIYS FGG
Sbjct:  345 LQILNIFNVDFRNSFTSSSSVVNTEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVIVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISDKGHIYSGFGG 572          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042235.1 (SMESG000042235.1)

HSP 1 Score: 426.017 bits (1094), Expect = 4.651e-145
Identity = 219/228 (96.05%), Postives = 223/228 (97.81%), Query Frame = 1
Query:    1 LQILNIFNVDXXXXXXXXXXXXXXEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            LQILNIFNVDF NS+TSSSSVVNTEMPDSMF +D IGLEDLVHRMLLNHDYLI KAPLVAGLLPIFSSSML+NSKMPEYLITIIKKYEKLLKWICPCDVQKAT+PNDRKLIRFLGEIMKNQ LAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG
Sbjct:  285 LQILNIFNVDFLNSYTSSSSVVNTEMPDSMFIDDFIGLEDLVHRMLLNHDYLIRKAPLVAGLLPIFSSSMLNNSKMPEYLITIIKKYEKLLKWICPCDVQKATNPNDRKLIRFLGEIMKNQALAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 512          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042170.1 (SMESG000042170.1)

HSP 1 Score: 421.009 bits (1081), Expect = 2.013e-142
Identity = 215/228 (94.30%), Postives = 219/228 (96.05%), Query Frame = 1
Query:    1 LQILNIFNVDXXXXXXXXXXXXXXEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            LQILNIFNVDF NS+TS SSVVNTEMPDSMF +D IGLEDLVHRMLLNHDYLISKAPLV  LL IFSSSML+NSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQ LAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPIS+KGHIYS FGG
Sbjct:  348 LQILNIFNVDFLNSYTSWSSVVNTEMPDSMFIDDFIGLEDLVHRMLLNHDYLISKAPLVGSLLAIFSSSMLNNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQALAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISDKGHIYSGFGG 575          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042170.1 (SMESG000042170.1)

HSP 1 Score: 420.239 bits (1079), Expect = 3.414e-142
Identity = 215/228 (94.30%), Postives = 219/228 (96.05%), Query Frame = 1
Query:    1 LQILNIFNVDXXXXXXXXXXXXXXEMPDSMFSEDLIGLEDLVHRMLLNHDYLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISNKGHIYSAFGG 684
            LQILNIFNVDF NS+TS SSVVNTEMPDSMF +D IGLEDLVHRMLLNHDYLISKAPLV  LL IFSSSML+NSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQ LAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPIS+KGHIYS FGG
Sbjct:  345 LQILNIFNVDFLNSYTSWSSVVNTEMPDSMFIDDFIGLEDLVHRMLLNHDYLISKAPLVGSLLAIFSSSMLNNSKMPEYLITIIKKYEKLLKWICPCDVQKATDPNDRKLIRFLGEIMKNQALAYSNFKAPCGDLFPGDFVASPPKVTVKLNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSLPEWARYPSINIYRIPISDKGHIYSGFGG 572          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A1S6KMG41.284e-11779.82Peptidase M60 domain-containing protein OS=Schmidt... [more]
A0A1S6KMG02.819e-4537.89Peptidase M60 domain-containing protein OS=Schmidt... [more]
A0A448WAZ01.624e-827.62Peptidase M60 domain-containing protein OS=Protopo... [more]
A0A448WDR53.583e-727.81Peptidase M60 domain-containing protein OS=Protopo... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042174.12.144e-14798.68SMESG000042174.1[more]
SMESG000042174.12.931e-14798.68SMESG000042174.1[more]
SMESG000042235.14.651e-14596.05SMESG000042235.1[more]
SMESG000042170.12.013e-14294.30SMESG000042170.1[more]
SMESG000042170.13.414e-14294.30SMESG000042170.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029987 ID=SMED30029987|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=685bp
TTACAAATTCTCAATATATTTAACGTTGACTTTCGCAACTCTTTCACAAG
TTCGAGTTCAGTTGTAAACACCGAAATGCCCGACTCGATGTTCAGTGAGG
ATTTGATTGGATTAGAAGATCTTGTACATAGGATGCTTCTTAATCACGAT
TACTTGATAAGCAAAGCCCCACTGGTAGCTGGCCTATTGCCAATATTCTC
TTCGTCCATGTTAGACAATAGCAAAATGCCTGAGTATTTAATCACCATTA
TAAAGAAATATGAAAAGCTTCTGAAATGGATTTGTCCATGCGATGTGCAA
AAAGCCACCGACCCAAATGATAGGAAATTAATCAGATTCCTTGGTGAAAT
AATGAAAAATCAAGTTTTAGCCTATTCAAATTTTAAAGCACCATGTGGCG
ATTTATTCCCGGGAGATTTTGTTGCTTCGCCTCCAAAGGTCACAGTTAAG
CTTAACCTAATCGGTGTCACGCCTTCAACAGAAAATCCGATTGGGTATTA
TTTAGAAGCTGGAAGCACTTTAGAATACAACGTGATTGGATCAAGCGGAT
CTTGGGCAATTAGTGTTGGATGCCATACAGATAATTTGCCAGATTCTCTT
CCAGAATGGGCAAGGTATCCGAGTATAAACATATACAGAATACCAATTTC
TAACAAAGGTCATATTTATTCAGCATTTGGTGGTG
back to top

protein sequence of SMED30029987-orf-1

>SMED30029987-orf-1 ID=SMED30029987-orf-1|Name=SMED30029987-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=228bp
LQILNIFNVDFRNSFTSSSSVVNTEMPDSMFSEDLIGLEDLVHRMLLNHD
YLISKAPLVAGLLPIFSSSMLDNSKMPEYLITIIKKYEKLLKWICPCDVQ
KATDPNDRKLIRFLGEIMKNQVLAYSNFKAPCGDLFPGDFVASPPKVTVK
LNLIGVTPSTENPIGYYLEAGSTLEYNVIGSSGSWAISVGCHTDNLPDSL
PEWARYPSINIYRIPISNKGHIYSAFGG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR031161Peptidase_M60_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031161Peptidase family M60 domainPROSITEPS51723PEPTIDASE_M60coord: 159..228
score: 11.755