Multidrug resistance-associated protein 1

Overview
NameMultidrug resistance-associated protein 1
Smed IDSMED30029981
Length (bp)4628
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug resistance-associated protein 1 (SMED30029981) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30029981) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multidrug resistance-associated protein 1 (SMED30029981) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30029981) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029981

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029981h1SMcG0001246 SmedASXL_014731SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029981h1SMcG0001246 SmedASXL_014731SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30029981h1SMcG0001246 SmedASXL_014732SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029981h1SMcG0001246 SmedASXL_014732SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30029981h1SMcG0001246 Contig45844uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029981h1SMcG0001246 Contig45844newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029981h1SMcG0001246 Contig47549uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029981h1SMcG0001246 Contig47549newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 447/1367 (32.70%), Postives = 733/1367 (53.62%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVADVNTMNFKRKLTSTLK--------SKNNYHTKSRRPINEHSSVW----------W---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR-----SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKI---------KSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIK-----SKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  I + NPCPE  +S  SRI F W+   I   ++  ++    + ++ +     V  V   N+K++   T K        SK+    K    ++ +  V           W   L K L+  FG   ++S+     H +  FS P ILK L+KF++  + P + G+   +   +T  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G   LA + V+VLM   P+N++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  S V    W   P  V L     YV I  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + ++     + I ++N +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V+IKGS++YVPQ  WI+  S ++NI+   +  E  Y++VI+ C L  DL    + +    G   +  SGGQ+QR++LARAVY  ++IYL DDPLSA+DA V + +FE VI   G+L N TR+ VT ++++L  +D II +   G I   G    + + D    +F++            E   +       E+    N   V +    ++ + L +S       S++H      Q            +   +  +    E    +   V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP                       +      H      + +YG +G  Q I    + +  S+G   AS+ +H  +L+ +L+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  VIL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ +   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP+ G++EF+ + L+Y ED  F L +IN+ I  GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L  +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GEI E+G  S+++     ++S  K
Sbjct:  199 SETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLM--VPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMS-GGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQ-----------KAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-----------------------IVNGTQEHTKVR--LSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAK 1526          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 447/1367 (32.70%), Postives = 733/1367 (53.62%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVADVNTMNFKRKLTSTLK--------SKNNYHTKSRRPINEHSSVW----------W---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR-----SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKI---------KSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIK-----SKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  I + NPCPE  +S  SRI F W+   I   ++  ++    + ++ +     V  V   N+K++   T K        SK+    K    ++ +  V           W   L K L+  FG   ++S+     H +  FS P ILK L+KF++  + P + G+   +   +T  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G   LA + V+VLM   P+N++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  S V    W   P  V L     YV I  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + ++     + I ++N +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V+IKGS++YVPQ  WI+  S ++NI+   +  E  Y++VI+ C L  DL    + +    G   +  SGGQ+QR++LARAVY  ++IYL DDPLSA+DA V + +FE VI   G+L N TR+ VT ++++L  +D II +   G I   G    + + D    +F++            E   +       E+    N   V +    ++ + L +S       S++H      Q            +   +  +    E    +   V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP                       +      H      + +YG +G  Q I    + +  S+G   AS+ +H  +L+ +L+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  VIL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ +   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP+ G++EF+ + L+Y ED  F L +IN+ I  GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L  +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GEI E+G  S+++     ++S  K
Sbjct:  199 SETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLM--VPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMS-GGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQ-----------KAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-----------------------IVNGTQEHTKVR--LSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAK 1526          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 446/1374 (32.46%), Postives = 739/1374 (53.78%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVADVNTMNFKRKLTSTLK--------SKNNYHTKSRRPINEHSSVW----------W---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR-----SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQ----------INIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEI-----------KSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  I + NPCPE  +S  SRI F W+   I   ++  ++    + ++ +     V  V   N+K++   T K        SK+    K    ++ +  V           W   L K L+  FG   ++S+     H +  FS P ILK L+KF++  + P + G+   +   +T  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G   LA + V+VLM   P+N++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  S V    W   P  V L     YV I  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + ++     + I ++N +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V+IKGS++YVPQ  WI+  S ++NI+   +  E  Y++VI+ C L  DL    + +    G   +  SGGQ+QR++LARAVY  ++IYL DDPLSA+DA V + +FE VI   G+L N TR+ VT ++++L  +D II +   G I   G    + + D    +F++  +        +   E     N + VM+     +  +     ++K  +            +++Q    ++   + +  ++ +    K+E    E              V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP                       +      H      + +YG +G  Q I    + +  S+G   AS+ +H  +L+ +L+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  VIL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ +   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP+ G++EF+ + L+Y ED  F L +IN+ I  GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L  +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GEI E+G  S+++     ++S  K
Sbjct:   98 SETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLM--VPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMS-GGKISEMGSYQELLARDGAFAEFLRTYA--------STEQEQDAEENGSTVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-----------------------IVNGTQEHTKVR--LSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAK 1435          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 446/1374 (32.46%), Postives = 739/1374 (53.78%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVADVNTMNFKRKLTSTLK--------SKNNYHTKSRRPINEHSSVW----------W---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR-----SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQ----------INIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEI-----------KSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  I + NPCPE  +S  SRI F W+   I   ++  ++    + ++ +     V  V   N+K++   T K        SK+    K    ++ +  V           W   L K L+  FG   ++S+     H +  FS P ILK L+KF++  + P + G+   +   +T  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G   LA + V+VLM   P+N++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  S V    W   P  V L     YV I  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + ++     + I ++N +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V+IKGS++YVPQ  WI+  S ++NI+   +  E  Y++VI+ C L  DL    + +    G   +  SGGQ+QR++LARAVY  ++IYL DDPLSA+DA V + +FE VI   G+L N TR+ VT ++++L  +D II +   G I   G    + + D    +F++  +        +   E     N + VM+     +  +     ++K  +            +++Q    ++   + +  ++ +    K+E    E              V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP                       +      H      + +YG +G  Q I    + +  S+G   AS+ +H  +L+ +L+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  VIL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ +   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP+ G++EF+ + L+Y ED  F L +IN+ I  GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L  +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GEI E+G  S+++     ++S  K
Sbjct:   98 SETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLM--VPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMS-GGKISEMGSYQELLARDGAFAEFLRTYA--------STEQEQDAEENGSTVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-----------------------IVNGTQEHTKVR--LSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAK 1435          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 416/1238 (33.60%), Postives = 686/1238 (55.41%), Query Frame = 2
Query:  893 HIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR-----SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQ----------INIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEI-----------KSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            H +  FS P ILK L+KF++  + P + G+   +   +T  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G   LA + V+VLM   P+N++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  S V    W   P  V L     YV I  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + ++     + I ++N +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V+IKGS++YVPQ  WI+  S ++NI+   +  E  Y++VI+ C L  DL    + +    G   +  SGGQ+QR++LARAVY  ++IYL DDPLSA+DA V + +FE VI   G+L N TR+ VT ++++L  +D II +   G I   G    + + D    +F++  +        +   E     N + VM+     +  +     ++K  +            +++Q    ++   + +  ++ +    K+E    E              V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP                       +      H      + +YG +G  Q I    + +  S+G   AS+ +H  +L+ +L+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  VIL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ +   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP+ G++EF+ + L+Y ED  F L +IN+ I  GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L  +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GEI E+G  S+++     ++S  K
Sbjct:    9 HDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLM--VPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMS-GGKISEMGSYQELLARDGAFAEFLRTYA--------STEQEQDAEENGSTVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-----------------------IVNGTQEHTKVR--LSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAK 1210          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 428/1349 (31.73%), Postives = 718/1349 (53.22%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTL---KSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFP-NYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRV-SLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEP-ILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISN-NGILANTTRLFVTQNINFLNYLDKIIFLDE---------------NGS------------IKYYGDVSNISNDAIDFMK-IKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINI--RKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML-IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNK--LTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
              N CPE  +S  +++ F W     Y   +  ++ E  +D++ +  A+    +F   L   +   + K   + ++  P N H S+      +F  +   L+   C  +   +  F  P +L+ L+ FI     P++ G ++A+   ++ +L S+  +  FH      + +RS + SAVY+K++N++NEA+   T   I+NLMS D  +I     +  +  S+P +I+L   FL+  +G     G ++L+   P NS     +++ Q E+M++KD+RIK M+E+LN MKV+KLYSWE    K++   REKE+ +++ +S  +    + W   P  V +     YV   P N V+T + TFV++ L N+LR P+AV     + A+    S  R+   F  E  +     +     S I++  GSF+W S  E   L  I  +I +G+LV IVG++ SGK+SLL+A++GEM  L G+V + GS++YVPQ  WI+ +S ++NI+ ++ Y    Y+NVI  C L  DL +  A++    G   +  SGGQ+QR++LARAVYQ +EI LLDDPLSA+D+ V + +FE VIS   G L   TR+ +T  + +L + D++I L +               NG+             K+ G   +   D+ +  + ++     S    +  +S  +       ++N+  I   LH   ++ +  I     K+ L+   S   K     +       E    E   V ++ Y  YF A G          +   ++L V S+ +L + + D                        +  S +  ++     L IY ++G GQ    C   +  +LG   AS+ +H  +L  +++S + +F  +   +ILN F KDI+ ID  +P+++  ++  IF V+++ FVI+   P   +  + +G +YF++L+FY+ ++ Q + L   S SPI+  F E++QG   IRA      F  E    +++N    Y   V N WL++RL+ +GN++V  S   A+ +R+   L+  LVGL++SY+++I   LNW +    +LETN +A+ER++ +    +E N+ + L  P S WP  G+I  K F+++Y       L+ +   I   EKIGIVGRTG+GK+SL  +LF+++E  GG + ID  +I D+ +  +R  +T+ PQ+  +FSGT+R N+DPF    D  + +AL  +HL  +++S+   LH    + G +LSVGQRQL+CLAR +LR +K++VLDEA A+VD ETD L+ +TI+ +F + T+L IAHR + + D D+++V+D+G + EF    ++++NP+G F
Sbjct:  203 GKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKKNPEAAIPKN-HPSILI---PIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAK---------------------EIALSGNGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIEAIDQTLPHSIRAMVMTIFNVISTVFVIIWATPWAGIGFLVLGFVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSL-APKS-WPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIF 1524          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-2 (pep chromosome:WBcel235:X:563719:572701:-1 gene:WBGene00003408.1 transcript:F57C12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-2)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 430/1357 (31.69%), Postives = 713/1357 (52.54%), Query Frame = 2
Query:  572 ENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRR------PINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFP-NYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRV-SLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNN-GILANTTRLFVTQNINFLNYLDKIIFLDEN---------------------------------GSIKYYGDVSNISNDAI-DFMKIKSE--KSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNK--LTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
            ++ + CPE  +S  +R+ F W     Y   +  +++E  +D++    A+    +F + L   +   + YH   ++      P N  S V      +F  +   L+  +   +   +  F  P +LK L+ FI     P++ G ++      +  L S+  +  +H      + VRS + SAVYSK++N++NEA+   T   I+NLMS D  KI        +  S+P +I L   FL+  +G  A  G++VL+   P+N +    ++  QTE+M+ KD+RIK M+E+LN MKV+KLYSWE     ++ + RE+E+++++ +S     +   W   P    +     YV + P N V+T E TFV++ L ++LR P+A++      A+   VS  R+   F  E  +     S  +  S IE++NG FSW SD +P L+ I+  I KG+LV IVGK+ SGK+SLL+A++GEM  L G+V I G+++YVPQ  WI+ +S ++NI+ +K Y   +Y++V++ C L  DL    A +    G   +  SGGQ+QR++LARAVYQ  +I LLDDPLSA+D+ V + +FE VIS++ G LA+ TR+ VT  + +L + D++I L E                                  G +   GD S   ++ + D  ++K    K      ++ ++   TS      +R+S R   +LH+           R Q           +       +    E    E   V ++ Y  YF A          F +   + L +LS+++L KL+                         H        + A   + IY ++G GQ        +  ++G   AS+ +H  +L  +++S + +F  +   +ILN   KDI+ ID  +P+ +  +   IF V+A+  VI+   P   +    + ++YFI+L+FY+ ++ Q + L   S SPI+  F E++QG   IRA     +F  +  + ++D+    Y   V N WL++RL+ +GN++V  +   A+ +R+   L+  LVGL++SY+++I   LNW +    +LETN +++ER+  +    +E N+   L      WP  G+I  K F+++Y       L+ I+  I   EK+GIVGRTG+GK+SL  +LF+++E  GGS+ ID I+I ++ +  +R  +T+ PQ+  +FSGT++ N+DPF+   D  + +AL  +HL P+++S+   L     + G +LSVGQRQL+CLAR +LR +K++VLDEA A+VD ETD LI +TI+ +F   T+L IAHR + + D D+++V+D+G + EF     ++ NP+G F
Sbjct:  202 KSESSCPEYTASFINRLTFQWFTGLAYLGNKKSLENEDLWDLNEIDKAENLIPSFMQNLKPRI---DEYHQNIKKDPSAALPKNHPSFVI----PIFKTYKYTLLAGFFYKLCFDMLQFLAPQLLKQLIGFIEDKNQPVWIGCSIVGIMFFSSFLQSMFLHQYYHSMFRLGMHVRSVLTSAVYSKALNLSNEARKGKTIGAIVNLMSVDIQKIQDMAPTIMLFWSAPLQIFLSIYFLWKFLGVAALAGLVVLILALPVNGLIAIQMRKCQTEQMKLKDERIKMMSEILNGMKVLKLYSWERSMENMVLKIRERELHILKKLSYFMAAIVFSWICAPFLASVISFVVYVYLDPENNVLTPEITFVALSLFDILRMPLAMVAMVYGEAVQCSVSNTRLKEFFAAEEMSPQTSISHGETDSAIEVENGLFSWSSDEDPTLREISFKIQKGQLVAIVGKVGSGKSSLLHALLGEMNKLSGSVQINGNIAYVPQQAWIQNMSLRNNILFNKPYDLENYEDVVKNCALKEDLANLPAGDRTEIGEKGINLSGGQKQRVSLARAVYQNPDIILLDDPLSAVDSHVGKHIFENVISSSTGCLASKTRVLVTHGLTYLKHCDQLIVLKEGTISELGTYQELLNNSGAFAEFLEEFLIEESKTRGRVASIGDGSGEVDEILRDLGQVKPGILKRLESHLSQESDKEDTSARAIEYSRDSSRRSVLLHSP----------RSQHEENEALLGAISEDVPAQENTQLIEKETVETGKVKFEVYIAYFQAISIPITLLFFFLYVGSSGLGILSNFYLAKLSD------------------------HAKSGNRTSSDAKMELGIYAVLGMGQSFVVLIASIILTIGVLRASRILHAGLLGNIMRSPMAFFDVTPIGRILNRIGKDIEAIDRTLPDVIRHMSMTIFNVVATLVVIMWATPWAGIAFAILSVIYFIVLRFYISTSRQLKRLESASRSPIYSHFQESIQGASSIRAFGVVDNFIKQSQQRVDDHLIAYYPSIVANRWLAVRLEMVGNLIVLSAAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVSVERIKEYTVTPTEGNNSRRL--AAKSWPEKGEISIKNFSVRYRPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFRIIEADGGSIEIDGINIANLQLEQLRSCLTIVPQDPVLFSGTMKMNLDPFSAYSDSQVWEALENAHLKPFVKSLQDGLEHKISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLIQKTIREQFKECTVLTIAHRLNTVMDSDRLLVLDKGRVAEFDSPKNLLANPDGIF 1515          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 428/1349 (31.73%), Postives = 715/1349 (53.00%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTL---KSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFP-NYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRV-SLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEP-ILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISN-NGILANTTRLFVTQNINFLNYLDKIIFLDE---------------NGS------------IKYYGDVSNISNDAIDFMK-IKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINI--RKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML-IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNK--LTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
              N CPE  +S  +++ F W     Y   +  ++ E  +D++ +  A+    +F   L   +   + K   + ++  P N H S+      +F  +   L+   C  +   +  F  P +L+ L+ FI     P++ G ++A+   ++ +L S+  +  FH      + +RS + SAVY+K++N++NEA+   T   I+NLMS D  +I     +  +  S+P +I+L   FL+  +G     G ++L+   P NS     +++ Q E+M++KD+RIK M+E+LN MKV+KLYSWE    K++   REKE+ +++ +S  +    + W   P  V +     YV   P N V+T + TFV++ L N+LR P+AV     + A+    S  R+   F  E  +     +     S I++  GSF+W S  E   L  I  +I +G+LV IVG++ SGK+SLL+A++GEM  L G+V + GS++YVPQ  WI+ +S ++NI+ ++ Y    Y+NVI  C L  DL +  A++    G   +  SGGQ+QR++LARAVYQ +EI LLDDPLSA+D+ V + +FE VIS   G L   TR+ +T  + +L + D++I L +               NG+             K+ G   +   D+ +  + ++     S    +  +S  +       ++N+  I   LH   ++ +  I     K+ L+   S   K     +       E    E   V ++ Y  YF A G          +   ++L V S+ +L + + D                        +  S +  ++     L IY ++G GQ    C   +  +LG   AS+ +H  +L  +++S + +F  +   +ILN F KD+D +D+ IP  +S  I      +    +IL   PL + L++P+ ++YF++L+FY+ ++ Q + L   S SPI+  F E++QG   IRA      F  E    +++N    Y   V N WL++RL+ +GN++V  S   A+ +R+   L+  LVGL++SY+++I   LNW +    +LETN +A+ER++ +    +E N+ + L  P S WP  G+I  K F+++Y       L+ +   I   EKIGIVGRTG+GK+SL  +LF+++E  GG + ID  +I D+ +  +R  +T+ PQ+  +FSGT+R N+DPF    D  + +AL  +HL  +++S+   LH    + G +LSVGQRQL+CLAR +LR +K++VLDEA A+VD ETD L+ +TI+ +F + T+L IAHR + + D D+++V+D+G + EF    ++++NP+G F
Sbjct:  203 GKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKKNPEAAIPKN-HPSILI---PIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAK---------------------EIALSGNGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDVDGVDTDIPRTMSMFIRTAVSSIEIIAIILWATPLAISLLLPLFIVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSL-APKS-WPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIF 1524          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 427/1349 (31.65%), Postives = 711/1349 (52.71%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTL---KSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFP-NYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRV-SLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEP-ILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISN-NGILANTTRLFVTQNINFLNYLDKIIFLDE---------------NGS------------IKYYGDVSNISNDAIDFMK-IKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINI--RKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML-IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNK--LTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
              N CPE  +S  +++ F W     Y   +  ++ E  +D++ +  A+    +F   L   +   + K   + ++  P N H S+      +F  +   L+   C  +   +  F  P +L+ L+ FI     P++ G ++A+   ++ +L S+  +  FH      + +RS + SAVY+K++N++NEA+   T   I+NLMS D  +I     +  +  S+P +I+L   FL+  +G     G ++L+   P NS     +++ Q E+M++KD+RIK M+E+LN MKV+KLYSWE    K++   REKE+ +++ +S  +    + W   P  V +     YV   P N V+T + TFV++ L N+LR P+AV     + A+    S  R+   F  E  +     +     S I++  GSF+W S  E   L  I  +I +G+LV IVG++ SGK+SLL+A++GEM  L G+V + GS++YVPQ  WI+ +S ++NI+ ++ Y    Y+NVI  C L  DL +  A++    G   +  SGGQ+QR++LARAVYQ +EI LLDDPLSA+D+ V + +FE VIS   G L   TR+ +T  + +L + D++I L +               NG+             K+ G   +   D+ +  + ++     S    +  +S  +       ++N+  I   LH   ++ +  I     K+ L+   S   K     +       E    E   V ++ Y  YF A G          +   ++L V S+ +L + + D                        +  S +  ++     L IY ++G GQ    C   +  +LG   AS+ +H  +L  +++S + +F  +   +ILN F KDID ID  +P+ +   +  I Q +  F V ++  PL    I  + + Y+ +L+FY+ ++ Q + L   S SPI+  F E++QG   IRA      F  E    +++N    Y   V N WL++RL+ +GN++V  S   A+ +R+   L+  LVGL++SY+++I   LNW +    +LETN +A+ER++ +    +E N+ + L  P S WP  G+I  K F+++Y       L+ +   I   EKIGIVGRTG+GK+SL  +LF+++E  GG + ID  +I D+ +  +R  +T+ PQ+  +FSGT+R N+DPF    D  + +AL  +HL  +++S+   LH    + G +LSVGQRQL+CLAR +LR +K++VLDEA A+VD ETD L+ +TI+ +F + T+L IAHR + + D D+++V+D+G + EF    ++++NP+G F
Sbjct:  203 GKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKKNPEAAIPKN-HPSILI---PIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAK---------------------EIALSGNGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIDVIDYRLPSCIMTFVGAIVQAVTIFAVPIYATPLSSFPITIVLIGYYFLLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSL-APKS-WPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIF 1524          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 427/1357 (31.47%), Postives = 711/1357 (52.39%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTL---KSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFP-NYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRV-SLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEP-ILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISN-NGILANTTRLFVTQNINFLNYLDKIIFLDE---------------NGS------------IKYYGDVSNISNDAIDFMK-IKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINI--RKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML-IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNL-------SEVINC-IFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNK--LTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
              N CPE  +S  +++ F W     Y   +  ++ E  +D++ +  A+    +F   L   +   + K   + ++  P N H S+      +F  +   L+   C  +   +  F  P +L+ L+ FI     P++ G ++A+   ++ +L S+  +  FH      + +RS + SAVY+K++N++NEA+   T   I+NLMS D  +I     +  +  S+P +I+L   FL+  +G     G ++L+   P NS     +++ Q E+M++KD+RIK M+E+LN MKV+KLYSWE    K++   REKE+ +++ +S  +    + W   P  V +     YV   P N V+T + TFV++ L N+LR P+AV     + A+    S  R+   F  E  +     +     S I++  GSF+W S  E   L  I  +I +G+LV IVG++ SGK+SLL+A++GEM  L G+V + GS++YVPQ  WI+ +S ++NI+ ++ Y    Y+NVI  C L  DL +  A++    G   +  SGGQ+QR++LARAVYQ +EI LLDDPLSA+D+ V + +FE VIS   G L   TR+ +T  + +L + D++I L +               NG+             K+ G   +   D+ +  + ++     S    +  +S  +       ++N+  I   LH   ++ +  I     K+ L+   S   K     +       E    E   V ++ Y  YF A G          +   ++L V S+ +L + + D                        +  S +  ++     L IY ++G GQ    C   +  +LG   AS+ +H  +L  +++S + +F  +   +ILN F KD+D +D  +P+N+       SE++ C +F   A+ F I     + +          F IL+FY+ ++ Q + L   S SPI+  F E++QG   IRA      F  E    +++N    Y   V N WL++RL+ +GN++V  S   A+ +R+   L+  LVGL++SY+++I   LNW +    +LETN +A+ER++ +    +E N+ + L  P S WP  G+I  K F+++Y       L+ +   I   EKIGIVGRTG+GK+SL  +LF+++E  GG + ID  +I D+ +  +R  +T+ PQ+  +FSGT+R N+DPF    D  + +AL  +HL  +++S+   LH    + G +LSVGQRQL+CLAR +LR +K++VLDEA A+VD ETD L+ +TI+ +F + T+L IAHR + + D D+++V+D+G + EF    ++++NP+G F
Sbjct:  203 GKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKKNPEAAIPKN-HPSILI---PIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAK---------------------EIALSGNGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDMDVVDERLPDNIGDFLLTFSELVACVVFTSYATPFAIFPIVLIAIGC--------FAILRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSL-APKS-WPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIF 1524          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090025)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 426/1369 (31.12%), Postives = 706/1369 (51.57%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ--C--VADVNTMNFKRKLTSTLKSKNNYHTKSR---------RPINEHSS----VWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPET-PLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL-IENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLN-----YLDKIIFLDENGS-----------------------------------IKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
              N  PE  +S  SRI + W D+     ++N ++ +  +D+  Q  C  V  +   ++ + +    K+K     K++          P  E +     +  +   ++  FG   +      +F    +F++P +L  ++ F+ A +  P + G   A+   +     +      FH      L++R+A+ +A+Y K++ I+N  K   T  EI+NLM+ D  + +    Y  ++ S+P +I L   FL+ ++G     G+ V++   P+N +  S ++ YQ  +M++KD+R+K M EVL+ +KV+KLY+WE  F K +   R+KE+  +R  +  +   + +W   P  V L    TYV I  N V+ A  TFVS+ L N+LR P+ +LP  IT  +   VS+ R++ FL  E    N           + I+NG FSW    E  L+ INI + KG LV +VG + SGK+S++ A +GEM  L G V+  G ++YVPQ  WI+  + +DNI+  + Y    Y  VI  C L  D+    A +L   G   +  SGGQ+QRI+LARAVY  +++YLLDDPLSA+DA V + +FE+VI   GILA  +R+ VT  + FL      Y+ K+  + E+G+                                   I    DV  +       +K+   +S SD  +       TS ++ +    S R       S  S     +++K+                + +     E   ++   V +  Y  Y  + G      ++    +    Q+ S+ WL +  +D N+                          +     + Y+ +YG  GFGQ   + F  L  +LG+ +A+K +H  +L  VL++ +  F  +   +IL+ FSKD++++D  +P  +++ I C F+V+A+  VI  + P+FL +IVPI  LY+   +FY+ ++ Q   L   S SPI+  F+ET+ G   IRA      F  E    ++ N    Y   + N WL++RL+ +GN+++  + + A+    +  P LVGL++SY++ +   LNW++    D+ETN +++ER+  +   + E   + E   +    WP+ G++EF+ F ++Y E     L  ++  I+ GEK+GIVGRTG+GK+SL  +LF+++E  GG + ID +DI  + +  +R  +T+ PQ+  +FSG++R N+DPF    D  + +AL LSHL  +++S+   L+ +  + G +LSVGQRQL+CLAR +LR +K++VLDEATA+VD ETD LI +TI+  F   T+L IAHR + + D DK+IV+D+G+IIEF   +E+++NP   F
Sbjct:  220 GENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSW--GDEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSIS------VTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKK----------------QEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNV-------------------------ANDTGLRDMYLGVYGAFGFGQGFTSFFSDLAPALGSLHAAKVLHSMLLENVLRAPMTMFDTTPVGRILSRFSKDVESVDQKMPQVINDCIWCAFEVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL-GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAF 1538          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090026)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 427/1370 (31.17%), Postives = 704/1370 (51.39%), Query Frame = 2
Query:  572 ENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ--C--VADVNTMNFKRKLTSTLKSKNNYHTKSR---------RPINEHSS----VWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPET-PLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL-IENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLN-----YLDKIIFLDENGS-----------------------------------IKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
               N  PE  +S  SRI + W D+     ++N ++ +  +D+  Q  C  V  +   ++ + +    K+K     K++          P  E +     +  +   ++  FG   +      +F    +F++P +L  ++ F+ A +  P + G   A+   +     +      FH      L++R+A+ +A+Y K++ I+N  K   T  EI+NLM+ D  + +    Y  ++ S+P +I L   FL+ ++G     G+ V++   P+N +  S ++ YQ  +M++KD+R+K M EVL+ +KV+KLY+WE  F K +   R+KE+  +R  +  +   + +W   P  V L    TYV I  N V+ A  TFVS+ L N+LR P+ +LP  IT  +   VS+ R++ FL  E    N           + I+NG FSW    E  L+ INI + KG LV +VG + SGK+S++ A +GEM  L G V+  G ++YVPQ  WI+  + +DNI+  + Y    Y  VI  C L  D+    A +L   G   +  SGGQ+QRI+LARAVY  +++YLLDDPLSA+DA V + +FE+VI   GILA  +R+ VT  + FL      Y+ K+  + E+G+                                   I    DV  +       +K+   +S SD  +       TS ++ +    S R       S  S     +++K+                + +     E   ++   V +  Y  Y  + G      ++    +    Q+ S+ WL +  +D N+                          +     + Y+ +YG  GFGQ++      L  SLG   +++ +H+ +L+  L+  ++ F  +   +I+N FSKD+D ID+ +P NL  VI  +F V+A+  VI  + P+FL +IVPI  LY+   +FY+ ++ Q   L   S SPI+  F+ET+ G   IRA      F  E    ++ N    Y   + N WL++RL+ +GN+++  + + A+    +  P LVGL++SY++ +   LNW++    D+ETN +++ER+  +   + E   + E   +    WP+ G++EF+ F ++Y E     L  ++  I+ GEK+GIVGRTG+GK+SL  +LF+++E  GG + ID +DI  + +  +R  +T+ PQ+  +FSG++R N+DPF    D  + +AL LSHL  +++S+   L+ +  + G +LSVGQRQL+CLAR +LR +K++VLDEATA+VD ETD LI +TI+  F   T+L IAHR + + D DK+IV+D+G+IIEF   +E+++NP   F
Sbjct:  219 RGENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSW--GDEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSIS------VTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKK----------------QEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNV-------------------------ANDTGLRDMYLGVYGAFGFGQVVTGYLSTLILSLGCVYSARYMHNVLLHGTLRWPMEMFDITPLGRIVNRFSKDVDTIDNTLPLNLRVVILQLFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL-GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAF 1538          

HSP 2 Score: 67.781 bits (164), Expect = 8.441e-11
Identity = 62/260 (23.85%), Postives = 122/260 (46.92%), Query Frame = 2
Query: 1754 ENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRMLCSG------GQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSE 2476
            +NK KN+    Q+ R  +E +N    +R   + +L+ ++ +I  GE VGIVG+  +GK+SL  A+   +    G +SI G              ++ +PQ+P +   S + N+   +   +++    + +  L   +++  A    G++  +  G      GQRQ + LARA+ +K+++ +LD+  +A+D +    + +K I         T L +   +N +   DK+I LD+   I++      + N    F  +  +
Sbjct: 1297 KNKPKNW---PQEGR--VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAA----GLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVD-LETDDLIQKTIRTE--FKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKD 1544          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090023)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 427/1370 (31.17%), Postives = 703/1370 (51.31%), Query Frame = 2
Query:  572 ENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ--C--VADVNTMNFKRKLTSTLKSKNNYHTKSR---------RPINEHSS----VWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPET-PLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL-IENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLN-----YLDKIIFLDENGS-----------------------------------IKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
               N  PE  +S  SRI + W D+     ++N ++ +  +D+  Q  C  V  +   ++ + +    K+K     K++          P  E +     +  +   ++  FG   +      +F    +F++P +L  ++ F+ A +  P + G   A+   +     +      FH      L++R+A+ +A+Y K++ I+N  K   T  EI+NLM+ D  + +    Y  ++ S+P +I L   FL+ ++G     G+ V++   P+N +  S ++ YQ  +M++KD+R+K M EVL+ +KV+KLY+WE  F K +   R+KE+  +R  +  +   + +W   P  V L    TYV I  N V+ A  TFVS+ L N+LR P+ +LP  IT  +   VS+ R++ FL  E    N           + I+NG FSW    E  L+ INI + KG LV +VG + SGK+S++ A +GEM  L G V+  G ++YVPQ  WI+  + +DNI+  + Y    Y  VI  C L  D+    A +L   G   +  SGGQ+QRI+LARAVY  +++YLLDDPLSA+DA V + +FE+VI   GILA  +R+ VT  + FL      Y+ K+  + E+G+                                   I    DV  +       +K+   +S SD  +       TS ++ +    S R       S  S     +++K+                + +     E   ++   V +  Y  Y  + G      ++    +    Q+ S+ WL +  +D N+                          +     + Y+ +YG  GFGQ+    F  LT +LG    SK +H+ +L+ V +  ++ F  +   +++N FSKD+D ID+++P     VI+  F V+A+  VI  + P+FL +IVPI  LY+   +FY+ ++ Q   L   S SPI+  F+ET+ G   IRA      F  E    ++ N    Y   + N WL++RL+ +GN+++  + + A+    +  P LVGL++SY++ +   LNW++    D+ETN +++ER+  +   + E   + E   +    WP+ G++EF+ F ++Y E     L  ++  I+ GEK+GIVGRTG+GK+SL  +LF+++E  GG + ID +DI  + +  +R  +T+ PQ+  +FSG++R N+DPF    D  + +AL LSHL  +++S+   L+ +  + G +LSVGQRQL+CLAR +LR +K++VLDEATA+VD ETD LI +TI+  F   T+L IAHR + + D DK+IV+D+G+IIEF   +E+++NP   F
Sbjct:  219 RGENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSW--GDEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSIS------VTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKK----------------QEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVA-------------------------NDTGLRDMYLGVYGAFGFGQVTSYFFCSLTLALGCIFCSKVLHETLLSYVFRWPMELFDTTPLGRVVNRFSKDVDTIDNVLPMLWRMVISQAFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL-GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAF 1538          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090022)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 428/1370 (31.24%), Postives = 701/1370 (51.17%), Query Frame = 2
Query:  572 ENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ--C--VADVNTMNFKRKLTSTLKSKNNYHTKSR---------RPINEHSS----VWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPET-PLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL-IENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLN-----YLDKIIFLDENGS-----------------------------------IKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
               N  PE  +S  SRI + W D+     ++N ++ +  +D+  Q  C  V  +   ++ + +    K+K     K++          P  E +     +  +   ++  FG   +      +F    +F++P +L  ++ F+ A +  P + G   A+   +     +      FH      L++R+A+ +A+Y K++ I+N  K   T  EI+NLM+ D  + +    Y  ++ S+P +I L   FL+ ++G     G+ V++   P+N +  S ++ YQ  +M++KD+R+K M EVL+ +KV+KLY+WE  F K +   R+KE+  +R  +  +   + +W   P  V L    TYV I  N V+ A  TFVS+ L N+LR P+ +LP  IT  +   VS+ R++ FL  E    N           + I+NG FSW    E  L+ INI + KG LV +VG + SGK+S++ A +GEM  L G V+  G ++YVPQ  WI+  + +DNI+  + Y    Y  VI  C L  D+    A +L   G   +  SGGQ+QRI+LARAVY  +++YLLDDPLSA+DA V + +FE+VI   GILA  +R+ VT  + FL      Y+ K+  + E+G+                                   I    DV  +       +K+   +S SD  +       TS ++ +    S R       S  S     +++K+                + +     E   ++   V +  Y  Y  + G      ++    +    Q+ S+ WL +  +D N+                          +     + Y+ +YG  GFGQ+    F  L  SLG    S+ +H  +L   L+  ++ F  +   +I+N FSKDID ID+++P N+  VI   + V+A+  VI  + P+FL +IVPI  LY+   +FY+ ++ Q   L   S SPI+  F+ET+ G   IRA      F  E    ++ N    Y   + N WL++RL+ +GN+++  + + A+    +  P LVGL++SY++ +   LNW++    D+ETN +++ER+  +   + E   + E   +    WP+ G++EF+ F ++Y E     L  ++  I+ GEK+GIVGRTG+GK+SL  +LF+++E  GG + ID +DI  + +  +R  +T+ PQ+  +FSG++R N+DPF    D  + +AL LSHL  +++S+   L+ +  + G +LSVGQRQL+CLAR +LR +K++VLDEATA+VD ETD LI +TI+  F   T+L IAHR + + D DK+IV+D+G+IIEF   +E+++NP   F
Sbjct:  219 RGENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSW--GDEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSIS------VTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKK----------------QEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVA-------------------------NDTGLRDMYLGVYGAFGFGQVATNFFSSLAISLGCLKCSQLLHQTLLYYNLRWPMELFDTTPLGRIVNRFSKDIDTIDNVLPFNIRVVIGQAYMVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL-GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAF 1538          

HSP 2 Score: 67.781 bits (164), Expect = 1.034e-10
Identity = 62/260 (23.85%), Postives = 122/260 (46.92%), Query Frame = 2
Query: 1754 ENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRMLCSG------GQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSE 2476
            +NK KN+    Q+ R  +E +N    +R   + +L+ ++ +I  GE VGIVG+  +GK+SL  A+   +    G +SI G              ++ +PQ+P +   S + N+   +   +++    + +  L   +++  A    G++  +  G      GQRQ + LARA+ +K+++ +LD+  +A+D +    + +K I         T L +   +N +   DK+I LD+   I++      + N    F  +  +
Sbjct: 1297 KNKPKNW---PQEGR--VEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAA----GLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVD-LETDDLIQKTIRTE--FKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKD 1544          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090021)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 424/1370 (30.95%), Postives = 699/1370 (51.02%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ--C--VADVNTMNFKRKLTSTLKSKNNYHTKSR---------RPINEHSS----VWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPET-PLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL-IENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLN-----YLDKIIFLDENGS-----------------------------------IKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS--SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
              N  PE  +S  SRI + W D+     ++N ++ +  +D+  Q  C  V  +   ++ + +    K+K     K++          P  E +     +  +   ++  FG   +      +F    +F++P +L  ++ F+ A +  P + G   A+   +     +      FH      L++R+A+ +A+Y K++ I+N  K   T  EI+NLM+ D  + +    Y  ++ S+P +I L   FL+ ++G     G+ V++   P+N +  S ++ YQ  +M++KD+R+K M EVL+ +KV+KLY+WE  F K +   R+KE+  +R  +  +   + +W   P  V L    TYV I  N V+ A  TFVS+ L N+LR P+ +LP  IT  +   VS+ R++ FL  E    N           + I+NG FSW    E  L+ INI + KG LV +VG + SGK+S++ A +GEM  L G V+  G ++YVPQ  WI+  + +DNI+  + Y    Y  VI  C L  D+    A +L   G   +  SGGQ+QRI+LARAVY  +++YLLDDPLSA+DA V + +FE+VI   GILA  +R+ VT  + FL      Y+ K+  + E+G+                                   I    DV  +       +K+   +S SD  +       TS ++ +    S R       S  S     +++K+                + +     E   ++   V +  Y  Y  + G      ++    +    Q+ S+ WL +  +D N+                          +     + Y+ +YG  GFGQ + A F  +   LG   A+K IH+ +L  +++  +  F   +   ++LN FS D+D +D  +P  +   +  IF V+A+  VI  + P+FL +IVPI  LY+   +FY+ ++ Q   L   S SPI+  F+ET+ G   IRA      F  E    ++ N    Y   + N WL++RL+ +GN+++  + + A+    +  P LVGL++SY++ +   LNW++    D+ETN +++ER+  +   + E   + E   +    WP+ G++EF+ F ++Y E     L  ++  I+ GEK+GIVGRTG+GK+SL  +LF+++E  GG + ID +DI  + +  +R  +T+ PQ+  +FSG++R N+DPF    D  + +AL LSHL  +++S+   L+ +  + G +LSVGQRQL+CLAR +LR +K++VLDEATA+VD ETD LI +TI+  F   T+L IAHR + + D DK+IV+D+G+IIEF   +E+++NP   F
Sbjct:  220 GENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSW--GDEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSIS------VTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKK----------------QEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVA-------------------------NDTGLRDMYLGVYGAFGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCRFFDITPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL-GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAF 1539          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 456/1364 (33.43%), Postives = 733/1364 (53.74%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVA-----------DVNTMNFKRKLTSTL---KSKNNYHTKSRRPINEHSSVWWLTKAL------------FHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFG-FTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLI------ENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKI----------KSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARG-SLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            + V++++NPCPE  +S  S+I F W+   +   ++  ++ +  + ++ +  +           D   +  KR +  TL   K       K  +P+ E   +  L KAL               FG   ++S    + H +  F  P IL+ L+ F++    P + G F  A+ F+ T + + I Q   FH+   T +++R+AI  AVY K++ I N A+ T T  EI+NLMS D  + +  I Y  ++ S+P ++IL   FL+  +G+  LA + V+VLM   PLN++     + YQ  +M+ KD RIK M EVLN +KV+KLY+WE  F   +S  RE E+ +++ ++    +    W   P  V L+    YV +  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VS++R+ +FL       +N  +   S   D    I I +G+FSW  D  P LKRIN+SI +G LV +VG + SGK+SLL+A++GEM   +G+VSIKGS++YVPQ  WI+  + KDNI+  ++  ++ Y+ V+  C L  DL      +    G   +  SGGQ+QR+++ARAVY    +YLLDDPLSA+DA V + +FEKVI   G+L   TR+ VT  ++FL   D I+ +  +G I   G  + +      F +           + E+S  D           +     + R S      L+A+   K  Q            ++    +    + +   +E        V    +++Y  A G  L +F SIF F    +  + S+YWL   T DP +                          +        + +YG +G  Q I    + ++ S+G   AS+ +H  ML  VL+S + +F ++ S  ++N F+K+ D IDS+IP+ +   +  +F V+ S  VIL   PL  ++I P+GLLYF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA  +++ F  E    ++ N K  +   V N WL++RL+F+GN +V  + + A+  RN L+P ++GL+ISY++ +   LNW++    +LETN +A+ER+  +   E E   K    +    WP  G IE  KF L+Y ED +  + +I++ I  GEK+GIVGRTG+GK+SL   LF+++E   G + ID ++I D+ + ++R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++  +   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  +++V+D+G++ EF   S +I     ++   K
Sbjct:  199 SEVVKDSNPCPESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKRPVDKTLYSPKRSTRGEKKDGQPVEESEIL--LAKALQKTGEPSLFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAPTWHGYFYTALLFVCTCLQTLILQKY-FHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLM--VPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFLSHEELDDDNVERPAISGTPD---SIRIADGAFSWSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVM-VDGEITEMGSYTELLGRQGAFAEFLRTYTNTEQEEGEESLGDAVPRKG---LENGGPAALLRQS---QISLNATGAGKTTQ--------KTEANDDAAATKTKSAEASRLTEADKANTGRVKLSVFWEYMKAIGLPLSIF-SIFLFFCHHLSSLGSNYWLSLWTDDPVV-------------------------NNTQPKREMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNNLSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKEAEWKLENSNLPPGWPTAGHIEIHKFGLRYREDLELAICDISVNIAGGEKVGIVGRTGAGKSSLTLGLFRIIEAAEGEIRIDGVNIADLGLHELRSRITIIPQDPVLFSGSLRMNLDPFDGYTDEEVWRSLELAHLKTFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAKKGIFYKMAK 1513          

HSP 2 Score: 86.2705 bits (212), Expect = 2.544e-16
Identity = 71/274 (25.91%), Postives = 127/274 (46.35%), Query Frame = 2
Query: 3698 SMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLY 4510
            S++++RL  F + E E +D        S  P   +I    F+  + +D    L  IN+ I  G  + +VG  GSGK+SL+ +L   +    GS+              ++ ++   PQ++ I + T++ NI      +D   ++ +    L P LE + G    + G+ G +LS GQ+Q + +AR +  N  + +LD+  ++VD    + I E +   +      T +++ H  S L   D I+VM  GEI E G  +E++     +    + Y
Sbjct:  609 SVSMQRLRVFLSHE-ELDDDNVERPAISGTPDSIRIADGAFS--WSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSV-------------SIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVMVDGEITEMGSYTELLGRQGAFAEFLRTY 866          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 431/1386 (31.10%), Postives = 719/1386 (51.88%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSE-------------------STFDVHYQCVADVNTMNFKRKLTSTLK---SKNNY---------------HTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENK--TKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSD---------------------PFAEHTESIFTSNNNCVMN---RNSCRIHKILHASIK-----SKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +S + + N CPE  +   SR+ F W  R     +++ ++++                   + ++V        +  N K ++T T     +++N+                 KSR+P    S +W    AL   FG   +I     +   + +F  P +L+ L+ F    + P ++G+ LA     T +L ++  +  F     T +++R+ I  A+Y K++ I NEAK + T  E++NLMS D  + +    +  ++ S+P +I L   FL+  +G     GV V++   P N+      + YQ E+M++KD RIK M E+LN +KV+KLY+WE  F   I + R+KE++++R  +  S +  + W + P  V LT    +VN+    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+  FL  ++   ++           + + NG FSW    + IL  IN+ + +G L+ +VG +  GKTSL++A++GEM  LDG +SI+GS++YVPQ  WI+  + +DNI+  + Y+E  Y+ V+  C L  DL      +L   G   +  SGGQRQR++LARA+Y ++++YLLDDPLSA+DA VA+ +F+ VI   G L   TR+ VT  I+FL  ++ I+ L  +G +   G   ++      F +     S  D                       + HT+ +   +N  V+N   R   R   I+   ++     S+  + + RK             +       +   +   TE   V  + Y++Y  A G L      F +G  +   + +++WL + T+D                                      + +Y  +G  Q I   F   T +LG   A++ +H  +L    ++   +F  + + +I+N FSKDI  +D ++P+ L   +   F  +++  VI+ + P+F  +I P+ L+YF + +FY+ ++ Q + L   S SPI+  F+E++ G  VIRA  +   F       +++N K  Y   V N WL +R++F+GN +V  + + A+  ++KL+P LVGL++SY++ +   LNWM+    DLE+N +A+ER+  ++  ++E   +     P  +WP  G +EF  ++++Y E     L NI+L +  GEKIGIVGRTG+GK+S+   LF+L+E   G ++IDD+ I +I + D+R  +T+ PQE  +FSGT+R N+DPF    D  + +AL LSHL  ++ +    L  +C + G +LSVGQRQL+CLAR +LR ++I+VLDEATA+VD ETD LI  TI+  F + T+  IAHR + + D  +++V+D+G+I EF   + ++N    +F   K
Sbjct:  193 SSAVMDPNVCPETTAGFLSRMTFWWFTRMAIKGYKSPLENKDLWSLNKNDSSELVVPGLLNQWEVEKSKAHSSDDQNVKEQVTFTKPGSGAESNHVNESPEEAEVLLSKQQQKSRQP----SFLW----ALLRAFGPYFLIGSAFKLLQDLITFINPQLLRMLIAFTKQSDVPSWWGYALAFLMFGTSLLQTLILHQHFQYCFVTGMRLRTGIIGAIYRKALVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIFLALFFLWQNLGPSVLAGVAVMVLLIPFNAFIAMKTRTYQVEQMKYKDDRIKLMNEILNGIKVLKLYAWEPSFRDKILQIRQKELHVLRKTAYLSALSTMAWTSAPFLVALTSFAVFVNVDEKNVLDAEKAFVSLSLFNILRFPLNMLPQVISSIVQASVSLKRLQDFLNHDELDPESVDRKSNTTEYAVSVVNGKFSWAKRDQVILDNINVLVPQGSLLAVVGHVGCGKTSLISALLGEMEKLDGQISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLLDDPLSAVDAHVAKHIFDHVIGPEGALKGKTRILVTHGISFLPQVNNILVL-VDGRVSEMGSYQDLLRQNGAFAEFLRNYSLEDIIEDDELTVSFDEEEEEFPEDALSNHTDMV---DNEPVVNEARRQFMRQMSIMSNDVENPKKMSRRRRCSERKH--------PETPTEKKEPKVEKLIQAETTETGRVKLQVYWEYVKAIGPLLALFICFLYGCQSAAAIGANFWLSEWTND-------------------------ALHNRTQEMLQTRVGVYAALGISQGILVMFSSFTLALGKIQAARKLHQVLLENKFQTPQSFFDTTPTGRIINRFSKDIYVVDEVLPSTLLMFLGTFFASLSTMIVIISSTPVFAFVIAPLALIYFFVQRFYVATSRQLKRLESVSRSPIYSHFSESITGTSVIRAYGRNAAFVLMSDNKVDENQKSYYPGIVSNRWLGVRIEFIGNCIVLFAALFAVTGKDKLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETQTEAPWEVLEKKPPPDWPPLGNVEFVDYSVRYREGLDLVLKNISLKVRGGEKIGIVGRTGAGKSSMTLCLFRLLEAAAGEIVIDDVKISEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFERYSDEEVWKALELSHLQKFVTNQAAKLELECSEGGENLSVGQRQLVCLARALLRKTRILVLDEATAAVDLETDDLIQSTIRTEFQDCTVFTIAHRLNTIMDYTRVLVLDKGQIAEFDTPTNLMNQKGLFFGMAK 1533          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc6b.2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110208-2])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 441/1326 (33.26%), Postives = 702/1326 (52.94%), Query Frame = 2
Query:  578 NNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKS--RRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTK--------NYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESE----FNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
             NPCP E +S  S++LF W  R +                 YQC+  + T+        TL  K +   K   R+   E  + + L + L  +F    +     +V      FS P +L  LL ++   + PL+ G+  A S  +   L S+  +   +   T  ++V++A+   VY KS+ IN+ A+ T T  EI+NL+S DT K+V  + Y   +  +P EI L   FL+  +G     G+  ++  FPLN          Q  +M+ KD+RIK M E+L+ +K++K Y+WE  F + +   REKE+N ++   +   V    +++  + +   M   YV I   +V+ A+  FVS+ L+N+L++P++ LP  ++  M   VSLKR+  FL +++ K        + F S  DI SV+ I NG+FSW  DS P L+RIN+ + +G LV +VG + SGK+SLL+A++GEM    G ++I GS+ YVPQ  WI+  + KDNI+   +  ++ Y+ V+  C L  DL    A +    G   +  SGGQ+QR++LARAVY+ S+IYLLDDPLSA+DA V Q +FEKVI  NG L N TR+ VT  ++FL   D I+ +  +G IK  G  + + +    F ++   K+FS   +E  ES                      A++K K     I     MV    +    +                   V  + Y +YF   G   +   IF +    +  +  +YWL     DP I                                +  + +YG +GF Q I      +  SLG   AS+ +H  +LN VL S + +F  + S  +LN FSK+ID ID +IP+ L  ++  +F+++    ++L   P   ++I+P+ LLY  I  FY+ ++CQ + L   S SPI+  FNET+QG  VIRA  ++  F  +    ++ N    + + V + WL++ L+FLGN+LV  + I+++  R  L+P  VGL +S+S+ +  +L+W++  + D+E N +++ER+  +     E    F D        S+WPR G I F+ + L+Y +   + L  I+L +   EK+GIVGRTG+GK+SL   +F+++E   G + ID I+I +I + ++R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++  +   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD +TD LI  TI+ +F + T+L IAHR + + D  ++IVMDRG I E    S +I+    ++  C+
Sbjct:  205 KNPCPVEDASFLSKLLFWWYGRLVVK--------------GYQCLIKIITIPSSLNEAQTLGFKLSSCVKQLFRKLFKEQCTGFVLFRTLAKIFSPYFLTGTLFLVIQDALMFSIPQVLSLLLGYVRDEDAPLWKGYLFAFSLFLLSCLQSLFNHQYMYTCLTVGMRVKTAVMGLVYRKSLVINSAARKTCTVGEIVNLVSADTQKLVDFVMYFNALWLAPIEIALCLFFLWQHLGPSTLAGITTVILIFPLNGFIAKMRSKLQEVQMKHKDERIKLMNEILSGIKILKFYAWEKAFRERVLGYREKELNALKKSQILYSVSIASFNSSTLLIAFAMFGVYVLIDDKHVLDAQKIFVSMALINILKAPLSQLPIAMSTTMQVVVSLKRLGTFLDQDELKLDSKKLIGSLFISLSDIESVV-INNGTFSWSKDSTPCLRRINVKVQRGSLVAVVGHVGSGKSSLLSAMLGEMEKKSGHITITGSVGYVPQQAWIQNATLKDNILFGCEKKDSLYQKVLEACALLPDLEILPARDATEIGEKGLNLSGGQKQRVSLARAVYRNSDIYLLDDPLSAVDAHVGQHIFEKVIGPNGSLKNKTRVLVTHGLSFLPQADLILVM-ADGEIKEMGSYAELLSRKNAFAEL---KAFS--VSERKES----------------------ATLKGK-----IEFPATMVTLYLLTLLKN-----------------ADVKLEMYVEYFRTIGLAFIIPIIFLYAFQQVASLAYNYWLSLWADDPVI-------------------------NGTQVNTDLKLGVYGALGFAQGIAIFGTTVAISLGGIIASRQLHLDLLNNVLHSPMSFFESTPSGNLLNRFSKEIDAIDCMIPHGLKIMLGYVFKLLEVCIIVLMATPFAGVIILPLTLLYAFIQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFGEQPRFILQANCRVDLNQTSYFPRFVASRWLAVNLEFLGNLLVLAAAILSVMGRATLSPGTVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVKEYAETAKEAPWTFEDSPL----PSDWPRSGSIGFQAYGLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLKTFVSDLPDKLNHECSEGGENLSLGQRQLICLARALLRKTKILVLDEATAAVDLKTDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGNITEIDSPSNLISQHGQFYRMCR 1436          

HSP 2 Score: 63.1586 bits (152), Expect = 2.866e-9
Identity = 59/239 (24.69%), Postives = 110/239 (46.03%), Query Frame = 2
Query: 1823 SFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN-----GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSF 2485
               +R   +  LK I++S+N+ E VGIVG+  +GK+SL   I   +    G + I G              ++ +PQ+P +   S + N+    +Y + +    + +  L     ++  D+LN     G + +  S GQRQ I LARA+ +K++I +LD+  +A+D +    + +  I       + T L +   +N +    ++I +D  G+I      SN+ +    F ++  E   
Sbjct: 1209 GLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLK-TFVSDLPDKLNHECSEGGENL--SLGQRQLICLARALLRKTKILVLDEATAAVD-LKTDNLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVMDR-GNITEIDSPSNLISQHGQFYRMCREAGL 1440          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc6b.2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110208-2])

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 440/1340 (32.84%), Postives = 713/1340 (53.21%), Query Frame = 2
Query:  578 NNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTF-----DVHYQCVADVNTMNFKR--KLTSTLKSKNNYHTKS-----------RRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQ------DIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESE----FNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
             NPCP E +S  S++LF W  R +   +++ +K+E  +     D   + + D+     K+  KL     S N   T             R+   E  + + L + L  +F    +     +V      FS P +L  LL ++   + PL+ G+  A S  +   L S+  +   +   T  ++V++A+   VY KS+ IN+ A+ T T  EI+NL+S DT K+V  + Y   +  +P EI L   FL+  +G     G+  ++  FPLN          Q  +M+ KD+RIK M E+L+ +K++K Y+WE  F + +   REKE+N ++   +   V    +++  + +   M   YV I   +V+ A+  FVS+ L+N+L++P++ LP  ++  M   VSLKR+  FL +++ K    S Q      +I SV+ I NG+FSW  DS P L+RIN+ + +G LV +VG + SGK+SLL+A++GEM    G ++I GS+ YVPQ  WI+  + KDNI+   +  ++ Y+ V+  C L  DL    A +    G   +  SGGQ+QR++LARAVY+ S+IYLLDDPLSA+DA V Q +FEKVI  NG L N TR+ VT  ++FL   D I+ +  +G IK  G  + + +    F ++   K+FS   +E  ES           R S     I      +   + ++    +    +  +   +  R      ++        V  + Y +YF   G   +   IF +    +  +  +YWL     DP I                                +  + +YG +GF Q I      +  SLG   AS+ +H  +LN VL S + +F  + S  +LN FSK+ID ID +IP+ L  ++  +F+++    ++L   P   ++I+P+ LLY  I  FY+ ++CQ + L   S SPI+  FNET+QG  VIRA  ++  F  +    ++ N    + + V + WL++ L+FLGN+LV  + I+++  R  L+P  VGL +S+S+ +  +L+W++  + D+E N +++ER+  +     E    F D        S+WPR G I F+ + L+Y +   + L  I+L +   EK+GIVGRTG+GK+SL   +F+++E   G + ID I+I +I + ++R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++  +   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD +TD LI  TI+ +F + T+L IAHR + + D  ++IVMDRG I E    S +I+    ++  C+
Sbjct:  203 KNPCPVEDASFLSKLLFWWYGRLVVKGYRSPLKAEDLWSLREEDTSEKIICDLEKEWAKQWAKLQQKKSSLNEAQTLGFKLSSCVKQLFRKLFKEQCTGFVLFRTLAKIFSPYFLTGTLFLVIQDALMFSIPQVLSLLLGYVRDEDAPLWKGYLFAFSLFLLSCLQSLFNHQYMYTCLTVGMRVKTAVMGLVYRKSLVINSAARKTCTVGEIVNLVSADTQKLVDFVMYFNALWLAPIEIALCLFFLWQHLGPSTLAGITTVILIFPLNGFIAKMRSKLQEVQMKHKDERIKLMNEILSGIKILKFYAWEKAFRERVLGYREKELNALKKSQILYSVSIASFNSSTLLIAFAMFGVYVLIDDKHVLDAQKIFVSMALINILKAPLSQLPIAMSTTMQVVVSLKRLGTFLDQDELK--LDSVQRVPYNPNIESVV-INNGTFSWSKDSTPCLRRINVKVQRGSLVAVVGHVGSGKSSLLSAMLGEMEKKSGHITITGSVGYVPQQAWIQNATLKDNILFGCEKKDSLYQKVLEACALLPDLEILPARDATEIGEKGLNLSGGQKQRVSLARAVYRNSDIYLLDDPLSAVDAHVGQHIFEKVIGPNGSLKNKTRVLVTHGLSFLPQADLILVM-ADGEIKEMGSYAELLSRKNAFAEL---KAFS--VSERKESATLKG-----TRKSVSFLSI--KDFSTDLIRGDLGSASIQTMEAISDPKLNQDRDEVGRLTQADKAHTGRVKLEMYVEYFRTIGLAFIIPIIFLYAFQQVASLAYNYWLSLWADDPVI-------------------------NGTQVNTDLKLGVYGALGFAQGIAIFGTTVAISLGGIIASRQLHLDLLNNVLHSPMSFFESTPSGNLLNRFSKEIDAIDCMIPHGLKIMLGYVFKLLEVCIIVLMATPFAGVIILPLTLLYAFIQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFGEQPRFILQANCRVDLNQTSYFPRFVASRWLAVNLEFLGNLLVLAAAILSVMGRATLSPGTVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVKEYAETAKEAPWTFEDSPL----PSDWPRSGSIGFQAYGLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLKTFVSDLPDKLNHECSEGGENLSLGQRQLICLARALLRKTKILVLDEATAAVDLKTDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGNITEIDSPSNLISQHGQFYRMCR 1497          

HSP 2 Score: 62.3882 bits (150), Expect = 5.398e-9
Identity = 59/239 (24.69%), Postives = 110/239 (46.03%), Query Frame = 2
Query: 1823 SFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN-----GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSF 2485
               +R   +  LK I++S+N+ E VGIVG+  +GK+SL   I   +    G + I G              ++ +PQ+P +   S + N+    +Y + +    + +  L     ++  D+LN     G + +  S GQRQ I LARA+ +K++I +LD+  +A+D +    + +  I       + T L +   +N +    ++I +D  G+I      SN+ +    F ++  E   
Sbjct: 1270 GLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLK-TFVSDLPDKLNHECSEGGENL--SLGQRQLICLARALLRKTKILVLDEATAAVD-LKTDNLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVMDR-GNITEIDSPSNLISQHGQFYRMCREAGL 1501          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc6b.2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110208-2])

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 436/1329 (32.81%), Postives = 710/1329 (53.42%), Query Frame = 2
Query:  578 NNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR---SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFD----------TEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESE----FNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
             NPCP E +S  S++LF W  R +   +++ +K+E  + +  +  ++        K+  T    +      R+   E  + + L + L  +F    +     +V      FS P +L  LL ++   + PL+ G+  A S  +   L S+  +   +   T  ++V++A+   VY KS+ IN+ A+ T T  EI+NL+S DT K+V  + Y   +  +P EI L   FL+  +G     G+  ++  FPLN          Q  +M+ KD+RIK M E+L+ +K++K Y+WE  F + +   REKE+N ++   +   V    +++  + +   M   YV I   +V+ A+  FVS+ L+N+L++P++ LP  ++  M   VSLKR+  FL +++ K    S Q +    S + I NG+FSW  DS P L+RIN+ + +G LV +VG + SGK+SLL+A++GEM    G ++I GS+ YVPQ  WI+  + KDNI+   +  ++ Y+ V+  C L  DL    A +    G   +  SGGQ+QR++LARAVY+ S+IYLLDDPLSA+DA V Q +FEKVI  NG L N TR+ VT  ++FL   D I+ +  +G IK  G  + + +    F ++K   +FS   +E  ES+    +  +  R S     I   S      + N    F+   +       +         ++D D               V  + Y +YF   G   +   IF +    +  +  +YWL     DP I                                +  + +YG +GF Q I      +  SLG   AS+ +H  +LN VL S + +F  + S  +LN FSK+ID ID +IP+ L  ++  +F+++    ++L   P   ++I+P+ LLY  I  FY+ ++CQ + L   S SPI+  FNET+QG  VIRA  ++  F  +    ++ N    + + V + WL++ L+FLGN+LV  + I+++  R  L+P  VGL +S+S+ +  +L+W++  + D+E N +++ER+  +     E    F D        S+WPR G I F+ + L+Y +   + L  I+L +   EK+GIVGRTG+GK+SL   +F+++E   G + ID I+I +I + ++R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++  +   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD +TD LI  TI+ +F + T+L IAHR + + D  ++IVMDRG I E    S +I+    ++  C+
Sbjct:  172 KNPCPVEDASFLSKLLFWWYGRLVVKGYRSPLKAEDLWSLREEDTSE--------KIIYTCYLSSCVKQLFRKLFKEQCTGFVLFRTLAKIFSPYFLTGTLFLVIQDALMFSIPQVLSLLLGYVRDEDAPLWKGYLFAFSLFLLSCLQSLFNHQYMYTCLTVGMRVKTAVMGLVYRKSLVINSAARKTCTVGEIVNLVSADTQKLVDFVMYFNALWLAPIEIALCLFFLWQHLGPSTLAGITTVILIFPLNGFIAKMRSKLQEVQMKHKDERIKLMNEILSGIKILKFYAWEKAFRERVLGYREKELNALKKSQILYSVSIASFNSSTLLIAFAMFGVYVLIDDKHVLDAQKIFVSMALINILKAPLSQLPIAMSTTMQVVVSLKRLGTFLDQDELK--LDSVQRVPYNPSDVVINNGTFSWSKDSTPCLRRINVKVQRGSLVAVVGHVGSGKSSLLSAMLGEMEKKSGHITITGSVGYVPQQAWIQNATLKDNILFGCEKKDSLYQKVLEACALLPDLEILPARDATEIGEKGLNLSGGQKQRVSLARAVYRNSDIYLLDDPLSAVDAHVGQHIFEKVIGPNGSLKNKTRVLVTHGLSFLPQADLILVM-ADGEIKEMGSYAELLSRKNAFAELK---AFS--VSERKESM----HLVLGTRKSVSFLSIKDFSTDLISFK-NATFTFVEKGDLGSASIQTMEAISDPKLNQDRDEVGRLTQADKAHTGRVKLEMYVEYFRTIGLAFIIPIIFLYAFQQVASLAYNYWLSLWADDPVI-------------------------NGTQVNTDLKLGVYGALGFAQGIAIFGTTVAISLGGIIASRQLHLDLLNNVLHSPMSFFESTPSGNLLNRFSKEIDAIDCMIPHGLKIMLGYVFKLLEVCIIVLMATPFAGVIILPLTLLYAFIQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFGEQPRFILQANCRVDLNQTSYFPRFVASRWLAVNLEFLGNLLVLAAAILSVMGRATLSPGTVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVKEYAETAKEAPWTFEDSPL----PSDWPRSGSIGFQAYGLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLKTFVSDLPDKLNHECSEGGENLSLGQRQLICLARALLRKTKILVLDEATAAVDLKTDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGNITEIDSPSNLISQHGQFYRMCR 1450          

HSP 2 Score: 62.3882 bits (150), Expect = 5.141e-9
Identity = 59/239 (24.69%), Postives = 110/239 (46.03%), Query Frame = 2
Query: 1823 SFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN-----GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSF 2485
               +R   +  LK I++S+N+ E VGIVG+  +GK+SL   I   +    G + I G              ++ +PQ+P +   S + N+    +Y + +    + +  L     ++  D+LN     G + +  S GQRQ I LARA+ +K++I +LD+  +A+D +    + +  I       + T L +   +N +    ++I +D  G+I      SN+ +    F ++  E   
Sbjct: 1223 GLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLK-TFVSDLPDKLNHECSEGGENL--SLGQRQLICLARALLRKTKILVLDEATAAVD-LKTDNLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVMDR-GNITEIDSPSNLISQHGQFYRMCREAGL 1454          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 457/1355 (33.73%), Postives = 733/1355 (54.10%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKR-------------------KLTSTLKSKNNYHTKSRRPINEHSSVWW---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLI--ENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLR---TNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENG--SIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMN---RNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRA-SKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            N   ++ NPCPE  +S  S+I F W+ R +   F+  ++++  + ++ +     V  V + N+++                   K T  L SK +   ++   I + +       L KAL+  FG    IS     FH +  FS P +L+ L+KF+   + P + G+           L ++  +  FH+   T +++++A+   VY K++ INN A+ T T  EI+NLMS D  + +    Y  ++ S+P ++IL F  L+  +G   LA I V+VL+   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+ E+ +++  +  + V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   E + ++     Q     I +K+ +FSW  +  P LK INISI +G LV +VG++  GK+SLL+A++GEM   DG V++KGS+ YV Q  WI+  S KDN++  ++  E+ YK VI  C L  DL    T    E+ G   +  SGGQ+QR++LARAVY  ++IYLLDDPLSA+DA V + +F+KVI   G+L N TR+ VT  +++L  +D II + +     +  Y D+        +F++  +     +   E   S   S    + N   RN   + + L AS ++K    N                 ++S       +E    +   V    +++Y  A G    F SIF F    +  + S+YWL   T D  +                                   + +YG +GF Q I    +    SLG   AS+ +H  +L+ VL+  + +F ++ S  ++N FSK+ID ID+ IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ ++ Q + L   S SP++  FNETL G  VIRA  +QK+  Q   FK +++N +  Y   V N WL++RL+F+GN +V  + + A+  R  L+P LVGL++SY++ +   LNW++    +LETN +A+ER+  +  ++ E         P++ WP  GKIEF+ + L+Y ED    L NIN+ I+ GEK+GIVGRTG+GK+SL   LF++ E   G ++ID  ++  I + D+R  +T+ PQ+  +FSGT+R N+DPF+   D  +  +L L+HL  ++ ++   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+  F + T++ IAHR + + D  K+IV+D+G+++EF   S ++     +F+  K
Sbjct:  158 NCYRQSCNPCPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEKEYNKAKAKKVPLKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPDWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLL--VPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKTEGSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEI-GEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTYANAE-QNKDQEEAPSPVPSEEKRLENGILRNERNLQRQLSASSETKSLNQNKTGDL------------NSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV-------------------------NGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFK-VDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFFNMAK 1470          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 456/1353 (33.70%), Postives = 732/1353 (54.10%), Query Frame = 2
Query:  569 IENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKR-------------------KLTSTLKSKNNYHTKSRRPINEHSSVWW---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLI--ENKTKNYFSSCQ-DIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLR---TNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENG--SIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMN---RNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRA-SKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            + + NPCPE  +S  S+I F W+ R +   F+  ++++  + ++ +     V  V + N+++                   K T  L SK +   ++   I + +       L KAL+  FG    IS     FH +  FS P +L+ L+KF+   + P + G+           L ++  +  FH+   T +++++A+   VY K++ INN A+ T T  EI+NLMS D  + +    Y  ++ S+P ++IL F  L+  +G   LA I V+VL+   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+ E+ +++  +  + V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   E + ++     Q      I +K+ +FSW  +  P LK INISI +G LV +VG++  GK+SLL+A++GEM   DG V++KGS+ YV Q  WI+  S KDN++  ++  E+ YK VI  C L  DL    T    E+ G   +  SGGQ+QR++LARAVY  ++IYLLDDPLSA+DA V + +F+KVI   G+L N TR+ VT  +++L  +D II + +     +  Y D+        +F++  +     +   E   S   S    + N   RN   + + L AS ++K    N                 ++S       +E    +   V    +++Y  A G    F SIF F    +  + S+YWL   T D  +                                   + +YG +GF Q I    +    SLG   AS+ +H  +L+ VL+  + +F ++ S  ++N FSK+ID ID+ IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ ++ Q + L   S SP++  FNETL G  VIRA  +QK+  Q   FK +++N +  Y   V N WL++RL+F+GN +V  + + A+  R  L+P LVGL++SY++ +   LNW++    +LETN +A+ER+  +  ++ E         P++ WP  GKIEF+ + L+Y ED    L NIN+ I+ GEK+GIVGRTG+GK+SL   LF++ E   G ++ID  ++  I + D+R  +T+ PQ+  +FSGT+R N+DPF+   D  +  +L L+HL  ++ ++   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+  F + T++ IAHR + + D  K+IV+D+G+++EF   S ++     +F+  K
Sbjct:  186 VNDPNPCPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEKEYNKAKAKKVPLKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPDWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLL--VPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEI-GEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTYANAE-QNKDQEEAPSPVPSEEKRLENGILRNERNLQRQLSASSETKSLNQNKTGDL------------NSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV-------------------------NGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFK-VDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFFNMAK 1496          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 453/1349 (33.58%), Postives = 735/1349 (54.48%), Query Frame = 2
Query:  569 IENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKR-------------------KLTSTLKSKNNYHTKSRRPINEHSSVWW---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLI--ENKTKNYFSSCQ-DIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLR---TNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIH-KILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRA-SKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            + + NPCPE  +S  S+I F W+ R +   F+  ++++  + ++ +     V  V + N+++                   K T  L SK +   ++   I + +       L KAL+  FG    IS     FH +  FS P +L+ L+KF+   + P + G+           L ++  +  FH+   T +++++A+   VY K++ INN A+ T T  EI+NLMS D  + +    Y  ++ S+P ++IL F  L+  +G   LA I V+VL+   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+ E+ +++  +  + V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   E + ++     Q      I +K+ +FSW  +  P LK INISI +G LV +VG++  GK+SLL+A++GEM   DG V++KGS+ YV Q  WI+  S KDN++  ++  E+ YK VI  C L  DL    T    E+ G   +  SGGQ+QR++LARAVY  ++IYLLDDPLSA+DA V + +F+KVI   G+L N TR+ VT  +++L  +D II +  +G I   G   ++       M+  +   F   +A   ++          N+   R++    H      + Q++   +   +N ++    +S+ +   +    D   +   V    +++Y  A G    F SIF F    +  + S+YWL   T D  +                                   + +YG +GF Q I    +    SLG   AS+ +H  +L+ VL+  + +F ++ S  ++N FSK+ID ID+ IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ ++ Q + L   S SP++  FNETL G  VIRA  +QK+  Q   FK +++N +  Y   V N WL++RL+F+GN +V  + + A+  R  L+P LVGL++SY++ +   LNW++    +LETN +A+ER+  +  ++ E         P++ WP  GKIEF+ + L+Y ED    L NIN+ I+ GEK+GIVGRTG+GK+SL   LF++ E   G ++ID  ++  I + D+R  +T+ PQ+  +FSGT+R N+DPF+   D  +  +L L+HL  ++ ++   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+  F + T++ IAHR + + D  K+IV+D+G+++EF   S ++     +F+  K
Sbjct:  196 VNDPNPCPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEKEYNKAKAKKVPLKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPDWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLL--VPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEI-GEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVM-VDGKITEVGSYQDL------LMQDGAFAEFLRTYANAEQN--KDQEGKPSNQEESRLYLNRFHIHFLFNFRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEAD-KAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV-------------------------NGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFK-VDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFFNMAK 1505          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 456/1360 (33.53%), Postives = 740/1360 (54.41%), Query Frame = 2
Query:  569 IENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKR-------------------KLTSTLKSKNNYHTKSRRPINEHSSVWW---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLI--ENKTKNYFSSCQ-DIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLR---TNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIH----KILHASIKSKY--HQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDF------DTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRA-SKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            + + NPCPE  +S  S+I F W+ R +   F+  ++++  + ++ +     V  V + N+++                   K T  L SK +   ++   I + +       L KAL+  FG    IS     FH +  FS P +L+ L+KF+   + P + G+           L ++  +  FH+   T +++++A+   VY K++ INN A+ T T  EI+NLMS D  + +    Y  ++ S+P ++IL F  L+  +G   LA I V+VL+   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+ E+ +++  +  + V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   E + ++     Q      I +K+ +FSW  +  P LK INISI +G LV +VG++  GK+SLL+A++GEM   DG V++KGS+ YV Q  WI+  S KDN++  ++  E+ YK VI  C L  DL    T    E+ G   +  SGGQ+QR++LARAVY  ++IYLLDDPLSA+DA V + +F+KVI   G+L N TR+ VT  +++L  +D II +  +G I   G   ++       M+  +   F   +A   ++          N+   R++     +L  ++   Y     N   + L  ++   + N + +  L+ S+ +D+        +   V    +++Y  A G    F SIF F    +  + S+YWL   T D  +                                   + +YG +GF Q I    +    SLG   AS+ +H  +L+ VL+  + +F ++ S  ++N FSK+ID ID+ IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ ++ Q + L   S SP++  FNETL G  VIRA  +QK+  Q   FK +++N +  Y   V N WL++RL+F+GN +V  + + A+  R  L+P LVGL++SY++ +   LNW++    +LETN +A+ER+  +  ++ E         P++ WP  GKIEF+ + L+Y ED    L NIN+ I+ GEK+GIVGRTG+GK+SL   LF++ E   G ++ID  ++  I + D+R  +T+ PQ+  +FSGT+R N+DPF+   D  +  +L L+HL  ++ ++   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+  F + T++ IAHR + + D  K+IV+D+G+++EF   S ++     +F+  K
Sbjct:  174 VNDPNPCPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEKEYNKAKAKKVPLKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPDWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLL--VPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEI-GEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVM-VDGKITEVGSYQDL------LMQDGAFAEFLRTYANAEQN--KDQEGKPSNQEESRLYLNALYLLCVTVYYVYFPQAYNTGPRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV-------------------------NGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFK-VDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFFNMAK 1495          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 436/1244 (35.05%), Postives = 697/1244 (56.03%), Query Frame = 2
Query:  827 LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLI--ENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLR---TNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIH-KILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKS--------VSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRA-SKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            L KAL+  FG    IS     FH +  FS P +L+ L+KF+   + P + G+           L ++  +  FH+   T +++++A+   VY K++ INN A+ T T  EI+NLMS D  + +    Y  ++ S+P ++IL F  L+  +G   LA I V+VL+   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+ E+ +++  +  + V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   E + ++     Q     I +K+ +FSW  +  P LK INISI +G LV +VG++  GK+SLL+A++GEM   DG V++KGS+ YV Q  WI+  S KDN++  ++  E+ YK VI  C L  DL    T    E+ G   +  SGGQ+QR++LARAVY  ++IYLLDDPLSA+DA V + +F+KVI   G+L N TR+ VT  +++L  +D II +  +G I   G   ++       M+  +   F   +A   ++          N+   R++   L+    +++H I+    F  ++ S   K+ + +++   + SE  D ++          V    +++Y  A G    F SIF F    +  + S+YWL   T D  +                                   + +YG +GF Q I    +    SLG   AS+ +H  +L+ VL+  + +F ++ S  ++N FSK+ID ID+ IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ ++ Q + L   S SP++  FNETL G  VIRA  +QK+  Q   FK+ ++N +  Y   V N WL++RL+F+GN +V  + + A+  R  L+P LVGL++SY++ +   LNW++    +LETN +A+ER+  +  ++ E         P++ WP  GKIEF+ + L+Y ED    L NIN+ I+ GEK+GIVGRTG+GK+SL   LF++ E   G ++ID  ++  I + D+R  +T+ PQ+  +FSGT+R N+DPF+   D  +  +L L+HL  ++ ++   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+  F + T++ IAHR + + D  K+IV+D+G+++EF   S ++     +F+  K
Sbjct:  270 LLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPDWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLL--VPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKTEGSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEI-GEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVM-VDGKITEVGSYQDL------LMQDGAFAEFLRTYANAEQN--KDQEGKPSNQEESRLYLNALYLLCVTRFH-IHFLFNFRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV-------------------------NGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKV-DENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFFNMAK 1474          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:MGI Symbol;Acc:MGI:102676])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 444/1357 (32.72%), Postives = 732/1357 (53.94%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKRKLTSTLKS---------KNNYHTKSRRPINEHSSVWWLT-------------KALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRS----VIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMK-IKSEKSFSDPFAEHTESIFTSN------NNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGF--GQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   ++  ++S   + ++ +     V  V   N+K++   + K          K+    K    ++ +  V  L              K L+  FG   ++S+     H +  F+ P IL+ ++ F++  E P + G+       ++  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL   FL+  +G     GV V++   PLN++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  + V    W   P  V L+    +V +    ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + I+S     I +KN +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V++KGS++YVPQ  WI+  S ++NI+      EN YK V+  C L  DL    + +    G   +  SGGQ+QR++LARAVY  S+IYL DDPLSA+DA V + +FEKV+   G+L N TR+ VT  I++L  +D II +   G I   G    + +    F + +++  +     A   +S+  S        N ++  ++   H   H S  S  H  +  +Q   +   +       +  L     E    +   V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP ++N T                         A  N+ + +YG +G   G  IF   + +  S+G   AS+ +H  +L  VL+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ I   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP  G++EF+ + L+Y ED    L +IN+ IE GEK+GIVGRTG+GK+SL   LF++ E   G ++ID ++I  I + ++R  IT+ PQ+  +FSG++R N+DPF+   D  +  AL L+HL  ++ ++   L+ +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GE+ E G  SE++     ++S  K
Sbjct:  199 SETVHDRNPCPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDREPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPDWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMS-GGKISEMGSYQELLDRDGAFAEFLRTYANAEQDLASEDDSVSGSGKESKPVENGMLVTDTVGKHLQRHLS-NSSSHSGDTSQQHSSIAELQKAGAKEETWKLM----EADKAQTGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGT------------------------QANRNFRLSVYGALGILQGAAIFG--YSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELLQQRGIFYSMAK 1523          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 419/1351 (31.01%), Postives = 710/1351 (52.55%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIK-----SESTFDVHYQCVADV------NTMNFKRKLTSTLKSK---NNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSV-----IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDL--DFDLRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFD-------------------TEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            + NPCPE  +   SR+ F W  R     ++  ++     S S  D  ++ V  +            R  T+T + K    +      RP ++  S     +AL   F S L++S C  +   +  F  P +L  L++FIS P  P ++GF LA    ++  + ++  +  +H     +L++R+AI   +Y K++ I N  K   T  E++NLMS D  + +    +  ++ S+P ++IL   FL+  +G  A  GV V++   PLN      ++ YQ ++M++KD RIK M+E+LN +KV+KLY+WE  F + +   R+ E+ L+R  +    +   IW   P  V L  L  YV +  + V+ AE  FVS+ L N+L+ P+ +LP  I+      VSLKR+  FL +N+       C + +++     I I NG+F+W  D  P L  +NI I KG LV +VG +  GK+SL++A++GEM  L+G VS+KGS++YVPQ  WI+  + ++N++  +      Y+  +  C L  D D+         G   +  SGGQRQR++LARAVY  + I+LLDDPLSA+D+ VA+ +F++VI   G+LA  TR+ VT  I+FL   D II L   G +   G  S +      F       +  +   +H  ++  +N   ++  ++   H  L  +  + Y    +RKQF+   +S  ++    +R++ +  +   +                    E  +V    Y+ Y  + G          +G  +   + ++ WL   ++D                            +      +  + +Y  +G  Q +       T  +G   A++ +H+ +L+  ++S   +F  + S +ILN FSKDI  ID ++   +  ++N  F  +++  VI+ + PLF+++++P+ +LY  + +FY+ ++ Q + L   S SPIF  F+ET+ G  VIRA  + + F+      +++N K  Y     N WL + ++F+GN +V  + + A+  RN L P LVGL++SY++ +   LNWMI    DLE+N +A+ER+  ++  ++E             WP  G +EF+ ++++Y    +  L N+ + ++ GEK+GIVGRTG+GK+S+   LF+++E   G ++ID +++  I + D+R  +T+ PQ+  +FSGT+R N+DPF    +  + +AL LSHL  ++ S    L F C + G +LSVGQRQL+CLAR +LR S+++VLDEATA++D ETD LI  TI+ +F + T+L IAHR + + D ++++V+D+G + EF     +I     ++   K
Sbjct:  203 DTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQKQQNQASRSQTATAEPKIPGEDAVLLKPRPKSKQPS---FLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELD---PQCVERKTISPGYAITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-AGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEAALQNANEEVLLLEDTLSTHTDLTDNEPAIYE---VRKQFMREMSSLSSEGEVQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAE-------------------------EHGQQNKTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIAAGGIFYGMAK 1518          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 421/1351 (31.16%), Postives = 710/1351 (52.55%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIK-----SESTFDVHYQCVADV------NTMNFKRKLTSTLKSK---NNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSV-----IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDL--DFDLRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFD-------------------TEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            + NPCPE  +   SR+ F W  R     ++  ++     S S  D  ++ V  +            R  T+T + K    +      RP ++  S     +AL   F S L++S C  +   +  F  P +L  L++FIS P  P ++GF LA    ++  + ++  +  +H     +L++R+AI   +Y K++ I N  K   T  E++NLMS D  + +    +  ++ S+P ++IL   FL+  +G  A  GV V++   PLN      ++ YQ ++M++KD RIK M+E+LN +KV+KLY+WE  F + +   R+ E+ L+R  +    +   IW   P  V L  L  YV +  + V+ AE  FVS+ L N+L+ P+ +LP  I+      VSLKR+  FL +N+       C + +++     I I NG+F+W  D  P L  +NI I KG LV +VG +  GK+SL++A++GEM  L+G VS+KGS++YVPQ  WI+  + ++N++  +      Y+  +  C L  D D+         G   +  SGGQRQR++LARAVY  + I+LLDDPLSA+D+ VA+ +F++VI   G+LA  TR+ VT  I+FL   D II L   G +   G  S +      F       +  D   E  E++  +N   ++  ++   H  L  +  + Y    +RKQF+   +S  ++    +R++ +  +   +                    E  +V    Y+ Y  + G          +G  +   + ++ WL   ++D                            +      +  + +Y  +G  Q +       T  +G   A++ +H+ +L+  ++S   +F  + S +ILN FSKDI  ID ++   +  ++N  F  +++  VI+ + PLF+++++P+ +LY  + +FY+ ++ Q + L   S SPIF  F+ET+ G  VIRA  + + F+      +++N K  Y     N WL + ++F+GN +V  + + A+  RN L P LVGL++SY++ +   LNWMI    DLE+N +A+ER+  ++  ++E             WP  G +EF+ ++++Y    +  L N+ + ++ GEK+GIVGRTG+GK+S+   LF+++E   G ++ID +++  I + D+R  +T+ PQ+  +FSGT+R N+DPF    +  + +AL LSHL  ++ S    L F C + G +LSVGQRQL+CLAR +LR S+++VLDEATA++D ETD LI  TI+ +F + T+L IAHR + + D ++++V+D+G + EF     +I     ++   K
Sbjct:  203 DTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQKQQNQASRSQTATAEPKIPGEDAVLLKPRPKSKQPS---FLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELD---PQCVERKTISPGYAITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-AGGQVSEMGHYSALLQHDGSFANFLRNYA-PDEDQEDHEALQNANEEVLLLEDTLSTHTDLTDNEPAIYE---VRKQFMREMSSLSSEGEVQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAE-------------------------EHGQQNKTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIAAGGIFYGMAK 1517          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:MGI Symbol;Acc:MGI:1352447])

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 423/1377 (30.72%), Postives = 719/1377 (52.21%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTL------------KSKNNYHTKSRRPINEHSSVW------------------------WLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEV-NLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDI---RSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMK-IKSEKSFSDPFAEHT------------------ESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESE---FNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            ++   P   +S  S + F W D  +   +++ +  E  +D+     A   T  FK  +T  L            KS+ +    S     + S                           WL KALF  F   ++ S+   + H I  F  P +LK+L+ F+  P++  + G+  AI      ++ S    C F       + VR+ I ++VY K++ ++N A+  +T  E +NLMS D+ K++    Y  ++ SS  +I L   FL+ E+G   LA +G++VL+   P+N +  + ++  Q + M+ KDKR+K M E+L+ +K++K ++WE  F + ++  R+KE+ NL+R   L + ++ I+  T P  V +     YV +    V+ AE  F S+ L N+LR P+A+LP  I+  +   VS+ R+  +L  +      S+ + +      ++    SF+W  D E  ++ +N+ I  G+LV +VG + SGK+SL++A++GEM  + G ++IKGS++YVPQ  WI+  + KDNI+   +Y E  Y+ VI  C L  DL      ++   G   +  SGGQ+ R++LARA YQ ++IY+LDDPLSA+D  V + +F KV+  NG+L+  TR+ VT  I+FL  +D+I+ L + G+I   G  S++ +    F K  K+    S P  E T                  E I     +  M R +     +  +S        ++ K  L + +              +   ++F  E   V +  Y KY  A G   L   +  + +  +  + ++ WL   TSD                           + +  +  +  + ++G +G  Q IF     L       NASK +H  +L  +L++ + +F  + + +I+N F+ DI  +D  +P  L   + C F ++++  +I    P+F+++I+P+ +LY  +  FY+ ++ Q + L   + SPI+  F+ET+ G PVIRA + ++ F     K ++ N K ++     N WL++RL+ +GN++VF S ++ + Y+N LT   VG  +S +++I   LNW++    ++ETN +A+ER++ +  +++E     DK+    P ++WP+ G+I+F  + ++Y  +    L  I   I+  EK+G+VGRTG+GK+SL   LF+++E  GG ++ID IDI  I + D+R  +T+ PQ+  +FSG +R N+DPFN   D  + +AL L+HL  ++  +   L  +  + G +LS+GQRQLLCL R +LR SKI+VLDEATA+VD ETD LI  TI++ F   T++ IAHR   + D DKI+V+D G+I+E+G   E+++N   ++   K
Sbjct:  188 DSTHAPSATASFLSSVTFSWYDSTVLKGYKHPLTIEDVWDIEENLKAKSLTSKFKTIMTKDLQKARQALQRRLKKSQQSPEGTSHGLTKKQSQSQDVLVLEDSKKKKKKSEATKDFPKSWLVKALFKTFYVVILKSFILKLAHDILLFLNPQLLKFLIGFVKDPDSYPWVGYIYAILMFSVTLIQSFFLQCYFQFCFVLGMTVRTTIIASVYKKALTLSNLARRQYTIGETVNLMSVDSQKLMDVTNYIHLLWSSVLQIALSIFFLWRELGPSILAGVGLMVLL--VPVNGVLATKIRKIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFKEQVNSIRKKELRNLLRFSQLQTILIFILHLT-PTLVSVITFSVYVLVDSQNVLNAEKAFTSITLFNILRFPLAMLPMVISSVIQASVSVDRLEQYLGSDDLD--LSAIRHVCHFDKAVQFSEASFTWDRDLEATIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIAYVPQQAWIQNGTIKDNILFGSEYDEKKYQRVIEACALLPDLEMLPGGDMAEIGEKGINLSGGQKHRVSLARATYQDADIYILDDPLSAVDTHVGKHIFNKVVGPNGLLSGKTRILVTHGIHFLPQVDEIVVLGK-GTILEKGSYSDLMDKKGVFAKNWKTFMKHSGPEGEATVDNDSEEEDGDCGLIPTVEEIPDDAASLTMRRENSLRRTLSRSSRSGSRRGKSL-KSSLKIKSVNALNKKEEVVKGQKLIKKEF-VETGKVKFSIYLKYLQAVGWWSLLFIVIFYVLNYVAFIGTNLWLSAWTSDSE---------------------KQNGTDNSPSQRDMRIGVFGALGIAQGIFLLSSSLWSIYACRNASKTLHRQLLTNILRAPMSFFDTTPTGRIVNRFAGDISTVDDTLPQTLRSWLLCFFGIVSTLVMICMATPIFIIIIIPLSILYVSVQVFYVATSRQLRRLDSVTKSPIYSHFSETVSGLPVIRAFEHQQRFLANSEKQIDTNQKCVFSWITSNRWLAIRLELVGNLIVFCSALLLVIYKNSLTGDTVGFVLSNALNITQTLNWLVRMTSEVETNIVAVERINEYINVDNEAPWVTDKK----PPADWPKKGEIQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLDPFNKYSDEEIWRALELAHLKSFVAGLQLGLLHEVTEGGDNLSIGQRQLLCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRNEFSQCTVITIAHRLHTIMDSDKIMVLDSGKIVEYGSPEELLSNMGPFYLMAK 1531          

HSP 2 Score: 65.855 bits (159), Expect = 4.702e-10
Identity = 65/259 (25.10%), Postives = 117/259 (45.17%), Query Frame = 2
Query: 1796 RSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAV----------------SIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN----GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTE 2512
            +  I+  N    +R + + +LK I  +I   E VG+VG+  +GK+SL N +     IL+ A                  ++G ++ +PQ+P +   + + N+    KY + +    + +  L   +   Q   L+    G D +  S GQRQ + L RAV +KS+I +LD+  +A+D +    + +  I N    +  T + +   ++ +   DKI+ LD +G I  YG    + ++   F  +  E         HTE
Sbjct: 1295 KGEIQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFR---ILESAGGQIIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLDPFNKYSDEEIWRALELAHLKSFVAGLQLGLLHEVTEGGDNL--SIGQRQLLCLGRAVLRKSKILVLDEATAAVD-LETDSLIQTTIRNE--FSQCTVITIAHRLHTIMDSDKIMVLD-SGKIVEYGSPEELLSNMGPFYLMAKEAGIES--VNHTE 1542          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc6 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [Source:MGI Symbol;Acc:MGI:1351634])

HSP 1 Score: 504.982 bits (1299), Expect = 1.922e-152
Identity = 362/1328 (27.26%), Postives = 651/1328 (49.02%), Query Frame = 2
Query:  581 NPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNY--HTKSRRPINE------HSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYS---WIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL-IENKTKNYFSSCQDIRSV---IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI--SNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHK---ILHASIKSK-YHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYF 4492
            NPCPE  +S PS+ +F W    ++  ++  +  +  + +  +  ++      +R+   +      +  H+    P  E       S    L +A++ VF S  ++   ++V    F F+ P +L   L+F+    +  + G+ LA+       L ++ +    +      +++R+AI   VY K + +++ ++ +    +++NL+S D  ++  +I Y    W++      I + F +L+  +G  A   V V +   PLN         +Q E+M  K  R +  + +L  ++ IK + WE  F + +   R +E++ ++  +L   V  + +      V L +   +  +  +  + AE  FV++ +L++L    A LP+ +   +   VS  R++ FL +E    N   +    RS    I + NG+F+W  +S P L  IN+++ +G L+ +VG + +GK+SLL+A++GE+  ++G+VSI+GS++YVPQ  W++  S  +N+   ++      + V+  C L  D+ +  A      G   M  SGGQ+QR++LARAVY+K+ IYLLDDPL+ALDA V+Q+VF++VI  +G+L  TTR+ VT  ++ L   D+I+ L  NG+I   G   ++   N A+  +   + +      A  ++ +          R +CR  +      A +K +   ++ +                 +    +   +E+       V    Y  Y  A G+     ++F F    +      YWL     DP                       +      HA    +  ++GL+G  Q I          LG A AS  +   +L  V +S + +F ++    +LN FSK+ D +D  IP+ L  ++   F ++     +    PL ++ I+P+ +LY      Y+ ++CQ + L     S +     ET QG  V+RA + +  F  +   L+++N +  + + V + WL+  L+ LGN LVF +   A+  +  L+  LVG ++S ++ +   L W++  + DLE + +A+ER+ ++  +  E   +         WP  G+IEF+ F L++  +    +  ++L I  GEK+GIVGRTG+GK+SL   L +L E   G++ ID + I  + +  +R  IT+ PQ+  +F G++R N+D      D  +  AL    L  ++ S+ G L ++C   G  LSVGQ+QLLCLAR +LR ++I++LDEATASVD  T+  +   ++  F   T+L+IAHR   + D  +++VMD G++ E G  ++++    G F
Sbjct:  207 NPCPEAEASFPSKAMFWWASGLLWRGYKKLLGPKDLWSLGRENSSEELVSQLEREWRRSCNGLPGHKGHSSVGAPETEAFLQPERSQRGPLLRAIWRVFRSTFLLGTLSLVISDAFRFAVPKLLSLFLEFMGDRNSSAWTGWLLAVLMFAAACLQTLFEQQHMYRAKVLQMRLRTAITGLVYRKVLVLSSGSRKSSAAGDVVNLVSVDIQRLAESIIYLNGLWLLF---LWIFVCFVYLWQLLGPSALTAVAVFLSLLPLNFFITKKRGFHQEEQMRQKASRARLTSSMLRTVRTIKSHGWEHAFLERLLHIRGQELSALKTSTLLFSVSLVSFQVSTFLVALVVFAVHTLVAEDNAMDAEKAFVTLTVLSILNKAQAFLPFSVHCIVQARVSFDRLAAFLCLEEVDPNGMIASNSRRSSKDRISVHNGTFAWSQESPPCLHGINLTVPQGCLLAVVGPVGAGKSSLLSALLGELLKVEGSVSIEGSVAYVPQEAWVQNTSVVENVCFRQELDLPWLQKVLDACALGSDVASFPAGVHTPIGEQGMNLSGGQKQRLSLARAVYKKAAIYLLDDPLAALDAHVSQQVFKQVIGPSGLLQGTTRILVTHTLHVLPQADRILVL-ANGTIAEMGSYQDLLQRNGALVGLLDGARQPAGTHDAATSDDLGGFPGG---GRPTCRPDRPRPTEAAPVKGRSTSEVQMEASL-------------DDPEATGLTAEEDSVRYGRVKTTIYLSYLRAVGTPLCTYTLFLFLCQQVASFSQGYWLSLWADDP-----------------------VVDGRQMHAALRGW--VFGLLGCLQAIGLFASMAAVFLGGARASGLLFRSLLWDVARSPIGFFERTPVGNLLNRFSKETDTVDVDIPDKLRSLLTYAFGLLEVGLAVTMATPLAIVAILPLMVLYAGFQSLYVATSCQLRRLESARYSSVCSHMAETFQGSLVVRAFRAQASFTAQHDALMDENQRVSFPKLVADRWLATNLELLGNGLVFVAATCAVLSKAHLSAGLVGFSVSAALQVTQTLQWVVRSWTDLENSMVAVERVQDYARIPKEAPWRLPTCAAQPLWPCGGQIEFRDFGLRHRPELPLAVQGVSLKIHAGEKVGIVGRTGAGKSSLAWGLLRLQEAAEGNIWIDGVPITHVGLHTLRSRITIIPQDPVLFPGSLRMNLDLLQEHTDEGIWAALETVQLKAFVTSLPGQLQYECAGQGDDLSVGQKQLLCLARALLRKTQILILDEATASVDPGTEMQMQAALERWFTQCTVLLIAHRLRSVMDCARVLVMDEGQVAESGSPAQLLAQ-KGLF 1488          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q5F364|MRP1_CHICK (Multidrug resistance-associated protein 1 OS=Gallus gallus OX=9031 GN=ABCC1 PE=2 SV=1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 452/1358 (33.28%), Postives = 730/1358 (53.76%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTF-----DVHYQCVADVNTMNFKRKLTSTLKSKNN--YHTKSR-------------------RPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDL-------RTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIH----KILHASIK--SKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + +  PCPE  +S  SRI F W+   +    +  ++++  +     D   + V  +   N+ ++   T +   N  Y +K +                   +P ++ SS   L+K L+  FG   ++S+     H +  F+ P ILK L+ F++    P + G+       +   L ++  +  FH+   T +++++AI   +Y K++ I N A+ T T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G     GV V++   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+KE+ +++  +  + +    W   P  V L+    YV +  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   +            +    I +KN +FSW     P L  IN ++ +G L+ +VG++  GK+SLL+A++GEM   +G V +KGS++YVPQ  WI+  + +DNII  ++  E+ YK VI  C L  DL       RT   ++  GV+    SGGQ+QR++LARAVY  ++ YL DDPLSA+DA V + +FEKVI   GIL N TR+ VT  +N+L  +D I+ + + G I   G    +      F +     + ++   E +++   S        N   ++    K++H  +   S Y +   + Q     +S        +   S   +E    +   V    Y++Y  A G    F S+F F    I  + S+YWL   T DP +                    + T  Y      N  + +YG +G  Q I    + +  S+G   AS+ +H  +L+ VL+S + +F ++ S  +++ FSK+ID IDS IP  +   +   F V+ +  +IL   P+  ++I P+GL+Y ++ +FY+ ++ Q + L   S SP++  FNETL G  VIRA +++K F  +    +++N K  Y   V N WL++RL+F+GN +V  + + A+  RNKL+P L+GL++SYS+ I   LNW++    DLETN +A+ER+  +  ME E         P S WP+ GK+EF+ F L+Y ED    L NIN+ I  GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++ S+   L+ +C + G +LSVGQRQL+CLAR +LR SKI+VLDEATA+VD ETD LI  TIK +F   T+L IAHR + + D  +++V+DRGE++E      ++     ++S  K
Sbjct:  199 SEAVNDPKPCPEFSASFLSRITFWWITGLMIQGHRRPLEAKDLWSLNKEDTSEEIVPGL-AKNWAKEWAKTKRQPLNMLYSSKKQQKSSDSNGEVMEEAEALIIKP-SQRSSEASLSKVLYKTFGPYFLMSFLFKAAHDLLMFTGPEILKLLINFVNNKSAPNWQGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPSVLAGVAVMILLVPINAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMGTFTWVCAPFLVALSTFAVYVKVNKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVEASVSLKRLRVFLSHEELDPDSIIRGPITNAEGSIVVKNATFSWSKTDPPSLNSINFTVPEGSLIAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSIAYVPQQAWIQNATLEDNIIFGREMNESRYKRVIEACALLPDLEILPMGDRTEIGEK--GVN---LSGGQKQRVSLARAVYCNADTYLFDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRVLVTHAVNYLPQMDTILVMTD-GEISEMGSYQELLKQDGAFAEFLRTYANAEQSMESSDASSPSGKEGKPVENGVLVNDATGKLMHRQLSNSSTYSRETGKSQH---QSSTAELQKPLAEKNSWKLTEADTAKTGRVKATVYWEYMKAIGLYISFLSVFLFMCNHIASLASNYWLSLWTDDPVV--------------------NGTQQY-----TNVRLGVYGALGISQGIAVFGYSMAVSIGGIFASRHLHLDLLHNVLRSPMSFFERTPSGNLVSRFSKEIDTIDSTIPPIIKMFMGSTFNVIGACIIILLATPIAAVVIPPLGLVYLLVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEFVGNCIVLFAALFAVIARNKLSPGLIGLSVSYSLQITAYLNWLVRMTSDLETNIVAVERVKEYAEMEKEAEWSIEETAPASTWPQEGKVEFRGFGLRYREDLDLVLKNINITINGGEKVGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPILFSGSLRMNLDPFDQHSDEDIWRSLELAHLKNFVSSLPDKLNHECSEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDNLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVVECDSPDNLLQAKGLFYSMAK 1520          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|O35379|MRP1_MOUSE (Multidrug resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Abcc1 PE=1 SV=1)

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 444/1357 (32.72%), Postives = 732/1357 (53.94%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKRKLTSTLKS---------KNNYHTKSRRPINEHSSVWWLT-------------KALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRS----VIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMK-IKSEKSFSDPFAEHTESIFTSN------NNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGF--GQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   ++  ++S   + ++ +     V  V   N+K++   + K          K+    K    ++ +  V  L              K L+  FG   ++S+     H +  F+ P IL+ ++ F++  E P + G+       ++  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL   FL+  +G     GV V++   PLN++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  + V    W   P  V L+    +V +    ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + I+S     I +KN +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V++KGS++YVPQ  WI+  S ++NI+      EN YK V+  C L  DL    + +    G   +  SGGQ+QR++LARAVY  S+IYL DDPLSA+DA V + +FEKV+   G+L N TR+ VT  I++L  +D II +   G I   G    + +    F + +++  +     A   +S+  S        N ++  ++   H   H S  S  H  +  +Q   +   +       +  L     E    +   V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP ++N T                         A  N+ + +YG +G   G  IF   + +  S+G   AS+ +H  +L  VL+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ I   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP  G++EF+ + L+Y ED    L +IN+ IE GEK+GIVGRTG+GK+SL   LF++ E   G ++ID ++I  I + ++R  IT+ PQ+  +FSG++R N+DPF+   D  +  AL L+HL  ++ ++   L+ +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GE+ E G  SE++     ++S  K
Sbjct:  199 SETVHDRNPCPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDREPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPDWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMS-GGKISEMGSYQELLDRDGAFAEFLRTYANAEQDLASEDDSVSGSGKESKPVENGMLVTDTVGKHLQRHLS-NSSSHSGDTSQQHSSIAELQKAGAKEETWKLM----EADKAQTGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGT------------------------QANRNFRLSVYGALGILQGAAIFG--YSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELLQQRGIFYSMAK 1523          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q8CG09|MRP1_RAT (Multidrug resistance-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Abcc1 PE=1 SV=2)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 443/1364 (32.48%), Postives = 729/1364 (53.45%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKRKLTSTLKS---------KNNYHTKSRRPINEHSSVWWLT-------------KALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR-----SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKII---------------FLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   ++  +KS   + ++ +     V  V   N+K++   + K          K+    K    ++ +  V  L              K L+  FG   ++S+     H +  F+ P IL+ ++ F++  E P + G+       ++  L ++  +  FH+   T +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++ L   FL+  +G     GV V++   P N++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  + V    W   P  V L+    +V +    ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +        I+     + I +KN +F+W  D  P L  I  +I  G LV +VG++  GK+SLL+A++ EM  ++G V++KGS++YVPQ  WI+  S ++NI+  +   E+ YK V+  C L  DL    + +L   G   +  SGGQ+QR++LARAVY  S+IYLLDDPLSA+DA V + +FEKV+   G+L N TR+ VT  I++L  +D II                LD +G+   +  V   +N   D       K+      + ++ +     N ++  ++       H S  S  H +   +Q     +S      S  +  +    E    +   V    Y+ Y  A G    F SIF F    +  + S+YWL   T D   +N T                            N+ + +YG +G  Q +    + +  S+G   AS+ +H  +L  VL+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ I   LNW++    ++ETN +A+ERL  ++  E E + +     P S WP  G++EF+ + L+Y ED    L +IN+ IE GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + ++R  IT+ PQ+  +FSG++R N+DPF+   D  +  AL L+HL  ++ ++   L+ +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F +ST+L IAHR + + D  ++IV+D+GEI E G  SE++     ++S  K
Sbjct:  199 SETVRDPNPCPESSASFLSRITFWWITGMMVQGYRQPLKSSDLWSLNKEDTSEEVVPVLVNNWKKECVKSRKQPVRIVYAPPKDPTKPKGSSQLDVNEEVEALIVKSSHKDRDPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPEILELIINFVNDREAPDWQGYLYTALLFVSACLQTLALHQYFHICFVTGMRIKTAVVGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVTLALYFLWLNLGPSVLAGVAVMILMVPFNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMNIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDEKNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERWSIKDGGGMNSITVKNATFTWARDEPPTLNGITFAIPDGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGRPLQEHCYKAVMEACALLPDLEILPSGDLTEIGEKGVNLSGGQKQRVSLARAVYCNSDIYLLDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLDRDGAFAEF--VRTYANTEQDLASEDDSKNGVSGLGKESKPV----ENGILVTDAVGKPLQRHLS-NSSSHSVVTNQQH----SSTAELQKSGVKEETWKLMEADKAQTGQVKLSVYWNYMKAIGLCISFLSIFLFLCNHVSALASNYWLSLWTDDRPAVNGT------------------------QENRNFRLSVYGALGILQGVAVFGYSMAVSIGGIFASRRLHLDLLQNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEASWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDSTVLTIAHRLNTIMDYTRVIVLDKGEIRECGAPSELLQQRGVFYSMAK 1527          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|P33527|MRP1_HUMAN (Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3)

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 447/1367 (32.70%), Postives = 733/1367 (53.62%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVADVNTMNFKRKLTSTLK--------SKNNYHTKSRRPINEHSSVW----------W---LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIR-----SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKI---------KSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIK-----SKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  I + NPCPE  +S  SRI F W+   I   ++  ++    + ++ +     V  V   N+K++   T K        SK+    K    ++ +  V           W   L K L+  FG   ++S+     H +  FS P ILK L+KF++  + P + G+   +   +T  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G   LA + V+VLM   P+N++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  S V    W   P  V L     YV I  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +      + ++     + I ++N +F+W     P L  I  SI +G LV +VG++  GK+SLL+A++ EM  ++G V+IKGS++YVPQ  WI+  S ++NI+   +  E  Y++VI+ C L  DL    + +    G   +  SGGQ+QR++LARAVY  ++IYL DDPLSA+DA V + +FE VI   G+L N TR+ VT ++++L  +D II +   G I   G    + + D    +F++            E   +       E+    N   V +    ++ + L +S       S++H      Q            +   +  +    E    +   V    Y+ Y  A G    F SIF F    +  + S+YWL   T DP                       +      H      + +YG +G  Q I    + +  S+G   AS+ +H  +L+ +L+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  VIL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ +   LNW++    ++ETN +A+ERL  ++  E E   +     P S WP+ G++EF+ + L+Y ED  F L +IN+ I  GEK+GIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L  +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GEI E+G  S+++     ++S  K
Sbjct:  199 SETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLM--VPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMS-GGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQ-----------KAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-----------------------IVNGTQEHTKVR--LSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAK 1526          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q8HXQ5|MRP1_BOVIN (Multidrug resistance-associated protein 1 OS=Bos taurus OX=9913 GN=ABCC1 PE=1 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 448/1369 (32.72%), Postives = 735/1369 (53.69%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVADVNTMNFKRKLTSTLK--------SKNNYHTK--SRRPINEHSSVWW-----------LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSV-----IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKI---------KSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIK-----SKYHQ--INIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  I + NPCPE  +S  SRI F W+   +   ++  ++S   + ++ +     V  V   N+K++   + K        SK+    K  S+  +NE +               L K L+  FG   ++S+     H +  F+ P ILK L+ F++  + P + G+       I+  L ++  +  FH+   + +++++A+  AVY K++ I N A+ + T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G   LA + V+VLM   PLN++     + YQ   M+ KD RIK M E+LN +KV+KLY+WE  F   +   R++E+ +++  +  + V    W   P  V L+    YV +  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL            + I+       I +KN +F+W  +  P L  I  S+ +G LV +VG++  GK+SLL+A++ EM  ++G V++KGS++YVPQ  WI+ IS ++NI+  ++  E  YK V+  C L  DL    + +    G   +  SGGQ+QR++LARAVY  S++YLLDDPLSA+DA V + +FE VI   G+L N TRL VT  I++L  +D II +   G I   G    + + D    +F++          + E   +       E     N   V +    ++ + L +S       S++H     +RK                    +    E    +   V    Y+ Y  A G    F SIF F    +  ++S+YWL   T DP                       +      H      + +YG +G  Q I    + +  S+G   AS+ +H  +L+ VL+S + +F ++ S  ++N FSK++D +DS+IP  +   +  +F V+ +  +IL   P+  ++I P+GL+YF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA ++++ F  +    +++N K  Y   V N WL++RL+ +GN +V  + + A+  R+ L+  LVGL++SYS+ +   LNW++    ++ETN +A+ERL  ++  E E   +     P  +WP+ G++EF+ + L+Y ED    L +IN+ I+ GEK+GIVGRTG+GK+SL   LF++ E   G ++IDDI+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L+ +C + G +LSVGQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IV+D+GEI E+G  S+++     ++S  K
Sbjct:  199 SETINDPNPCPESSASFLSRITFWWITGMMVQGYRQPLESTDLWSLNKEDTSEQVVPVLVKNWKKECAKSRKQPVKIVYSSKDPAKPKGSSKVDVNEEAEALIVKCPQKERDPSLFKVLYKTFGPYFLMSFLFKAVHDLMMFAGPEILKLLINFVNDKKAPEWQGYFYTALLFISACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLM--VPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVYVTVDENNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRVFLSHEDLDPDSIQRRPIKDAGATNSITVKNATFTWARNDPPTLHGITFSVPEGSLVAVVGQVGCGKSSLLSALLAEMDKVEGHVTVKGSVAYVPQQAWIQNISLRENILFGRQLQERYYKAVVEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCDSDVYLLDDPLSAVDAHVGKHIFENVIGPKGLLKNKTRLLVTHAISYLPQMDVIIVM-SGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQGQPEDGLAGVGGPGKEVKQMENGMLVTDTAGKQMQRQLSSSSSYSRDVSQHHTSTAELRKP--------------GPTEETWKLVEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFLCNHVASLVSNYWLSLWTDDP-----------------------IVNGTQEHTQVR--LSVYGALGISQGITVFGYSMAVSIGGIFASRRLHLDLLHNVLRSPISFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFNVIGACIIILLATPMAAVIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFASLFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQDMAPPKDWPQVGRVEFRDYGLRYREDLDLVLKHINVTIDGGEKVGIVGRTGAGKSSLTLGLFRIKESAEGEIIIDDINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFDDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEWGSPSDLLQQRGLFYSMAK 1525          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A093SCZ8 (Multidrug resistance-associated protein 1 (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_09668 PE=4 SV=1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 459/1353 (33.92%), Postives = 736/1353 (54.40%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTF----DVHYQCVADVNTMNFKRKLTSTLK---------SKNNYHTKSRRPINEH-----------SSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDL--DFDLRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI-SNDAI--DFMKI--KSEKSF--SDPFAEHTESIFTSNNNCVMNRNSCRI-HKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   +++ ++++  +    D   + +  V   N+ ++ + T +          K    + S   + E            SS   L K L+  FG   ++S+     H +  F+ P ILK LL F++    P + G+   +   +   L ++  +  FH+   T +++++AI   +Y K++ I N A+ T T  EI+NLMS D  + +    Y  ++ S+PF++IL    L+  +G     GV V++   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+KE+ +++  +  + +    W   P  V L+    YV +  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   +            +    I +KN +FSW     P+L  IN ++ +G LV +VG++  GK+SLL+A++GEM   +G V +KGS++YVPQ  W++  + +DNII  ++  E+ YK VI +C L  D ++  +      G   +  SGGQ+QR++LARAVY  +++YLLDDPLSA+DA V + +FEKVI   GIL N TRL VT  IN+L  +D I+ + + G I   G    +   D    +F++    +E+S   SD  +  T+      N  ++N    ++ H+ L  S  S Y +   + Q     +S        +   S    E    +   V    Y+ Y  A G    F SIF F    I  + S+YWL   T DP I                    + T  Y      +  + +YG +G  Q I    + +  S+G   AS+ +H  +L+ VL+S + +F ++ S  ++N FSK+ID IDS IP  +   +  +F V+ +  VIL   P+  ++I P+GL Y  + +FY+ ++ Q + L   S SP++  FNETL G  +IRA +++K F  +    +++N K  Y   V N WL++RL+++GN +V  + + A+  RNKL+  LVGL++SYS+ I   LNW++    ++ETN +A+ER+  +  ME E         P S WP  GKIEF+ + L+Y ED    L NIN+ I  GEKIGIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++ S+   L+ +C + G +LSVGQRQL+CLAR +LR SKI+VLDEATA+VD ETD+LI  TIK +F   T+L IAHR + + D  +++V++RGE++E G   +++     ++S  K
Sbjct:  182 SETVNDPNPCPEFSASFLSRITFWWITGLMIQGYRSPLEAKDLWSLNKDDKSEQIVPVLARNWAKEWSKTKRRPLDMLYAPKKQQKSSDSNGDVTEEAEALIIKPSQKSSEASLFKVLYKTFGPYFLMSFLFKAGHDLLMFAGPEILKLLLNFVNNKAAPDWQGYFYTVLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRFMDLATYINMIWSAPFQVILALYLLWQNLGPSVLAGVAVMILLVPINAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELQVLKKSAYLAAMATFTWVCAPFLVALSTFAVYVTVNKNNILDAQKAFVSLALFNILRFPLNMLPMVISNIVEASVSLKRLRVFLSHEELDPDSIIRGPMPEAEGCIVVKNATFSWSKTDSPLLNSINFTVPEGSLVAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSVAYVPQQAWVQNATLEDNIIFGREMNESRYKRVIEVCALLPDIEILPSGDKTEIGEKGVNLSGGQKQRVSLARAVYCNADVYLLDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRLLVTHAINYLPQMDTILVMTD-GEISEMGSYQELLEQDGAFAEFLRTYANAEQSMENSDTNSPSTKEGKPVENGVLVNEAPGKLMHRQLSNS--STYSRDTGKSQ---QQSSTAELQKPLAEKNSWKLMEADTAKTGRVKASVYWDYMKAIGLFMSFLSIFLFLCNHIASLASNYWLSLWTDDPVI--------------------NGTQQY-----TDVRLGVYGALGISQGIAVFGYSMVVSIGGIFASRHLHHNLLHNVLRSPMSFFERTPSGNLVNRFSKEIDTIDSTIPPIIKMFMGSMFNVIGACIVILLATPIAAVIIPPLGLAYLFVQRFYVTTSRQLKRLESVSRSPVYSHFNETLLGVSIIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEYVGNFIVLFAALFAVIARNKLSAGLVGLSVSYSLQITAYLNWLVRMSSEVETNIVAVERVKEYTEMEKEAEWSIEQTAPASTWPEEGKIEFRGYGLRYREDLDLVLKNINVTINGGEKIGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPILFSGSLRMNLDPFDQHSDEDIWRSLELAHLKNFVSSLPDKLNHECAEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDKLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLERGEVVECGSPEQLLRERGIFYSMAK 1503          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A091QFK8 (Multidrug resistance-associated protein 1 (Fragment) OS=Leptosomus discolor OX=188344 GN=N330_00597 PE=4 SV=1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 455/1361 (33.43%), Postives = 735/1361 (54.00%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ--------CVA-------------DVNTMNFKRKLTSTLKSKNNYHTKSRRPI---NEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFD---LRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSD---PFAEHTESIFTSNNNCVMNRNSCRIH----------KILHASIK--SKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   ++  ++++  + ++ +        C+A              +N +   +K   +  S  +   ++   I   ++ SS   L K L+  FG   ++S+     H +  F+ P IL+ L+ F++    P + G+       +   L ++  +  FH+   T +++++AI   +Y K++ I N A+ T T  EI+NLMS D  + +    Y  ++ S+P ++IL    L+  +G     GV V++   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+KE+ +++  +  + +    W   P  V L+    YV +  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   +            +    I +KN +FSW  +  P L  IN ++ +G LV +VG++  GK+SLL+A++GEM   +G V +KGS++YVPQ  W++  + + NII  ++  EN YK+VI  C L  D   L T    E+ G   +  SGGQ+QR++LARAVY  +++YL DDPLSA+DA V + +FEKVI   GIL N TR+ VT  +N+L  +D I+ + + G I   G    +         +K + +F++    +A   +SI  S+ N    +    +           K++H  +   S Y +   + Q     +S        +   S   +E    +   V    Y++Y  A G L  F SIF F    +  + S+YWL   T DP I                    + T  Y      N  + +YG +G  Q I    + +  S+G   AS+ +H  +L+ VL+S + +F ++ S  ++N FSK+ID IDS IP  +   +   F V+ +  VIL   P+  ++I P+GL+YF + +FY+ ++ Q + L   S SPI+  FNETL G  VIRA +++  F  +    +++N K  Y   V N WL++RL+++GN +V  + + A+  RNKL+  LVGL++SYS+ I   LNW++    +LETN +A+ER+  +  ME E         P S WP  GK+EF+ + L+Y ED    L NIN+ I  GEKIGIVGRTG+GK+SL   LF++ E   G ++ID ++I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++ S+   L+ +C + G +LSVGQRQL+CLAR +LR SKI+VLDEATA+VD ETD+LI  TIK +F   T+L IAHR + + D  +++V+DRGE++E G    ++     ++S  K
Sbjct:  183 SETVNDPNPCPEFSASFLSRITFWWITGLMVQGYRRPLEAKDLWSLNKEDKSEEIVPCLARNWAKEWAKTKRQPLNMLYLPKKQQKSSDSNGDVTEEAEALIIKPSQKSSEASLFKVLYKTFGPYFLMSFLFKAAHDLLMFAGPEILRLLINFVNNKGAPNWHGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWQNLGPSVLAGVAVMILLVPINAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMATFTWVCAPFLVALSTFAVYVTVGKNNILDAQRAFVSLALFNILRFPLNMLPMVISSIVEASVSLKRLRVFLSHEELDPDSIIRGPITEAEGCIVVKNATFSWSKNDPPSLNSINFTVPEGSLVAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSVAYVPQQAWVQNATLEANIIFGREMNENRYKHVIEACALLPDIEILPTGDKTEI-GEKGVNLSGGQKQRVSLARAVYCNADVYLFDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRVLVTHAVNYLPQMDTILVMSD-GEISEMGSYQEL---------LKQDGAFAEFLRTYANAEQSIENSDTNSPSGKEGKPLENGVLLNEAPGKLMHRQLSNSSTYSRDTGKSQH---QSSTAELQKPLAEKNSWKLTEADTAKTGRVKATVYWEYMKAIGLLISFLSIFLFVCNHVAALASNYWLSLWTDDPVI--------------------NGTQQY-----TNVRLGVYGALGISQGIAVFGYSMIVSIGGIFASRHLHLNLLHSVLRSPMSFFERTPSGNLVNRFSKEIDTIDSTIPPIIKMFMGSTFNVIGACIVILLATPIAAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPIYSHFNETLLGVSVIRAFEEQNRFIKQNDVKVDENQKAYYPSIVANRWLAVRLEYVGNCIVLFAALFAVIARNKLSAGLVGLSVSYSLQITAYLNWLVRMSSELETNIVAVERVKEYAEMEKEAEWSVEHTVPASTWPEEGKVEFRGYGLRYREDLDLVLKNINVTINGGEKIGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGVNIAKIGLHDLRFKITIIPQDPILFSGSLRMNLDPFDQHSDEDIWRSLELAHLKNFVSSLPDKLNHECAEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDKLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVVECGSPDHLLQEKGIFYSMAK 1504          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A093CK56 (Multidrug resistance-associated protein 1 (Fragment) OS=Tauraco erythrolophus OX=121530 GN=N340_00306 PE=4 SV=1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 462/1355 (34.10%), Postives = 736/1355 (54.32%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQC----VADVNTMNFKRKLTSTLKSKNN--YHTKSR-------------------RPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFD---LRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKI-----KSEKSF--SDPFAEHTESIFTSNNNCVMNRNSCR-IHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   ++  ++++  + ++ +     V      N+ ++   T +   N  Y +K +                   +P ++ SS   L K L+  FG   ++S+     H +  F+ P ILK L+ F++    P + G+       +   L ++  +  FH+   T +++++AI   +Y K++ I N A+   T  EI+NLMS D  + +  + Y  ++ S+P ++IL    L+  +G     GV V++   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+KE+ +++  +  + +    W   P  V L+    YV I  N V+ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   +         S  +    I +KN +FSW  +  P+L  IN ++ +G LV +VG++  GK+SLL+A++GEM   +G V +KGS++YVPQ  W++  + +DNII  K+  E+ YK VI  C L  D   L T    E+ G   +  SGGQ+QR++LARAVY  ++I LLDDPLSA+DA V + +F+KVI   GIL N TR+ VT  IN+L  +D I+ + + G I   G    +      F +       +E+S   SD  +   +      N  ++N  S + +H+ L  S  S Y +   + Q     +S        +   S    E    +   V    Y++Y  A G    F SIF F    I  + S+YWL   T DP I                    + T  Y      +  + +YG +G  Q I    + +  S+G   AS+ +H  +L+ VL+S + +F ++ S  ++N FSK+ID IDS IP  +   +   F V+ +   IL   P+  ++I P+GL+Y ++ +FY+ ++ Q + L   S SP++  FNETL G  VIRA +++K F  +    +++N K  Y   V N WL++RL+++GN +V  + + A+  RNKL+  LVGL++SYS+ I   LNW++    DLETN +A+ER+  ++ ME E         P S WP  GK+EF+ + L+Y ED    L NIN+ I  GEKIGIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++ S+   L+ +C + G +LSVGQRQL+CLAR +LR SKI+VLDEATA+VD ETD+LI  TIK +F   T+L IAHR + + D  +++V+DRGE++E G   +++     ++S  K
Sbjct:  182 SETVNDPNPCPEFSASFLSRITFWWITGLMIQGYRRPLEAKDLWSLNKEDKSEEVVPGLARNWAKEWAKTKRQPLNMLYSSKKQQKSSDSNGDATEEAEALIIKP-SQKSSEASLFKVLYKTFGPYFLMSFLFKAAHDLLMFAGPQILKLLINFVTNKAAPNWQGYFYTGLMFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKASTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVILALYLLWQNLGPSVLAGVAVMILLVPVNAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMATFTWVCAPFLVALSTFAVYVKINKNNVLDAQKAFVSLALFNILRFPLNILPMVISSIVEASVSLKRLRVFLSHEELDPDSIVRGSVTEPEGSIVVKNATFSWSKNDPPLLNSINFTVPEGSLVAVVGQVGCGKSSLLSALLGEMDKKEGHVVVKGSVAYVPQQAWVQNATLEDNIIFGKEKNESRYKCVIEACALLPDIEILPTGDKTEI-GEKGVNLSGGQKQRVSLARAVYCNADICLLDDPLSAVDAHVGKHIFDKVIGPKGILKNKTRVLVTHAINYLPQVDTILVMTD-GEISEMGSYQELLKQDGAFAEFLRTYANAEQSMENSDTNSPSGKEGKPVENGVLVNEASGKLVHRQLSNS--STYSRDTGKSQH---QSSTAELQKPLAEKNSWKLMEADTAKTGRVKATVYWEYMKAIGLFISFLSIFLFMCNHIASLASNYWLSLWTDDPVI--------------------NGTQQY-----TDVRLGVYGALGVSQGIAVFGYSMVVSIGGIIASRHLHLNLLHDVLRSPMSFFERTPSGNLVNRFSKEIDTIDSTIPPVIKMFMGSTFNVIGACISILLATPIAAIIIPPLGLIYLLVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEYVGNCIVLFAALFAVMARNKLSAGLVGLSVSYSLQITAYLNWLVRMTSDLETNVVAVERVKEYSEMEKEAEWSIEQTAPASTWPEEGKVEFRGYGLRYREDLDLVLKNINVTINGGEKIGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFDQHSDEDIWRSLELAHLRNFVSSLPDKLNHECAEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDKLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVVECGSPDDLLQEKGIFYSMAK 1503          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A091S8C9 (Multidrug resistance-associated protein 1 (Fragment) OS=Nestor notabilis OX=176057 GN=N333_07742 PE=4 SV=1)

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 453/1366 (33.16%), Postives = 727/1366 (53.22%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPIN------------------------------EHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSD---PFAEHTESIFTSNNNCVMNRNSCRIH----------KILHASIK--SKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   ++  ++++  + ++ +  ++       R  T        +    R+P+N                              + SS   L K L+  FG   ++S+     H +  F+ P ILK L++F++    P + G+       +   L ++  +  FH+   T +++++AI   +Y K++ I N A+ T T  EI+NLMS D  + +    Y  ++ S+PF++IL    L+  +G     GV V++   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+KE+ +++  +  + +    W   P  V L+    YV I  N ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   +        S        I +KN +FSW  +  P L  IN ++ +G LV +VG++  GK+SLL+A++GEM   +G V +KGS++YVPQ  W++  + +DNII  ++  E+ YK VI  C L  D+    A +    G   +  SGGQ+QR++LARAVY  +++ L DDPLSA+DA V + +FE VI   GIL N TR+ VT  IN+L  +D I+ + + G I   G    +         +K + +F++    +A   +S+  S+ N    +    +           K++H  +   S Y +   + Q    ++S        +   S   +E    +   V    Y+ Y  A G    F SIF F    I  + S+YWL   T DP I                    + T  Y      N  + +YG +G  Q I    + +  S+G   AS+ +H  +L+ VL+S + +F ++ S  ++N FSK++D IDS IP  +   +   F V+ +  +IL   P+  ++I P+GL+Y  + +FY+ ++ Q + L   S SP++  FNETL G  VIRA +++K F  +    +++N K  Y   V N WL++RL+++GN +V  + + A+  RNKL+  LVGL++SYS+ I   LNW++    +LETN +A+ER+  +  ME E         P S WP  GKIEF+ + L+Y ED    L NIN+ I  GEKIGIVGRTG+GK+SL   LF++ E   G ++ID ++I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ S+   L+ DC + G +LSVGQRQL+CLAR +LR SKI+VLDEATA+VD ETD+LI  TIK +F   T+L IAHR + + D  +++V+DRGE++E G    ++     ++S  K
Sbjct:  183 SETVNDPNPCPEFSASFLSRITFWWITGLMVQGYRRPLEAKDLWSLNKEDKSEEIVPGLARNWT------KEWAKAKRQPLNIVYSPKKQQKPSDSNGDVTEEAEALIIKPSQKSSEASLFKVLYKTFGPYFLMSFLFKAAHDLLMFAGPEILKLLIRFVNNKAAPDWQGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRFMDLATYINMIWSAPFQVILALYLLWQNLGPSVLAGVAVMILLVPVNAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMATFTWVCAPFLVALSTFAVYVTIDKNNILDAQKAFVSLALFNILRFPLNMLPMVISSIVEASVSLKRLRVFLSHEELDPDSIIRSPITAAEGCIVVKNATFSWSKNDPPFLNSINFTVPEGSLVAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSVAYVPQQAWVQNATLQDNIIFGREVNESRYKRVIEACALLPDIEILPAGDKTEIGEKGVNLSGGQKQRVSLARAVYCNADVCLFDDPLSAVDAHVGKHIFENVIGPKGILKNKTRVLVTHAINYLPQMDTILVMSD-GEISEMGSYQEL---------LKQDGAFAEFLRTYANTEQSMENSDTNSPSGKEGKPVENGILVNEAPGKLMHRQLSNSSTYSRDTGKSQH---HSSTAELQKPLAEKNSWKLTEADTAKTGRVKATVYWDYMKAIGLFISFLSIFLFMCNHIASLASNYWLSLWTDDPVI--------------------NGTQQY-----TNVRLGVYGALGISQGIAVFGYSMVVSIGGIFASRHLHLNLLHSVLRSPMSFFERTPSGNLVNRFSKELDTIDSAIPPIIKMFMGSTFNVIGACIIILLATPIAAVIIPPLGLVYLFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQKRFIKQNDIKVDENQKAYYPSIVANRWLAVRLEYVGNCIVLFAALFAVMARNKLSAGLVGLSVSYSLQITAYLNWLVRMSSELETNIVAVERVKEYAEMEKEAEWSIEQTAPASTWPEEGKIEFRGYGLRYREDLDLVLKNINVTINGGEKIGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGVNIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFDQRSDEDIWTSLELAHLKNFVSSLPDKLNHDCAEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDKLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVVECGSPEHLLQQKGIFYSMAK 1504          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A091GNP1 (Multidrug resistance-associated protein 1 (Fragment) OS=Cuculus canorus OX=55661 GN=N303_11864 PE=4 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 451/1353 (33.33%), Postives = 731/1353 (54.03%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVAD---------------------VNTMNFKRKLTSTLKSKNNYHTKSRRPI---NEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFD---LRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDEN--GSIKYYGDVSNISNDAIDFMKI--KSEKSF--SDPFAEHTESIFTSNNNCVMNRNSCR-IHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  + + NPCPE  +S  SRI F W+   +   ++  ++++  + +H +  ++                     +N +   +K   +  SK +   ++   I   ++ SS   L KAL+  FG   ++S+     H +  F+ P ILK L+ F++    P + G+       +   L ++  +  FH+   T +++++A+   +Y K++ I N A+ T T  EI+NLMS D  +++    Y  ++ S+PF++IL    L+  +G     GV V++   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +   R+KE+ +++  +  + +    W   P  V L+    YV      ++ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   +            +    I +KN +FSW  +  P L  IN ++ +G L+ +VG++  GK+SLL+A++GEM   +G V +KGS++YVPQ  W++  + +DNII  ++  EN YK VI  C L  D   L T    E+ G   +  SGGQ+QR++LARAVY  +++YL DDPLSA+DA V + +FEKVI   GIL N TR+ VT  +N+L  +D I+ + E     +  Y D+        +F++    +E+S   SD  +   +      N  ++N    + IH+ L  S          ++Q     +S        +   S   +E    +   V    Y+ Y  A G      S+F F    I  + S+YWL   T DP +                    + T  Y      N  + +YG +G  Q I    + +  S+G   AS+ +H  +L+ VL+S + +F ++ S  ++N FSK+ID IDS IP  +   +   F V+ +  +IL   P+  ++I P+GL+Y  + +FY+ ++ Q + L   S SP++  FNETL G  VIRA +++K F  +    +++N K  Y   V N WL++RL+F+GN +V  + + A+  RNKL+  LVGL++SYS+ I   LNW++    +LETN +A+ER+  +  ME E         P S WP  GK+EF+ + L+Y ED    L NIN+ I  GEKIGIVGRTG+GK+SL   LF++ E   G ++ID I+I  I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  + ++L L+HL  ++ S+   L+ +C + G +LSVGQRQL+CLAR +LR SKI+VLDEATA+VD ETD+LI  TIK +F   T+L IAHR + + D  +++V++RG+++E G    ++     ++S  K
Sbjct:  186 SETVNDPNPCPEFSASFLSRITFWWITGLMVQGYRRPLEAKDLWSLHKEDKSEEIVPGLARNWAKEWAKTKRQPLNMLYSLKKQQKSSDSKGDVTEEAEALIIKPSQKSSEASLFKALYKTFGPYFLMSFLFKAAHDLLMFAGPEILKLLINFVNNKAAPDWQGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAVVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRLMDLATYINMIWSAPFQVILALCLLWQNLGPSVLAGVAVMILLVPINAVMAMKTKTYQVAQMKCKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMATFTWVCAPFLVALSTFAVYVTTDKKNILDAQKAFVSLALFNILRFPLNMLPMVISSIVEASVSLKRLRVFLSHEELDPDSIIRGPITEAEGCIVVKNATFSWSKNDPPSLNSINFTVPEGSLIAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSVAYVPQQAWVQNATLQDNIIFGREMNENRYKRVIEACALIPDIEVLPTGDKTEI-GEKGVNLSGGQKQRVSLARAVYCNADVYLFDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRVLVTHAVNYLPQMDTILVMTEGEISEMGSYQDLLKQDGAFAEFLRTYANTEQSMENSDTNSPSGKEGKPVENGVLVNEAPGKLIHRQLSNSSTCSRDTGKSQQQ-----SSTAELQKPLAEKNSWKLTEADTAKTGRVKVTVYWDYMKALGLFISSFSVFLFMCNHIAALASNYWLSLWTDDPVV--------------------NGTQQY-----TNVRLGVYGALGTSQGIAVFGYSMAVSIGGIFASRHLHLNLLHSVLRSPMSFFERTPSGNLVNRFSKEIDTIDSTIPPIIKMFMGSTFNVIGACIIILLATPIAAVIIPPLGLVYLFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGVTVIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEFVGNCIVLFAALFAVMARNKLSAGLVGLSVSYSLQITAYLNWLVRMSSELETNIVAVERVKEYTEMEKEAEWSIEQTAPASTWPEEGKVEFRGYGLRYREDLDLVLKNINVTINGGEKIGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFDQHSDEDIWRSLELAHLKNFVSSLPDKLNHECAEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDQLIQSTIKSQFKECTVLTIAHRLNTIMDYTRVLVLERGKVVECGSPEHLLQEKGIFYSMAK 1507          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 453/1356 (33.41%), Postives = 735/1356 (54.20%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVA-----------DVNTMNFKRKLTSTL---KSKNNYHTKSRRPINE----------HSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFG-FTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSV------IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFL-----DENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  ++++NPCPE  +S  SRI F W+   +   ++  ++ +  + ++ +  +           D      KR    T+   K  +    K  RP+ E           S    L  AL   FG   ++S    + H +  F  P IL+ L++F++  + P + G F  A+ F+ T   + I Q   FH+   T +++R+AI  AVY K++ I N A+ T T  EI+NLMS D  + +  I Y  ++ S+P ++IL   FL+  +G   LA + V+VLM   P+N++     + YQ  +M+ KD RIK M EVLN +KV+KLY+WE  F   +S  RE E+ +++  +    +    W   P  V L+    YV +  + V+ A+  FVS+ L N+LR P+ +LP  I+  +   VS+KR+ +FL   +      +  D R++      I I +G+FSW  +  P LKRIN+ I +G LV +VG + SGK+SLL+A++GEM   +G VSIKGS++YVPQ  WI+  + ++NI+  ++  E+ Y+ V+  C L  DL      +    G   +  SGGQ+QR++LARAVY    +YLLDDPLSA+DA V + +FEKVI   G+L   TR+ VT  ++FL   D I+ +      E GS   Y ++ N      DF++  +         +  E    +     + RN+  +H     S  S       + Q    +N    K + +  +   ++++  +T    V    +++Y  A G    F SI  F    +  + S+YWL   T DP I                              +    + +YG +G  Q I    + ++ S+G   AS+ +H+ ML  VL+S + +F ++ S  ++N F+K+ D IDS+IP+ +   +  +F V+ S  VIL   PL  ++I P+GLLYF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA  +++ F  E  + ++ N K  +   V N WL++RL+F+GN +V  + + A+  R  L+P ++GL+ISY++ +   LNW++    ++ETN +A+ER+  +   E E   K       + WP  G IE + F L+Y ED +  +++I ++IE GEK+GIVGRTG+GK+SL   LF+++E   G + ID ++I ++ + D+R  IT+ PQ+  +FSG++R N+DPF+   D  + +AL L+HL  ++  +   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  +++V+D+G++ EF   + +I     ++   K
Sbjct:  199 SQAVKDSNPCPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPSWHGYFYTALLFVCTCFQTLILQKY-FHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLM--VPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDE---NSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGS---YTELLNRQGAFADFLRTYANAE------QDGEPDGMTGKKEKLQRNTTFVHFFPRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANT--GRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVI-------------------------NGTQPSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAKKGIFYKMAK 1512          

HSP 2 Score: 84.3445 bits (207), Expect = 9.611e-16
Identity = 60/230 (26.09%), Postives = 110/230 (47.83%), Query Frame = 2
Query: 3830 YVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLY 4510
            + ++ +  L  IN+ I  G  + +VG  GSGK+SL+ +L   +    G +              ++ ++   PQ++ I + T+R+NI      ++   ++ L    L P LE + G    + G+ G +LS GQ+Q + LAR +  +  + +LD+  ++VD    + I E +   +      T +++ H  S L   D I+VM  GEI E G  +E++N    +    + Y
Sbjct:  650 WSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDV-------------SIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGSYTELLNRQGAFADFLRTY 866          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 447/1351 (33.09%), Postives = 726/1351 (53.74%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVA-----------DVNTMNFKRKLTSTL---KSKNNYHTKSRRPINE----------HSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFG-FTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSV------IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  ++++NPCPE  +S  SRI F W+   +   ++  ++ +  + ++ +  +           D      KR    T+   K  +    K  RP+ E           S    L  AL   FG   ++S    + H +  F  P IL+ L++F++  + P + G F  A+ F+ T   + I Q   FH+   T +++R+AI  AVY K++ I N A+ T T  EI+NLMS D  + +  I Y  ++ S+P ++IL   FL+  +G   LA + V+VLM   P+N++     + YQ  +M+ KD RIK M EVLN +KV+KLY+WE  F   +S  RE E+ +++  +    +    W   P  V L+    YV +  + V+ A+  FVS+ L N+LR P+ +LP  I+  +   VS+KR+ +FL   +      +  D R++      I I +G+FSW  +  P LKRIN+ I +G LV +VG + SGK+SLL+A++GEM   +G VSIKGS++YVPQ  WI+  + ++NI+  ++  E+ Y+ V+  C L  DL      +    G   +  SGGQ+QR++LARAVY    +YLLDDPLSA+DA V + +FEKVI   G+L   TR+ VT  ++FL   D I+ +  +G I   G  + + N    F       + ++   E       +    + N     + +   +S+ +       +K       S   +        +   +E        V    +++Y  A G    F SI  F    +  + S+YWL   T DP I                              +    + +YG +G  Q I    + ++ S+G   AS+ +H+ ML  VL+S + +F ++ S  ++N F+K+ D IDS+IP+ +   +  +F V+ S  VIL   PL  ++I P+GLLYF + +FY+ S+ Q + L   S SP++  FNETL G  VIRA  +++ F  E  + ++ N K  +   V N WL++RL+F+GN +V  + + A+  R  L+P ++GL+ISY++ +   LNW++    ++ETN +A+ER+  +   E E   K       + WP  G IE + F L+Y ED +  +++I ++IE GEK+GIVGRTG+GK+SL   LF+++E   G + ID ++I ++ + D+R  IT+ PQ+  +FSG++R N+DPF+   D  + +AL L+HL  ++  +   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  +++V+D+G++ EF   + +I     ++   K
Sbjct:  199 SQAVKDSNPCPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPSWHGYFYTALLFVCTCFQTLILQKY-FHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLM--VPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDE---NSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVM-VDGEITETGSYTELLNRQGAFADFLRTYANAEQDGEPDGMTDGAPRKTLENGGPAAVLRQSQSSLNTPGAAKPQQK-----AESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVI-------------------------NGTQPSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAKKGIFYKMAK 1512          

HSP 2 Score: 84.3445 bits (207), Expect = 1.037e-15
Identity = 60/230 (26.09%), Postives = 110/230 (47.83%), Query Frame = 2
Query: 3830 YVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLY 4510
            + ++ +  L  IN+ I  G  + +VG  GSGK+SL+ +L   +    G +              ++ ++   PQ++ I + T+R+NI      ++   ++ L    L P LE + G    + G+ G +LS GQ+Q + LAR +  +  + +LD+  ++VD    + I E +   +      T +++ H  S L   D I+VM  GEI E G  +E++N    +    + Y
Sbjct:  650 WSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDV-------------SIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGSYTELLNRQGAFADFLRTY 866          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 432/1372 (31.49%), Postives = 723/1372 (52.70%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTS---------------TLKSKNNYHT--------------KSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENK--TKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKII---------------FLDENGS----IKYYGDVSNISNDAIDFMKIKSEKSFS-DPFAEHTESIFTSNNNCVMN---RNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +SV+ + NPCPE  +   SR+ F W        +++ ++++  + ++ Q  +++      R+                   + SK    T               S++   + S      ++L   FG   +I     +   + +F  P +L+ L++F      P ++GF LA       +L ++  +  F     T +++R+AI  A+Y KS+ I NEAK + T  E++NLMS D  + +    +  ++ S+P +IIL   FL+  +G     GV V++   P N++     + YQ E+M++KD RIK M E+LN +KV+KLY+WE  F + + + R+KE+N++R  +  S +  + W + P  V LT    YV++  N V+ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+  FL  ++    N           + + NG FSW     P L+ IN+ + +G L+ +VG +  GK+SL+ A++GEM  L+G +SI+GS++YVPQ  WI+  + +DNI+  + Y+E  Y+ V+  C L  DL      +L   G   +  SGGQRQR++LARA+Y ++++YL+DDPLSA+DA VA+ +F+ VI   G L   TR+ VT  I+FL  +D I+                L +NG+    ++ Y     I  D +  + I  E+SF  D  + HT+ +   +N   +N   R   R   I+   +++   + +IRK+                  + +    +   E   V +K Y++Y  A G +      F +   +   + ++ WL + T+D                    + + +T     H        +Y  +G  Q I   F   T ++G   A++ +H  +L+    +   +F  +   +I+N FSKDI  ID  +P+ +   +   F  +A+  VI+ + P+F ++IVP+ L+YF + +FY+ ++ Q + L   S SPI+  F+ET+ G  VIRA  +   F       +++N K  Y   V N WL +R++F+GN +V  + + A+  +  L+P LVGL++SY++ +   LNWM+    DLE+N +A+ER+  ++    E   +     P ++WP  G +EF  ++++Y E     L NI+L ++ GEKIGIVGRTG+GK+S+   LF+L+E  GG + ID + I++I + D+R  +T+ PQE  +FSGT+R N+DPF    D  +  AL LSHL  ++ +    L  +C + G +LSVGQRQL+CLAR +LR ++I++LDEATA++D ETD LI  TI+ +F + T+  IAHR + + D  +I+V+D+G+I EF     +I     ++S  K
Sbjct:  192 SSVVTDPNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLSSKKDTPQPS----FLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWWGFALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESFPDDALSNHTDMV---DNEPAVNEARRQFMRQISIMSNDLENPKTK-SIRKRRCSERRPGEPPQEKKEPKVEKLIQAE-TAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTND--------------------SRDSVTAQEKVHMRVG----VYASLGITQGILVMFSSFTLAMGKIQAARKLHQGLLDNKFHTPQAFFDTTPLGRIINRFSKDIYVIDEALPSTILMFLGTFFASVATMIVIVSSTPIFAVVIVPLALVYFFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKENLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIAQKGIFYSMAK 1530          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 431/1367 (31.53%), Postives = 719/1367 (52.60%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTS---------------TLKSKNNYHT--------------KSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENK--TKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKII---------------FLDENGS----IKYYGDVSNISNDAIDFMKIKSEKSFS-DPFAEHTESIFTSNNNCVMN---RNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            N NPCPE  +   SR+ F W        +++ ++++  + ++ Q  +++      R+                   + SK    T               S++   + S      ++L   FG   +I     +   + +F  P +L+ L++F      P ++GF LA       +L ++  +  F     T +++R+AI  A+Y KS+ I NEAK + T  E++NLMS D  + +    +  ++ S+P +IIL   FL+  +G     GV V++   P N++     + YQ E+M++KD RIK M E+LN +KV+KLY+WE  F + + + R+KE+N++R  +  S +  + W + P  V LT    YV++  N V+ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+  FL  ++    N           + + NG FSW     P L+ IN+ + +G L+ +VG +  GK+SL+ A++GEM  L+G +SI+GS++YVPQ  WI+  + +DNI+  + Y+E  Y+ V+  C L  DL      +L   G   +  SGGQRQR++LARA+Y ++++YL+DDPLSA+DA VA+ +F+ VI   G L   TR+ VT  I+FL  +D I+                L +NG+    ++ Y     I  D +  + I  E+SF  D  + HT+ +   +N   +N   R   R   I+   +++   + +IRK+                  + +    +   E   V +K Y++Y  A G +      F +   +   + ++ WL + T+D                    + + +T     H        +Y  +G  Q I   F   T ++G   A++ +H  +L+    +   +F  +   +I+N FSKDI  ID  +P+ +   +   F  +A+  VI+ + P+F ++IVP+ L+YF + +FY+ ++ Q + L   S SPI+  F+ET+ G  VIRA  +   F       +++N K  Y   V N WL +R++F+GN +V  + + A+  +  L+P LVGL++SY++ +   LNWM+    DLE+N +A+ER+  ++    E   +     P ++WP  G +EF  ++++Y E     L NI+L ++ GEKIGIVGRTG+GK+S+   LF+L+E  GG + ID + I++I + D+R  +T+ PQE  +FSGT+R N+DPF    D  +  AL LSHL  ++ +    L  +C + G +LSVGQRQL+CLAR +LR ++I++LDEATA++D ETD LI  TI+ +F + T+  IAHR + + D  +I+V+D+G+I EF     +I     ++S  K
Sbjct:  155 NKNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLSSKKDTPQPS----FLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWWGFALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESFPDDALSNHTDMV---DNEPAVNEARRQFMRQISIMSNDLENPKTK-SIRKRRCSERRPGEPPQEKKEPKVEKLIQAE-TAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTND--------------------SRDSVTAQEKVHMRVG----VYASLGITQGILVMFSSFTLAMGKIQAARKLHQGLLDNKFHTPQAFFDTTPLGRIINRFSKDIYVIDEALPSTILMFLGTFFASVATMIVIVSSTPIFAVVIVPLALVYFFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKENLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIAQKGIFYSMAK 1488          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 434/1372 (31.63%), Postives = 721/1372 (52.55%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTS---------------TLKSKNNYHT--------------KSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENK--TKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKII---------------FLDENGS----IKYYGDVSNISNDAIDFMKIKSEKSFS-DPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQ---IIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +SV+ + NPCPE  +   SR+ F W        +++ ++++  + ++ Q  +++      R+                   + SK    T               S++   + S      ++L   FG   +I     +   + +F  P +L+ L++F      P ++GF LA       +L ++  +  F     T +++R+AI  A+Y KS+ I NEAK + T  E++NLMS D  + +    +  ++ S+P +IIL   FL+  +G     GV V++   P N++     + YQ E+M++KD RIK M E+LN +KV+KLY+WE  F + + + R+KE+N++R  +  S +  + W + P  V LT    YV++  N V+ A+  FVS+ L N+LR P+ +LP  I+  +   VSLKR+  FL  ++    N           + + NG FSW     P L+ IN+ + +G L+ +VG +  GK+SL+ A++GEM  L+G +SI+GS++YVPQ  WI+  + +DNI+  + Y+E  Y+ V+  C L  DL      +L   G   +  SGGQRQR++LARA+Y ++++YL+DDPLSA+DA VA+ +F+ VI   G L   TR+ VT  I+FL  +D I+                L +NG+    ++ Y     I  D +  + I  E+SF  D  + HT+ +          R   R   I+   +++   + +IRK+                  + +    +   E   V +K Y++Y  A G +      F +   +   + ++ WL + T+D                    + + +T     H        +Y  +G  Q   I+  C     +S+    A+ A H  ML+ VL++   +F  + S ++LN FSKD+D IDSLIP+N+   +   +  +    V     P+FL++IVP+ + Y+ + +FY+ ++ Q + L   S SPI+  F+ET+ G  VIRA  +   F       +++N K  Y   V N WL +R++F+GN +V  + + A+  +  L+P LVGL++SY++ +   LNWM+    DLE+N +A+ER+  ++    E   +     P ++WP  G +EF  ++++Y E     L NI+L ++ GEKIGIVGRTG+GK+S+   LF+L+E  GG + ID + I++I + D+R  +T+ PQE  +FSGT+R N+DPF    D  +  AL LSHL  ++ +    L  +C + G +LSVGQRQL+CLAR +LR ++I++LDEATA++D ETD LI  TI+ +F + T+  IAHR + + D  +I+V+D+G+I EF     +I     ++S  K
Sbjct:  192 SSVVTDPNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLSSKKDTPQPS----FLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWWGFALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESFPDDALSNHTDMVDNEPAVNEARRQFMRQISIMSNDLENPKTK-SIRKRRCSERRPGEPPQEKKEPKVEKLIQAE-TAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTND--------------------SRDSVTAQEKVHMRVG----VYASLGITQGVLILANCLLCRAYSM--LKAAHATHLTMLHAVLRAPQAFFEATPSGRLLNRFSKDVDTIDSLIPDNIDIWMRTFWYTVNVLLVCSALTPMFLIVIVPLMMFYWWVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKENLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIAQKGIFYSMAK 1531          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 330.487 bits (846), Expect = 8.511e-93
Identity = 199/651 (30.57%), Postives = 340/651 (52.23%), Query Frame = 2
Query:  572 ENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDV-----------HYQCV-------------ADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYF--SSCQDIR-SVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNI 2437
            ++ N CPE  +S  SR+ F W  R   + ++ G+K    + +           H Q V                +T    RKL +T KS++           +  S   L +A+   FG + ++     +   I SF+ P +L +L++F+     P + G+ LA    +  I +S+  +  FH    T +++RSA+   +Y K++ I   A+ +    E+  LMS D   +         V S+P  I L   FL+  +G     GV V++   P N+     ++  Q + ++ +D+R++ ++E L+ +++IK+Y+WE  F  +I R RE E+ ++   +  S +    W   P  V L     YV +  ++V+ AE  FVS+ L N+LR P+  LP  ++      VSL+R+  FL   +   +    S   +R S + I+ G+F+W  D  PIL  I++++ +G L+ +VG + SGK+SL+ A++GE+  L G+V++KG ++YV Q  WI+  S +DN++  +   E  Y+ V++ C L+ DL    A +    G   +  SGGQRQR++LARA+Y K+ ++LLDDPLSA+DA V + +FE+VI  +G+LA  TR+ VT  ++FL ++D+I+ L   G +   G  S +
Sbjct:  184 DDPNLCPEVGASFISRLTFCWFTRMAVNGYRRGLKMSDLWSLRHKDSCSFVVPHLQAVWRKEQARIAQRSAVSQSTPAETRKLHTTEKSQSGGAGTEGGATGQEPS---LIRAMALAFGPRYLVGSVYKLLQDILSFASPLLLSHLIRFVGDNSRPTWHGYALAGLMFLCAIATSMLAHQHFHAGFVTGIRLRSALTGLLYRKALMITQAARLSCAGGELTTLMSVDVQHMADITNNLNFVWSAPLHICLAMYFLWQHLGPSVLAGVAVMLLLIPFNAFIALNIRTLQAQIIKKRDERVRTLSEALSGVRIIKMYAWEGRFRDVILRVREHELAVLGRAAYFSMLSAFTWLCSPFLVALASFGVYVLVDEHHVLDAERAFVSLALFNLLRYPLNQLPQLMSELAMASVSLRRLRNFLSLEELDPHAVDRSPSHLRESCVSIEGGTFTWSWDEPPILHDISLAVPRGCLLAVVGTVGSGKSSLMAALLGELNKLGGSVAVKGQVAYVAQQAWIQN-SLRDNVLFGRPLDETWYREVLQACALEQDLLALPAGDNTEIGEKGINLSGGQRQRVSLARAIYSKASVFLLDDPLSAVDAHVGKHIFERVIGPSGLLAGQTRVLVTHGLSFLPHVDRIVVLTA-GRVSESGSYSEL 829          

HSP 2 Score: 291.967 bits (746), Expect = 1.866e-80
Identity = 169/521 (32.44%), Postives = 298/521 (57.20%), Query Frame = 2
Query: 2966 NYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNN----LSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYI-----QNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSK 4498
             Y + +Y  +G  Q + +    L    G   A+ ++H  +L+  L S + ++  +   +I+N FSKD+  ID ++P      L  + N IF ++    +I+ + P+F++  +P+ ++YF + +FY+ ++ Q + L     SP+F  F E++ G   +RA +Q++ F     + ++   +  Y      + V  +WL    +FLG  +V  + + A+  R+ L    VGL++SY++ +  +++WM+    ++E+N +A+ER+  ++    E + +     P ++WP  G +EF+ ++ +Y E     L NI+  I+ GEK+GIVGRTG+GK+SL   L ++VE   G++ ID +DI  I + D+R  IT+ PQ+  +F G++R N+DPF    D  + +AL  +HLG    ++ G +  +C + G + SVGQRQL CLAR +LR ++++VLDEATA+VD ETD LI  TI+  F   T+L IAHR   + D  +++V+  G+I+EF     +++  +  F K
Sbjct:  996 GYRLGVYSALGAVQSVLSLVMVLMVFKGCLRAAGSLHLALLDNKLHSPISFYDVTPLGRIINRFSKDVFMIDEVLPPTFLMFLGALCNSIFTIL----IIVISTPVFVVAAIPLVVIYFFVQRFYVATSRQLKRLESTVRSPVFSHFGESVAGAATLRAFRQEERFVIAGDRAVDALQRTSYPSIVSQRRVGAVWL----EFLGACVVLFAAMFAVLSRDSLKAGTVGLSVSYAMQVTVVMSWMVRMSSEVESNIVAVERVKEYSETPPEADWEVESCRPPADWPSQGHVEFRDYSTRYREGLDLVLRNISCDIKGGEKVGIVGRTGAGKSSLTLCLLRMVEAASGAIAIDGVDISRIGLHDLRSRITIIPQDPVLFGGSLRDNLDPFGHHSDAEVWEALEFAHLGETARALPGGIQHECAEGGENFSVGQRQLACLARALLRRTRVLVLDEATAAVDVETDALIQGTIRTHFHACTVLTIAHRLHTVLDCTRVMVLSSGQIVEFDSPDVLLSRKDSAFHK 1508          

HSP 3 Score: 80.4925 bits (197), Expect = 2.671e-15
Identity = 66/266 (24.81%), Postives = 120/266 (45.11%), Query Frame = 2
Query: 3683 DLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEII 4471
            +L   S++L RL NF ++E E +       P         IE   F   +  D    L++I+L +  G  + +VG  GSGK+SL+ +L   +  +GGS+                +    +  +      ++R N+     L++   ++ L    L   L ++    + + G+ G +LS GQRQ + LAR I   + + +LD+  ++VD    + I E +          T +++ H  S L  +D+I+V+  G + E G  SE++
Sbjct:  582 ELAMASVSLRRLRNFLSLE-ELDPHAVDRSPSHLRESCVSIEGGTFTWSW--DEPPILHDISLAVPRGCLLAVVGTVGSGKSSLMAALLGELNKLGGSV--------------AVKGQVAYVAQQAWIQNSLRDNVLFGRPLDETWYREVLQACALEQDLLALPAGDNTEIGEKGINLSGGQRQRVSLARAIYSKASVFLLDDPLSAVDAHVGKHIFERVIGPSGLLAGQTRVLVTHGLSFLPHVDRIVVLTAGRVSESGSYSELM 830          

HSP 4 Score: 61.2326 bits (147), Expect = 1.872e-9
Identity = 46/174 (26.44%), Postives = 83/174 (47.70%), Query Frame = 2
Query: 1805 IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRMLC-------SGGQRQRINLARAVYQKSEIYLLDDPLSALD 2266
            +E ++ S  +R   + +L+ I+  I  GE VGIVG+  +GK+SL   ++  +    GA++I G              ++ +PQ+P +   S +DN+     + + +         L+F      A  L G  +  C       S GQRQ   LARA+ +++ + +LD+  +A+D
Sbjct: 1277 VEFRDYSTRYREGLDLVLRNISCDIKGGEKVGIVGRTGAGKSSLTLCLLRMVEAASGAIAIDGVDISRIGLHDLRSRITIIPQDPVLFGGSLRDNLDPFGHHSDAEVWEA-----LEFAHLGETARALPGGIQHECAEGGENFSVGQRQLACLARALLRRTRVLVLDEATAAVD 1445          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007076.1 (pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 gene:ENSPMAG00000006379.1 transcript:ENSPMAT00000007076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.878 bits (725), Expect = 1.351e-83
Identity = 169/528 (32.01%), Postives = 294/528 (55.68%), Query Frame = 2
Query: 2942 SYDYHATAN------YYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAIC--YRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSK 4498
            S  Y ++AN      +Y+ +YG +  G  +F       F+ G   A+K IH  +L+KVL++ + +F  + + +I+N FS D+  +D  +P  ++  +  +F ++ +  V+ +  P   L+++P+  +Y+ + K+Y  ++ + + L   + SPI+  F E+L G  +I+A +    F  E    L  N +  +    +  WL +RL  +G ++V     +A+   +   + P LVGL I+Y++ I   L+ ++  +   ET  +++ER+  +  + SE     +  H   +WP+ G + F K  L Y     F LN I+  I   EK+GIVGRTGSGK++L   LF++V+   G++ ID+ DI  + +  +R  + + PQ+  +FS T+R N+DP    +DH L + L   HL  ++    G L  +  + G   S GQRQLLCLAR +L  +KI+ +DEATASVDQ+TD L+ +TI+  F+NST+L IAHR + + D D+++V+  G ++EF    +++ +P    S+
Sbjct:    5 SPPYRSSANGSDPVQFYLSVYGALAAGNTVFTLLRAFLFAYGGVCAAKNIHVTLLHKVLQAPVSFFDATPTGRIMNRFSSDLFTVDDSLPFIMNIFMAQLFGLVGAIVVMCYGLPWMALVLLPLAGVYYCVQKYYRFTSRELKRLGSVTLSPIYSHFAESLSGLAIIKAFRATDRFTRENEARLELNQRCQFAAVAVMHWLDVRLQMMGVVIVVSLAALAVLEHHLRGVDPGLVGLAIAYALGINGRLSGLVSSFTQTETQMVSVERVQEYRGIASE-EAHRHPTHVSPDWPQGGALTFDKVFLTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLD-QGGLQAEVAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQDTDVLLQKTIRSEFVNSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLLQDPRSALSR 530          

HSP 2 Score: 58.151 bits (139), Expect = 1.104e-8
Identity = 52/223 (23.32%), Postives = 103/223 (46.19%), Query Frame = 2
Query: 1826 FSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSI-------------KGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLD---FDLRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISND 2446
             ++R      L  I+  IN  E VGIVG+  SGK++L + +   + +  GA+ I             + +++ +PQ+P++   + ++N+     Y +++   V+  C L     D    QA+         C  GQRQ + LARA+  K++I  +D+  +++D      + +K I +     N+T L +    N +   D+++ L + G +  +    ++  D
Sbjct:  307 LTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLDQGGLQAEVAERGRDFSC--GQRQLLCLARAMLFKAKILCIDEATASVDQDT-DVLLQKTIRSE--FVNSTVLTIAHRPNTILDSDRVLVL-QGGRVLEFASPHDLLQD 523          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006454.1 (pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:ENSPMAG00000005809.1 transcript:ENSPMAT00000006454.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.766 bits (665), Expect = 4.905e-76
Identity = 172/486 (35.39%), Postives = 270/486 (55.56%), Query Frame = 2
Query: 3047 GNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNF-NAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSG-KTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFS 4495
            G   AS  +HD +  KVL+S +  F  + + ++LN FS+D+D +D  +P      I  +  V+    VI   FP FLL ++P+ +L+ II K       + + L   S SP       +LQG P I A  +   F     +LL+ N   L++ +    WL++RLD +   L+  + +M +    ++  +  GL ISY+I +     + I    + E    ++ER+ ++  A+E E  D        +EWP+ G + F+   ++Y E     L  +   I+  E +GIVGRTGSG K+SL   LF+LVE  GGS+ ID + I DI + D+R  +++ PQE  +F GTIR N+DP     D  + +AL  +H+   +  +   L  +  +NG + SVG+RQLLC+AR ILR+SKI++LDEATA++D ETD LI ETI+  F + T+L IAHR + +   D+I+VMD+G+++EF   S ++ N    F+
Sbjct:    3 GTLRASSRLHDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEVDVRMPFQAELFIQNVILVLFCLGVIAAVFPWFLLAVIPLCVLFLIINKISRVFIRELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLHRYQELLDTNQACLFLFSCAVRWLAVRLDIISVALITTTALMMVLMHGQIPAAYAGLAISYAIQLTGTFQFTIRLASETEARFTSVERIQHYIEALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALERTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFGDCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLLENRASRFA 488          

HSP 2 Score: 58.151 bits (139), Expect = 1.248e-8
Identity = 56/244 (22.95%), Postives = 104/244 (42.62%), Query Frame = 2
Query: 1805 IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAII---GEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRML----------CSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDF 2458
            +  ++    +R     +LKR+  +I   E VGIVG+  SG  S L   +    E+C   G++SI G              +S +PQ P +   + + N+     Y +      +         RT+  D +  + + L           S G+RQ + +ARA+ + S+I LLD+  +A+D      + E +    G   + T L +   +N +   D+I+ +D+   +++    + + N A  F
Sbjct:  257 VSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELC--GGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALE--------RTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFG---DCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLLENRASRF 487          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001536.1 (pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 gene:ENSPMAG00000001392.1 transcript:ENSPMAT00000001536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.381 bits (664), Expect = 1.058e-75
Identity = 160/514 (31.13%), Postives = 299/514 (58.17%), Query Frame = 2
Query: 2972 YMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLN-DNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAIC--YRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDK--EYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFS 4495
            Y +++GL+    I       LT        ++ +H+ ML +++ + ++YF  +    ILN FS D + +D  IP  L  ++      +++  +I +  P+FL+ +VP+ + Y+ I K++  ++   Q L   +  P+F  F+ET++G   IRA + +  F+  L +L + +N  +L++ +  N WL +RLD++G  +V  + + +I   + N L+ + VGL ++Y++ + + LNW++    D+E    A++R++N   +E+E  D        PD+ WP+ G+I+ ++ +++Y    K  L ++N  I+  +K+GI GRTGSGK+SL  + F++V+   G ++ID+IDI  I +  +R  +++  Q+  +FSG+IR N+DP     D VL +AL+++ L   ++++ G L     +NG + SVGQRQL CLAR  +R + I ++DEATAS+D  T+ ++ + +   F N T++IIAHR   +   D ++V+ RG ++E+   S ++ + + + S
Sbjct:    2 YPMVFGLLCCSGIALCFITSLTVEWTGLKTARNVHNNMLKRIVLAPMRYFDTTPLGHILNRFSADTNIMDQQIPTTLESLMRSALLCLSALGIIAYVTPIFLIALVPLAIAYYFIQKYFRVASRDLQELDDSTQLPLFSHFSETVEGITTIRAFRHEVRFRQRLLELTDANNISYLFL-SAANRWLEVRLDYIGACIVLIASVASITDSWNNTLSSARVGLCLTYALMVSNYLNWVVRNLADIEVQMGAIKRVNNLLQIETESYDGLLSQAQVPDN-WPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASIDMATESILQKVVMTAFANRTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLAHDSMFAS 513          

HSP 2 Score: 62.3882 bits (150), Expect = 6.381e-10
Identity = 56/245 (22.86%), Postives = 113/245 (46.12%), Query Frame = 2
Query: 1808 EIKNGSFSWRSDS--EPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAV-------------SIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRMLC------SGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEK 2479
            EIK    S R DS  +P+LK +N  I   + VGI G+  SGK+SL  A    +   +G +             +++  +S + Q+P +   S + N+       +      + I  L   ++        G+D M+       S GQRQ   LARA  +K+ I+++D+  +++D +  + + +KV+      AN T + +   ++ +   D ++ L     ++Y    + +++D++    ++++K
Sbjct:  282 EIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPG----GLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASID-MATESILQKVVMTA--FANRTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLAHDSMFASFVRADK 519          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ABCC8 (ATP binding cassette subfamily C member 8 [Source:HGNC Symbol;Acc:HGNC:59])

HSP 1 Score: 252.677 bits (644), Expect = 4.802e-68
Identity = 152/485 (31.34%), Postives = 290/485 (59.79%), Query Frame = 2
Query: 3056 NASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLN-DNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAIC--YRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSE-WPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFS 4495
             A++ +H  +L +++++ L++F  +    ILN FS D+  ID LIP++   ++      +++  VI +  P+FL+ +VP+ L+++ I K +  ++   Q L   +  P+     ET+ G   IRA + +  F+  +F+L++ +N  FL++ +  N WL +R+D++G  +V  + + +I   + + L   LVGL ++Y++ +   LNW++    D+E    A++R++N   +E E +++    H   E WP  G+I+  + + +Y    K  L N++ VI+ G+K+GI GRTGSGK+SL  +LF++++   GS+ IDD+DI  I ++ +R  +++  Q+  +FSG+IR N+DP     D +L  AL ++ L   ++++ G L     + G + S+GQRQL CLAR  +R + I+++DEATA++D  T++++ + +   F + T+++IAHR + + D D ++V+++G + E    + ++ NP+  FS
Sbjct: 1088 KAARGLHKRLLGRIVRAPLRFFDTTPLGSILNRFSADLHMIDQLIPSSTESLVRSSLFSLSAVSVIAYVTPIFLVALVPLALVHYFIQKHFRIASKDLQELDENTKLPLLLHIMETVDGIATIRAFRHESQFRQRIFELIDANNVPFLFL-SAANRWLEVRMDYIGASIVLATAMASITRSFYSGLDSGLVGLGLTYALLVSIYLNWVVRNLADIEVQLQAIKRVNNLMKVEIEDDERSPELHAVPEDWPHRGEIKINRLSARYDASLKPALKNLSSVIQPGQKVGICGRTGSGKSSLSLALFRMLDIFDGSITIDDVDISKIPLSLLRSRLSIILQDPVLFSGSIRFNLDPEARSTDSMLWDALEIAQLKCVVKALPGGLDATVREGGENFSLGQRQLFCLARAFVRQTAILIMDEATAALDMATEKILQKVVMTAFADRTVVMIAHRVANILDADVVLVLNQGLLEENDSPANLLANPDTIFS 1571          

HSP 2 Score: 201.06 bits (510), Expect = 3.931e-52
Identity = 167/713 (23.42%), Postives = 321/713 (45.02%), Query Frame = 2
Query:  635 LDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFK-RKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPF----ILKYL---------------LKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEA--KSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIF-PNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL-------------IENKTK-----------------------NYFSSCQDIRS----------VIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAV--------------------------SIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRT-NQADELN-GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTR--LFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSE 2476
            L +  Y W  N I    T  +  +   D+  +    R L++ +  + ++    R        V  L +++F  FG  +I+S        + +F+ P     I+ +L               + FIS+ E  L   + L++    + +L        ++    T ++ R+A+ + +Y K ++++  +  +   T+  I N+++ D+++++  +     + + P +II+  + L++ +G  A IG  V+    PL     + L   Q   +E    RIK  +E+++ +K++KLY+WE +F   +   R KE+  +   ++ + +   +   +P++ ++    TYV++  P+  ++    F S+ L ++L +P+ +L   +  A+   +S+++++ FL             +E + K                       + F   QD R            I++  G F+W S    +L  INI I  G+L  +VG+I  GK+SLL+A +GEM ++ G+V                            +GS++Y  Q PWI   + ++NI     + E  YK VI  C L  D+    Q D    G   +  S GQRQRI++ARA+YQ + +  LDDP +ALD  ++  +    I   G+L N TR  + VT  + +L + D II + ++G+++  G + +I     +  ++  E
Sbjct:  224 LSQATYWWLSNLISLAQTRLIDLE---DIGKLPIGMRALSNYILLQKSFQEHKRECEARQEVVPSLWRSVFRTFGRPIIVSSVLRYMADLLAFTGPLCIYGIVHHLNNDEQQLKPQVRALGVYFISSREF-LANAYVLSVLLFFSLVLQRTLLQASYYKAIETGIKFRAAVQTMIYDKILHLSTSSVSRGKMTSRYISNVVTVDSNQLMWFLFLCPNLWALPVQIIVGVSLLYSLLGVSALIGAAVIALLAPLQYCIATKLARAQKLTLEHSSSRIKQTSELVHGIKLLKLYAWEQVFCSTVEETRSKELRSLSTFAIYTALSTFMNAAIPITAVMATFVTYVHLSSPDITLSPAVAFASLALFHILVTPLFLLSTVVRFAVKALISMQKLTEFLATSEIGDEPNTLDVEPRPKKSSNADVVQMMAVNRKQPQKPVWDDFEPPQDWRQFEFTDGSEDFAIKVTGGVFTWASSEPSLLTDINICIPHGQLTMVVGQIGCGKSSLLSATLGEMHLVSGSVYWNSSPRQQSVNTKNNRQERRASTFCRRRGSVAYAAQKPWILNSNVQENITFGSPFNEERYKAVINTCSLQPDIDILPQGDRTQIGEKGINLSAGQRQRISVARALYQHTNVVFLDDPFTALDIHLSDHLMHSGIL--GLLHNDTRTVVLVTHKLQYLTHADWIIAM-KDGTVQREGTLKDIQTSDPELYEMWKE 929          

HSP 3 Score: 64.6994 bits (156), Expect = 1.824e-10
Identity = 55/219 (25.11%), Postives = 104/219 (47.49%), Query Frame = 2
Query: 1808 EIKNGSFSWRSDS--EPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSI-------------KGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRMLCSG------GQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDEN 2401
            EIK    S R D+  +P LK ++  I  G+ VGI G+  SGK+SL  A+   + I DG+++I             +  +S + Q+P +   S + N+    +  ++   + + I  L   ++        G+D  +  G      GQRQ   LARA  +++ I ++D+  +ALD +  +K+ +KV+      A+ T + +   +  +   D ++ L++ 
Sbjct: 1340 EIKINRLSARYDASLKPALKNLSSVIQPGQKVGICGRTGSGKSSLSLALFRMLDIFDGSITIDDVDISKIPLSLLRSRLSIILQDPVLFSGSIRFNLDPEARSTDSMLWDALEIAQLKCVVKALPG----GLDATVREGGENFSLGQRQLFCLARAFVRQTAILIMDEATAALD-MATEKILQKVVMTA--FADRTVVMIAHRVANILDADVVLVLNQG 1551          

HSP 4 Score: 63.929 bits (154), Expect = 3.130e-10
Identity = 57/232 (24.57%), Postives = 106/232 (45.69%), Query Frame = 2
Query: 3854 LNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXX-------------XXXXXTMFPQESTIFSGTIRQNI---DPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVD-QETDRLIMETIKHRFINS--TILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEI-INNPNGY 4489
            L +IN+ I HG+   +VG+ G GK+SL+ +    +  + GS+  +    +    T               R ++    Q+  I +  +++NI    PFN   +   K  +N   L P ++ +        G+ G +LS GQRQ + +AR + +++ ++ LD+   ++D   +D L+   I     N   T++++ H+   L   D II M  G +   G   +I  ++P  Y
Sbjct:  696 LTDINICIPHGQLTMVVGQIGCGKSSLLSATLGEMHLVSGSVYWNSSPRQQSVNTKNNRQERRASTFCRRRGSVAYAAQKPWILNSNVQENITFGSPFN---EERYKAVINTCSLQPDIDILPQGDRTQIGEKGINLSAGQRQRISVARALYQHTNVVFLDDPFTALDIHLSDHLMHSGILGLLHNDTRTVVLVTHKLQYLTHADWIIAMKDGTVQREGTLKDIQTSDPELY 924          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: BPT1 (ABC type transmembrane transporter of MRP/CFTR family; found in vacuolar membrane, involved in the transport of unconjugated bilirubin and in heavy metal detoxification via glutathione conjugates, along with Ycf1p [Source:SGD;Acc:S000003938])

HSP 1 Score: 498.819 bits (1283), Expect = 8.842e-151
Identity = 402/1379 (29.15%), Postives = 685/1379 (49.67%), Query Frame = 2
Query:  614 SRILFMWLDRYIYSWFQNG-IKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPET----PLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMG-TFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNR-EKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYF------SSCQDIRSVIEIKNGSFSW---------------RSDSEPILKRINISIN--------KGELVGIVGKIASGKTSLLNAIIGEMCILDGA--------VSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRT-NQADE-LNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKV-ISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSI---KYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYH--------QINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILT-ILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSL-GNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRN---KLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESI-------------NGN----LHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNG-YFSKCK 4504
            S I F+W+++ I   ++N  IK  +   +      D+N  +  ++       K N+  +  + +N +S +W   +A++  FG  + ++        + S  +P  L+  +  ++ PET    P   G  +A++  +  ++S    N  +       L +R ++AS VY KS+ +    ++  +  +I+NLMS D  +I      +  +I +P +II++   L+  +G  A IG LV M    P+N+     ++     +M++KD RIK +TE+LN +K IKLY+WE      ++  R + E+   R I + S ++   W+ +P+ V  +    + ++F +  ++    F S+ L N+L S +  +P  I   +   VS++R+  FL+ ++  + F      S+ +     IE+ N +F W               R+D E I+    I++         +G+LV +VG++ +GK++ L AI+G++  + G+        +    S++Y  Q  WI   S ++NI+   K+ ++ Y   I+ C L  DL+     DE L G   +  SGGQ+ R++LARAVY +++IYLLDD LSA+DA V++ + E V I    +L N T +  T  ++ L +  ++I+  ENG I     Y DV N  N+     K+  E  F  P     ES   + +      +     K+  +  + +          + N R+  L          +        ++  +  TE+  V  K Y  Y  A G L +    F F ILT +  +  ++WL K  S+ N                             +     ++ +Y LIG     F     +   L  +   SK +H+ M   V++S + +F  +   +I+N FS D+D +DS +    S     I   + +  ++ +  P FL+  + + ++Y     FY+  + + + L   S SPI    +E+L G  +I A    + F +  ++ +  N  F++     N WLS+RL  +G  +V  + I+A+   N   +L+  +VGL +SYS+++   L W++   V +ETN +++ER+  +  +  E         PD  WP  G IEFK ++ KY E+    LNNIN+ IE  EK+GIVGRTG+GK++L  +LF+++EP  G ++ID IDI DI + D+R  + + PQ++  F GT++ N+DPFN   +  LK+A+  +HL P LE +             +GN    L     +NGS+LSVGQRQLLCLAR +L  SKI+VLDEATASVD ETD++I +TI+  F + TIL IAHR   + D DKIIV+D+G + EF   S+++++    ++S C+
Sbjct:  223 SYITFIWMNKLIVETYRNKKIKDPNQLPLP---PVDLNIKSISKEF------KANWELE--KWLNRNS-LW---RAIWKSFGRTISVAMLYETTSDLLSVVQPQFLRIFIDGLN-PETSSKYPPLNGVFIALTLFVISVVSVFLTNQFYIGIFEAGLGIRGSLASLVYQKSLRLTLAERNEKSTGDILNLMSVDVLRIQRFFENAQTIIGAPIQIIVVLTSLYWLLGK-AVIGGLVTMAIMMPINAFLSRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLF-SLFSDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSADERALPAIEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKH-SQMIYALENGEIVEQGNYEDVMNRKNNTSKLKKLLEE--FDSPIDNGNESDVQTEHRSESEVDEPLQLKVTESETEDEVVTESELELIKANSRRASLATLRPRPFVGAQLDSVKKTAQKAE-KTEVGRVKTKIYLAYIKACGVLGVVL-FFLFMILTRVFDLAENFWL-KYWSESN------------------------EKNGSNERVWMFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVTIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDRTILTIAHRIDTVLDSDKIIVLDQGSVREFDSPSKLLSDKTSIFYSLCE 1553          

HSP 2 Score: 70.0922 bits (170), Expect = 2.436e-12
Identity = 58/232 (25.00%), Postives = 107/232 (46.12%), Query Frame = 2
Query: 3833 VEDCKFCLNNIN-LVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI----KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLYE 4513
            +   +  L NI+    + G+ + +VGR G+GK++ ++++   +  + GS      D     +     ++    QES I + ++R+NI   +  +       +    L P L+ +        G+ G SLS GQ+  L LAR +   + I +LD+  ++VD E  + I+E +         N TI++  +  S L+    I  ++ GEI+E G   +++N  N      KL E
Sbjct:  647 IGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGS-----RDSIPPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYALENGEIVEQGNYEDVMNRKNNTSKLKKLLE 873          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YBT1 (Transporter of the ATP-binding cassette (ABC) family; involved in bile acid transport; negative regulator of vacuole fusion; regulates release of lumenal Ca2+ stores; similar to mammalian bile transporters; YBT1 has a paralog, VMR1, that arose from the whole genome duplication [Source:SGD;Acc:S000003971])

HSP 1 Score: 485.337 bits (1248), Expect = 2.675e-145
Identity = 388/1398 (27.75%), Postives = 676/1398 (48.35%), Query Frame = 2
Query:  584 PCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFI----SAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSK-------------------------SININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRS-VIEIKNGSFSWRSDSEPI-LKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG----------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATAN-----------------YYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHF-QFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESE-FNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHL--------GPWLESING-------------NLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKT-SEIINNPNGYFSKCK 4504
            P PE  +SI   I + WLD +++   +  IK +  + +  Q  +      F+  +   +K K  +            S + + +  +   GS             + SF    +LK +L+++    SAP    +F  T+     +  IL +I Q           ++++S I S +Y+K                         SIN + E+ S+     IINLM+ D  K+     Y    + +    ++  A L+  +G  A +GVL+++   PLN     ++   Q + +   D RI+ + E    +++IK +SWE  F K I+  RE E++L+ + S+   + + +W   P  V       Y+ +    V+T    F ++ L  +LR P+  L   ++  +   VSL RV  FL EN TK Y     D        +N + SW  D++   LK +NI    G+L  ++G   SGKTSLL A++GEM +L+G V +                  S++Y  Q  W+   + K+NI+ +  + E  YK V+  C L  D    +A +L   G   +  SGGQ+QR++LARA+Y  +   LLDD LSA+D+  A  +++  I+   ++ + T + V+ NI       +++ L E+G +K  GD  ++    + F + +  KS     A  + ++   ++  + N  + +  ++   +  S +    ++K  L                  +      D       YK Y K F     +    S+F   I  +L +  S+W+    S  N++   I          ++  +H+    D+  ++                  YY+++Y +IGF Q +      +   +   NAS+ I + +LNKVL SK+++F  + + +I+N FSKDI+ ID  +   +      + + +++  +I    P FL + + + +LY+ +  FY+  + + +     S SPI++ F+ETL G   IRA   +  F Q  L K+  +N  F Y+  V N WL+ R+D +G++++FG+ +  +   N L   + G++++Y+I   +   W++  Y ++E N  ++ER+  +  +E E +N+ + +  P  +WP+ GKIE    +L+Y  +    + N++  ++   KIGIVGRTG+GK++++ +LF+ +EP  G + ID+IDI  +D+  +RR+IT+ PQ+ T+FSGTI+ N+DP++   D  + +AL   +L        G   E+ N              +L  +  + GS+LS GQRQL+CLAR +LR+ KII+LDEATAS+D  +D  I ETI+  F  STIL IAHR   + D DKI+VMD GE+ E+    S ++N  + ++S C+
Sbjct:  278 PSPEPVTSIAGFICWAWLDSFVWKAHKVSIKVKDIWGLMMQDYSFFVVKKFRYFVDHKVKRKRIFSLNLF----FFFSNYLVLQCFWAFLGS-------------VLSFIPTVLLKRILEYVEDQSSAPSNLAWFYVTV---MFVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQKSINGDEESTSSANLGAIINLMAIDAFKVSEICGYLHSFLEAFVMTVVALALLYRLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYV-QGEVLTTPVAFTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDTKKYDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITG-PLMEDRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDMLQKGL-FGEDELVKSSILSRANSSANLAAKSSTSLSNLPAVKEQQVSVNNNSSHFEAKKLQKS-LRTEAERTEDGKLIKEETKEEGVVGLDV------YKWYLKIFGGWKIVSFLASLFL--IAQLLYIGQSWWVRAWASH-NVIAKIIPRAQRAIAFISKKASHLI---DWRGSSQISMASAENQPSSGHSTMYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLW-VANRWLAFRIDMIGSLVIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEI--PPPQWPQDGKIEVNDLSLRYAPNLPRVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGSTILTIAHRLRSVIDYDKILVMDAGEVKEYDHPYSLLLNKQSAFYSMCE 1636          

HSP 2 Score: 60.077 bits (144), Expect = 2.846e-9
Identity = 58/250 (23.20%), Postives = 124/250 (49.60%), Query Frame = 2
Query: 3788 PRFGKIEFKKFNLKYVEDCK-FCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFP---QESTIFSGTIRQNI---DPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMET--IKHRFINSTILIIAHRTS-GLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKL 4507
            P   +  F+   + + +D + F L ++N+  + G+   ++G TGSGKTSL+ +L   +  + G +++  ++ R   I D            Q + + + T++ NI    PFN      + +A  L      L++  G+L  + G+ G +LS GQ+Q + LAR +  N++ ++LD+  ++VD  T   I +         + T ++++H  +  L + + +++++ G + + G   +++    G F + +L
Sbjct:  689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKA--GDLT-EIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDMLQ--KGLFGEDEL 933          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: VMR1 (Vacuolar membrane protein; involved in multiple drug resistance and metal sensitivity; ATP-binding cassette (ABC) family member involved in drug transport; potential Cdc28p substrate; induced under respiratory conditions; VMR1 has a paralog, YBT1, that arose from the whole genome duplication [Source:SGD;Acc:S000001027])

HSP 1 Score: 466.077 bits (1198), Expect = 8.466e-139
Identity = 384/1375 (27.93%), Postives = 673/1375 (48.95%), Query Frame = 2
Query:  572 ENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAP---ETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSI--------NINNEAKSTFTN-AEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFS-SCQDIRSVIEIKNGSFSWRSDSEPI----LKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAV----------------SIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRI---HKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILT-ILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSE--------WPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQAL---NLSHLGPWLESING------------NLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNG-YFSKCK 4504
            ++ +P  E  SSI S I + W+  +I+   +N IK +  + +  +  +      F R+         N H  +            LT ALF  F + L+I    ++ + I +     ++K  L+ +  P    + +   +   I   I  +  +I  +    ++    L++R+ +   +Y+K +          ++++ S   N   IINL+S D+ K+     Y ++ + +   II++   LFN +G  A  G+ +++  FPLN +  + L  +Q + ++  D+RI  + E L N++++K ++WE      I   R+KE+  +   SL   V + +W   P +++  + +       +  + A   F ++ L  +L++P+  L   ++      VSLKR+S FL  + T+ Y   +    ++ IE KN + +W  +   +    L  +NI    G+L  I+G   SGK++LL  ++GE+ ++ G++                 +  S +Y  Q+ W+   + K+NII    Y E+ Y  VI  C L  DL    A +L   G   +  SGGQ+QRI+LARAVY  ++  LLDD LSA+D+  A  ++E  I+   ++ N T + VT N++          + ENG +K  G ++          +++S+  F + + +       S+ + +  +N+ R+    K     I+     IN    F+             +      + E  +  I    YK Y K+F   G  +   ++FA  I   IL +  S+W+    +D N+       N      +      MT S      A YY+ +Y LIG  Q +   F  +   L    AS+ I + +L+ VL +++++F  +   +I+N FSKDI+ +D  +   L   I C+ Q  +  F+I    P FL + V + +LYF + K+YL ++ + + L   + SPIF+ F+ETL G   IRA   ++ F  E    ++ N +  +  +V   W S R+D +G  +V  S    +     +   L G++++Y+I   D   W++  Y   E N  ++ERL  ++++E E     YL H +          WP+ G+IE +  +L+Y  +    + N++  ++   KIGIVGRTG+GK++++ +LF+L+EPI G + ID  DI  ID+  +RR+IT+ PQ+  +F+GTI+ N+DP++  ++  + +AL   NL     + E +N             NLH +  + G +LS G+RQLL +AR +LR  KII+LDEAT+S+D ++D LI   I+  F  STIL IAHR   + D D+IIVMD GE+ E+ + SE++ +  G ++S C+
Sbjct:  262 DHTSPSREHISSILSCITWSWITNFIWEAQKNTIKLKDIWGLSMEDYSIFILKGFTRR---------NKHINN------------LTLALFESFKTYLLIGMLWVLVNSIVNLLPTILMKRFLEIVDNPNRSSSCMNLAWLYIIGMFICRLTLAICNSQGQFVSDKICLRIRAILIGEIYAKGLRRRLFTSPKTSSDSDSISANLGTIINLISIDSFKVSELANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFPLNFLLANLLGKFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTP-TLVTGVTFAICTFVQHEDLNAPLAFTTLSLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYNQLTISPDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITG-PLMKNRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTIT----------ELQSKGLFKEKYVQ------LSSRDSINEKNANRLKAPRKNDSQKIEPVTENINFDANFV-------------NDGQLIEEEEKSNGAISPDVYKWYLKFF---GGFKALTALFALYITAQILFISQSWWIRHWVNDTNV-----RINAPGFAMDTLPLKGMTDSSKNKHNAFYYLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTDGALWLVRLYSTFEMNMNSVERLKEYSSIEQE----NYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKSTILTIAHRLRSVIDYDRIIVMDAGEVKEYDRPSELLKDERGIFYSMCR 1572          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YOR1 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter mediates export of many different organic anions including oligomycin; homolog of human cystic fibrosis transmembrane receptor (CFTR) [Source:SGD;Acc:S000003513])

HSP 1 Score: 313.923 bits (803), Expect = 1.086e-87
Identity = 256/904 (28.32%), Postives = 429/904 (47.46%), Query Frame = 2
Query: 1859 KRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEK-----SFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIK------SVSYKAYFKYFLARGSLQLFCSIFAFGIL----TILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRN--KLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNA---MESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQAL---------NLSHLGPWLESING------NLHFDCG--DNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEF 4450
            K +N  I KGE + I G I +GK+SLLNA+ G M   DG V + G +  +   PWI+  S +DNII    + +  Y  V+R+C L  DL    A ++   G   +  SGGQ+ RINLAR+VY+K +IYL DD LSA+D+ V + + ++ ++  G+LAN TR+  T  ++ +    ++I L         G    +    +D +K +++       FS                   ++NS +  +   A +  +  Q+    +   +   +      +  + S     D  T  K      S+S K Y +Y  A      F ++  + IL    T   + SS WL                             + T +   +   ++YM +Y    F   IF    +         ASK ++   + ++L + + Y   +   +ILN F+KD D++D+ +  +L  + +    ++    + +   P F + I  + +++ +I   Y  S  + + L     S ++   NE L G   I+A + ++ F  +   L+N   +  Y+  VL  W+ + LD +   + F  +I  +C      ++ + VG+ ++Y + +  LLN ++      E +  + ERL  +     +E+ +   E    P   WP  G+I F+  +  Y       L N+NL I+ GEKIGI GRTG+GK++++ +L++L E   G +LID++DI  + + D+RR + + PQ+  +F GTIR+N+DPFN   D  L  AL         +L  +       NG        H D    + GS+ S+G+RQLL L R ++R SKI++LDEAT+SVD ETD  I   I   F + TIL IAHR   + + D+I+V+++GE+ EF
Sbjct:  605 KDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGDL-LMCGYPWIQNASVRDNIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLT--GMLANKTRILATHQLSLIERASRVIVL---------GTDGQVDIGTVDELKARNQTLINLLQFS-------------------SQNSEKEDEEQEAVVAGELGQLKYESEVKELTELKKKATEMSQTANSGKIVADGHTSSKEERAVNSISLKIYREYIKAAVGKWGFIALPLYAILVVGTTFCSLFSSVWLS----------------------------YWTENKFKNRPPSFYMGLYSFFVFAAFIFMNGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVA--IAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMT--PPESWPSMGEIIFENVDFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFGDCTILCIAHRLKTIVNYDRILVLEKGEVAEF 1445          

HSP 2 Score: 162.155 bits (409), Expect = 2.116e-40
Identity = 172/695 (24.75%), Postives = 304/695 (43.74%), Query Frame = 2
Query:  590 PEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTL-KSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISW-----CAIVFHIIFSFS---RPFILKYLLKFISAPETPLFF------GFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLP-MSVLLTMLWTY-VNIF---PNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFL----------IENKTKNYFSSCQDIRSVIEIKNGSFSWR----SDSEPILK-------------------RINISINKGELVGIVGKIASGKTSL----------LNAII--GEMCILDGAV---------SIKGSMSYVPQN------------PWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSI 2410
            P  +++I S + F W+   +   ++  I+    F +  +   +    +F++ +     K++  Y  + R P      V    K   H     L+ ++      +IVF I+ + +    P I K L++F+   E  +F       G   AI   +   ++ +T N  FH +  T +Q +S +  A   K  N +N A+  F N ++ + ++TD  +I  A+++   +   P  + +    L   +G +A +G+ +  G F ++  A   +  ++     + D R+  M EVLNN+K+IK Y+WE  + K I   R KE++ +R + L    +  +  +LP ++ L+T L  Y VN     P  +      F S+ L  +L   M  LP  I   ++  + L R+   L          IE K    F    D +  +++ + SF W     +D+    K                   + + S NK + +  + K   G   L          LN  I  GE  ++ G +         ++ GSM                  PWI+  S +DNII    + +  Y  V+R+C L  DL    A ++   G   +  SGGQ+ RINLAR+VY+K +IYL DD LSA+D+ V + + ++ ++  G+LAN TR+  T  ++ +    ++I L  +G +
Sbjct:  109 PLFHTNIISNMFFWWVLPILRVGYKRTIQPNDLFKMDPRMSIETLYDDFEKNMIYYFEKTRKKY--RKRHPEATEEEVMENAKLPKHTVLRALLFTFKKQYFMSIVFAILANCTSGFNPMITKRLIEFVE--EKAIFHSMHVNKGIGYAIGACLMMFVNGLTFNHFFHTSQLTGVQAKSILTKAAMKKMFNASNYARHCFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAILAICIVLLIVNLGPIALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQDIRTKEISKVRKMQLSRNFLIAMAMSLPSIASLVTFLAMYKVNKGGRQPGNI------FASLSLFQVLSLQMFFLPIAIGTGIDMIIGLGRLQSLLEAPEDDPNQMIEMKPSPGF----DPKLALKMTHCSFEWEDYELNDAIEEAKGEAKDEGKKNKKKRKDTWGKPSASTNKAKRLDNMLKDRDGPEDLEKTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGDLLMCGYPWIQNASVRDNIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLT--GMLANKTRILATHQLSLIERASRVIVLGTDGQV 787          

HSP 3 Score: 65.4698 bits (158), Expect = 7.399e-11
Identity = 107/488 (21.93%), Postives = 211/488 (43.24%), Query Frame = 2
Query: 1151 AEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTF-PLNSIAMSWL--------QHYQTEEMEWKDKRIKA---------MTEVLNNMKVIKLYSWESLFFK----IISRNREKEVNLIRLISLCSGVVNIIWDTLPMS-VLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSP--MAVLPYGITIAMNGYVSLKRVSLFLIE-----NKTKNYFSSCQDIRSVIEI--KNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAI-------IGEMCILD------GAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIEND-YKNVIR---ICDLDF-DLRTNQADELNGVDRMLC---------------SGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYY 2419
              I+N  + DTD +   +  S  +++S F  I               +GV V+   + P  +IA+ +L         HYQ+   E K  R++A         + EVL  M  IK Y  +  F      +I++  E       L+ +    V I  D + ++  L+  L      FP       A  V V+L  +L+ P  +  +   +T   N   S +R+  +  E     +  K   +  +   S+ EI  +N  F++R     +LK +N++I  GE +GI G+  +GK+++++A+        G++ I +      G   ++  ++ +PQ+P + + + + N+    +  +++ +  ++R   I   D  +++  + DE NG    +                S G+RQ + L RA+ ++S+I +LD+  S++D     K+  +++   G   + T L +   +  +   D+I+ L E G +  +
Sbjct:  989 GRILNRFTKDTDSLDNELTESLRLMTSQFANI---------------VGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIK--RLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGY----LVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFP-----ISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESWPSMGEIIFENVDFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDE-NGTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFG---DCTILCIAHRLKTIVNYDRILVL-EKGEVAEF 1445          

HSP 4 Score: 54.299 bits (129), Expect = 1.531e-7
Identity = 48/207 (23.19%), Postives = 92/207 (44.44%), Query Frame = 2
Query: 3860 NINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNI---DPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIM-ETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEI 4468
            ++N  I+ GE I I G  G+GK+SL+ ++   +    G +             +    +  +P    I + ++R NI    PFN        + + +  L   L+ +      + G+ G +LS GQ+  + LAR + +   I + D+  ++VD    + IM E +     N T ++  H+ S +E   ++IV+     ++ G   E+
Sbjct:  606 DLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKV-----------EVNGDLLMCGYPW---IQNASVRDNIIFGSPFN---KEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILATHQLSLIERASRVIVLGTDGQVDIGTVDEL 795          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YCF1 (Vacuolar glutathione S-conjugate transporter; ABC-C transporter of the ATP-binding cassette family; required for vacuole fusion; forms stable complexes with vacuole fusion machinery; regulates Vam7p recruitment to vacuoles; role in detoxifying metals (Cd, Hg, As); transports GSSG that is not immediately reduced in cytosol to vacuole; transports unconjugated bilirubin, selenodigluthatione, oxidized glutathione; similar to human cystic fibrosis protein CFTR [Source:SGD;Acc:S000002542])

HSP 1 Score: 309.686 bits (792), Expect = 2.664e-86
Identity = 189/525 (36.00%), Postives = 312/525 (59.43%), Query Frame = 2
Query: 2945 YDYHATANYYMLIYGLIGFGQIIFACFFYLT-FSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAI--CYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESI-NGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEII-NNPNGYFSKC 4501
            Y  +  A  Y+ IY  +G G  +      +  +     +ASK +H+ M N VL++ + +F  +   +ILN FS DI  +D+L+    S+      +V  +  VI  T   F+ +I+P+ + Y    ++YL ++ + + L   + SPI+  F ETL G   +R   Q+K F       +++N    Y     N WL+ RL+ +G+I++ G+  +++    +  LT  +VGL++SY++ I   LNW++   V++ETN +++ER+  +  ++SE       + P  EWP  G I+F  ++ +Y  +    L +IN+ I+  EK+GIVGRTG+GK+SL  +LF+++E   G+++ID+I I +I + D+R  +++ PQ+S +F GT+R+NIDP N   D  + +AL LSHL   + S+ N  L     + G +LSVGQRQLLCLAR +L  SKI+VLDEATA+VD ETD+++ ETI+  F + TIL IAHR + + D D+IIV+D G++ EF    +++ +N + ++S C
Sbjct:  982 YGSNPNAARYLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDNKSLFYSLC 1506          

HSP 2 Score: 280.026 bits (715), Expect = 7.068e-77
Identity = 182/662 (27.49%), Postives = 334/662 (50.45%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFIS--------------------APETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIIS--RNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRV-SLFLIENKTKNYFSSCQDIRSVIEIK-----NGSFSWRSDSE--PILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLR--TNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDA 2449
            +  +    P P + ++I SRI F W+   + + ++  +     + +     ++  +   ++   + LK K+N             S+ W   A+   FGSK++++      H + +F++P +L+ L+KF++                      + P+  GF +A +  + G   +   +  F     T + ++SA+ + +Y KS+ ++NEA    +  +I+NLMS D  K+     +  ++ S PF+II+    L+  +G+   +GV++L+   PLNS  M   +  Q  +M++KD+R + ++E+LNN+K +KLY+WE  + + +   RN ++  NL +L      V +  ++ +P  V       +V    +  +T +  F ++ L N+L  P+ ++P  +   +   VS+ R+ + F  E    +       ++++ ++      + +F W+   E    LK IN    KG L  IVGK+ SGKT+LL+ ++G++  + G  ++ GS++YV Q PWI   + K+NI+   +Y    Y+  I+ C L  DL    +    L G   +  SGGQ+ R++LARAVY +++ YLLDDPL+A+D  VA+ + E V+  NG+L   T++  T  ++ L+  D I  LD NG I   G    I+ DA
Sbjct:  201 HQTLTRRKPNPYDSANIFSRITFSWMSGLMKTGYEKYLVEADLYKLPRNFSSEELSQKLEKNWENELKQKSN------------PSLSW---AICRTFGSKMLLAAFFKAIHDVLAFTQPQLLRILIKFVTDYNSERQDDHSSLQGFENNHPQKLPIVRGFLIAFAMFLVGFTQTSVLHQYFLNVFNTGMYIKSALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKL-GCYMAVTSFQFNIVPFLVSCCTFAVFVYT-EDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLD-NGEITQQGTYDEITKDA 844          

HSP 3 Score: 76.2554 bits (186), Expect = 3.353e-14
Identity = 71/263 (27.00%), Postives = 123/263 (46.77%), Query Frame = 2
Query: 1718 YVSLKRVSLFLIE-NKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLL------------NAIIGEMCILD-GAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRMLCSG------GQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISND 2446
            Y  LK  +  ++E ++    + S  DI+      N S  +R + + +LK INI I   E VGIVG+  +GK+SL             N +I  + I + G   ++  +S +PQ+  + + + ++NI    +Y +      + +  L   + +   D   G+D  L  G      GQRQ + LARA+   S+I +LD+  +A+D V   KV ++ I       + T L +   +N +   D+II LD NG +  +     + +D
Sbjct: 1246 YADLKSEAPLIVEGHRPPKEWPSQGDIK----FNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSND---GLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVD-VETDKVVQETIRT--AFKDRTILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPGQLLSD 1497          

HSP 4 Score: 64.6994 bits (156), Expect = 1.245e-10
Identity = 55/216 (25.46%), Postives = 98/216 (45.37%), Query Frame = 2
Query: 3845 KFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI--KHRFINSTILIIA-HRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPN 4483
            K  L NIN   + G    IVG+ GSGKT+L+  +   +  + G                V  ++    Q   I +GT+++NI   +  +    ++ +    L   L  +        G+ G SLS GQ+  L LAR +   +   +LD+  A+VD+   R ++E +   +  +++   ++A ++ S L   D I ++D GEI + G   EI  + +
Sbjct:  643 KVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKG-------------FATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEITKDAD 845          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO41257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4U1])

HSP 1 Score: 483.797 bits (1244), Expect = 4.546e-147
Identity = 363/1261 (28.79%), Postives = 634/1261 (50.28%), Query Frame = 2
Query:  770 NNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFF--GFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKI--VTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVL-PYGITIAMNGYVSLKRV--SLFLIENKTKNYFSSCQDIRSVIE-----IKNGSFSWRSD-SEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRIC--DLDFDLRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAF-GILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHF--QFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFS 4495
              Y  + RRP         L +AL + FG          +F       +P +L YL+ +    ++P+     +  A    + G+   +       + +   ++VR+A  + +Y K ++++  A ++ T   +INL+S D  K   V    +   +I  P E+ ++   L+ +IG  A  GV +L+   P+     + L   + + + W D+R+K M E++  M+VIK+Y+WE  F K+I   R+ E+     ++   G     + +    +  T    YV      V+TA   F  V L N +R   A+  P+ IT+     VSLKR   +L L E  ++    S   +R   E     +K  S +W  + + P L  ++  +  G L+G++G + SGK+SLLNAI+GE+ + +G++ ++G ++Y  Q  W+   + + NI+  K+Y E+ Y +VI+ C  D DF+L +   + L G   +  SGGQR RI+LARAVY   +IYLLDDPLSA+DA V + +F++ I     L +  R+ VT  + FL   D+I+ L +   I   G    +S +   F+ + +            E    + N    +  S R  + +   +  +     +RK+   V +S ++  S+ +      +    +  +   +Y AY + F   G+      +FA   +  ++ +    WL    +   + + T+     + N  + +        D H    YY+ +Y  + FG  +      +++      AS+ +H+ M + ++ + + +F  +S  +ILN FSKDI  ID  +P  L +V+   F  +    ++  + P+ + +++P+  L+F    +++ S+ + + +   + SP+F  F+ TL G   IRA   +  F  QF LF   +    + Y+      WL+ RL  LG + +   V+     ++ L+   VGL +SYSI +  L    + +  ++E    ++ER+  + ++  E  +K     P  +WP  GKI F   +  Y +     L+N+  VI+  EK+G+VGRTG+GK+SL+ +LF+L EP  G + ID I+IR + + D+R  +++ PQ+  +FSGT+R+N+DPF+   D  L + L+   L   +E + G L  +  + GS+ SVGQRQL+CLAR ILR+S+I+V+DEATA+VD  TD LI ETI+ +F + T+L IAHR   + D D+++V+D G ++EF    +++   N  FS
Sbjct:   46 KRYKQEKRRPS--------LVRALINAFGKGYAALGLFPLFADGLGILQPILLGYLVTYF-VEDSPITKKEAYLYAAGVGLCGLFILLFNVPFAFMKNVYGMRVRAACTALIYKKVLHLSRTALASTTTGNLINLVSADAQKFDWVRLAPFLHYLILGPLEVGVVAVLLWYQIGPAALAGVGLLVCLAPMQVKMGNALMSLRGKAIHWMDERVKIMNEIIAGMRVIKMYTWEDSFAKLIMHLRKNELKWFLRMAYIQGAFASFFFSSAGLIYFTTFLVYV--LTGEVLTAAKVFTCVSLFNSVRIVCALFFPFAITLFNESRVSLKRFEEALLLDEMHSEGLVKST--LRPKAEECGVFVKKASATWNKEIAIPTLDGLSFDVPSGCLLGVIGAVGSGKSSLLNAILGELPLSEGSIRVQGRVAYASQQAWVYNSTLRHNILFGKEYDEHRYNDVIKACALDKDFELLSEGDETLVGERGVSLSGGQRARISLARAVYADGDIYLLDDPLSAVDANVGRHLFQECICT--YLKDKARILVTHQLQFLKDADEIMVLQQGQCIDK-GTYQQLSRNDSGFLSLLA-----------EEVEEETGNESDGDDGSTRFGRPVSKQLSVEE---VVRKRAGNVVDSCMSIMSAATTLTLPPEETKQEGAVSRQTYAAYLRSFHDLGTGVFLIFLFAMCQVRPVMLMFGDVWLANWANREEVYSMTLASWNASSNTTSPSRP------DLH----YYLSVYAALVFGLFVLCLICTMSYYWFTIVASRNLHNGMFHSLIHTNMHFFDNNSIGRILNRFSKDIGVIDDFMPWMLCDVLQIGFSCLGIMCLVAASNPVSIAIVLPVICLFFYFRNYFMKSSREMKRIEGINRSPLFGHFSTTLLGIDTIRAYGVEATFTDQFNLFHDAHSRAWYAYLAG--QAWLTCRLQALGVVFLLFIVLGLPALKDGLSAGTVGLILSYSIMLAKLFEPFVEESAEVENIMTSVERVVEYTSLPPE-GEKVTDVIPPPDWPDKGKITFDNMSFSYHQSLPEVLHNVTCVIKPSEKVGVVGRTGAGKSSLLSTLFRLAEP-KGLIDIDGINIRKLGLKDLRSKLSIIPQDPVLFSGTMRKNLDPFSEHPDAGLWKVLDEVQLKQPVEDLPGKLDEELAEAGSNFSVGQRQLVCLARAILRHSRILVIDEATANVDPRTDALIQETIRDKFQDCTVLTIAHRLHTIMDSDRVMVLDAGRLVEFDAPYKLLKKRNTIFS 1262          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO38355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD35])

HSP 1 Score: 452.981 bits (1164), Expect = 7.337e-136
Identity = 360/1318 (27.31%), Postives = 644/1318 (48.86%), Query Frame = 2
Query:  623 LFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRP-FILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDT---DKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAV-LPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNG--------SFSWRSD---SEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLR--TNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGS--LQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIY-GLIGFGQI---IFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFL-GNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSK 4498
            +F WL++     FQNG K     +  Y+ +    +     KL    K +      S+R  +       L+++     G+  ++     V       ++P FI K +  F+    T     +  A    I   + ++  +  F  T      +R A ++ VY K++ +++ A ST T   IINL+++D    +++   + + WI   +P  +++     + E+G     GV+V++   PL           + +     DKR + M EV++ M+VIK+Y+WE  F  +++  R  EV++IR  +    V  +I+      +   M   YV     + ++ E  F  + L   +R  + + LP  I       VS KR+  FL E   K+   S + +R++ E+K G        +FS R +   S P L+ IN  +   +L+ +VG + +GK+SLL  ++GE+ +  G +S+KG +SY  Q  WI   S ++NI+  K+Y E  Y  VI+ C ++ D+R   N  + L G   +  SGGQ+ RINLARAVY  ++I LLDDPLSA+D  V +++F++ +   G+L +   + VT  + +L     II L ++G     G  + +S   +D M + S  S  D      ++I + +   V   ++     + + S +  Y +I+             N + +    +   +         +V+++ Y +YF A  S  ++    +  FG   ++ V   +WL K                 +    +    + T       T + Y+ IY G+I  G +   + A   Y  F      AS+ +HD M ++VL++ + +F  +   +++N F+KDI+ +D ++P    + +     + +   ++  + P  L+  +P+ +L+  I  +YL ++ + + L   + SP++   + +L G   IRA + ++ F        + +T   ++ +    WL  RLD +  +     +          L+ ++VGL ++Y+  +  +  W I Q  ++E N  ++ER+  ++ ++ E    + L  PD +WP  G I  +     Y +     L N+   I + EK+GIVGRTG+GK+SL+  LF+L  P  G + ID + I D+ + D+R AI++ PQ+  +FSGT+R+N+DPF    D  L  AL    L   ++ +   +  +  + GS+ SVGQRQL+CLAR IL ++KI+V+DEATA+VD  TD LI ETI+++F + T+L IAHR + + D D+++V+D G ++EF +   ++ N  G+FS+
Sbjct:    1 IFSWLNKL----FQNGNKHPLRNEDLYEAMEKDESKRLTDKLERLWKEEKEAAKSSKRKPS-------LSRSFVRFLGTHFMLIGLFAVAEEGMRITQPYFIGKLVSYFVPGSTTTKQEAYIYAAIMSIFSCVMAMVHHPLFFQTFRCGFHLRIACSTMVYRKAMCLSHSAYSTVTTGHIINLLTSDVQILERVAVFLHHLWI---APVLLLVTSVISWYELGPYCLPGVIVVVLIAPLQGWLGKKFAVIRNKTALQTDKRFRIMNEVISGMRVIKMYTWERPFANLVADVRRYEVSIIRKAAYLRSVNAVIYVMCIPVIGFAMFAPYV--LTGHALSPEKVFTVIALFYSIRVSLTIFLPECIRGLKESKVSAKRLQSFL-ERDEKH---SMKGVRTLTELKEGETASVKANNFSARWNDMISTPTLQGINFELKPSDLLMVVGPVGAGKSSLLMCLLGELPLTSGYISVKGRVSYASQQAWIFSGSVRENILFGKEYEEAKYWRVIKACAMERDMRLFPNGYETLVGEKGVALSGGQKARINLARAVYYDADIVLLDDPLSAVDTHVGRQLFDECVY--GLLKDRICVLVTHQLQYLKGATDIICL-QDGRCVGQGSYAELSEAGLDVMSLVSALSAGD-----HDNIISPDIINVPPSSAQFPVPLANGSTRPGYQKIS------------GNVDDAPEGEVLAREPSKEGQHTGTVTWQVYIEYFKAGASPCVRFLIVMLLFGSQAVVMV-GEWWLAKWADSEK---------EKSYLIESYRGTNSTPPPPADLTTHEYIYIYCGMICAGMVTSLVCAMMLYNFF----VTASQHLHDNMFSRVLRAPIYFFDTNPVGRVVNRFAKDINQMDDVLPAAFYDFLRVSLNLTS---LLGSSMPFLLVGAIPMTVLFGYIRNYYLRTSREVKRLEAINRSPVYSHLSTSLTGLITIRAFQAEQAFIRSYHAYTDFHTGSYFLFHTTQRWLGFRLDIICASFFTLATFTSLFIVEGGLS-NVVGLCLTYATQLTGMFQWCIRQSAEVENNMTSVERVIEYSQIDQEVEPSKPLTAPD-DWPHTGTITAESLYYSYHQSLPHVLKNVKFSIRNNEKVGIVGRTGAGKSSLLAVLFRLNNP-EGLVRIDGLPITDLKLQDLRSAISIIPQDPVLFSGTLRKNLDPFTQFSDDALWNALEEVQLKEAVDELPDGIETELAEGGSNFSVGQRQLVCLARAILSHNKILVIDEATANVDHSTDSLIQETIRNKFHDCTVLTIAHRLNTVMDSDRVMVLDAGRLVEFDEPYVLLLNSQGFFSQ 1258          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO37445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS6])

HSP 1 Score: 442.965 bits (1138), Expect = 1.065e-132
Identity = 348/1301 (26.75%), Postives = 622/1301 (47.81%), Query Frame = 2
Query:  620 ILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVF-HIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISL-CSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAV-LPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIE--IKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFS 4495
            ILF W++  +Y  F+  + +E  +++  +   D  T N K      ++     H     P         L K++      K+I       F   + + S   +L + L+ +   ++ L     + + F +  I  +I++N          ++++ A+   +Y K +N +  + ST     +INL+S D  +I   I    + +  P  I++    L   +G  +  G L L        +A       + +     DKR+ AM+EV++ ++ +K+Y+WE  +   +   R KE+ +IRL +L  S  V +   +  ++ L++++     IF    + +   F  + LL  L   + V L   +   ++ +VS++R+  FL+   ++    S +   +++   +      W+ DS   L+ ++ +   G+LV I G + SGK++LL  I GE+ +  G++   G ++YV Q PW+   + ++NI   K+Y +  Y+  I++CDL  D+      +L+  G   +  SGGQR R++LARAVY  ++IYLLDDPLSA+DA V   +F++ I   G L N  R+ VT  + +L + + II L +                     KI  + +F D    H   I  S ++ +++           A ++ +    N+      V+ ++                E+ D  + SV    Y+KYF A     +   IF F I+T   +L+  W     S+                           + +  A+ +   +  GL+G   +       L F +    +S+ +H+ M   +LKS + +F  + S +I+N FSKDI  +D  IP   S  +  +F  M             +L  +P+ + + +I  FYL S+ + Q L     SP++  F +TL G  VIR+S+ +K F  +L +  ++ +  L +      W++  LD +    +F S + A     +  P+  G+ +S +I +    ++ + +  ++E    ++ER+ ++  + SE    ++ L  P  +WP  G + F+  +L Y E     L++I L I   +K+GI GRTG+GK+SL+ +LF++ EP GG +LID ID+  IDI   RRA+ +  Q+  +F GT+R+N+DPF    D  +  A+    L   + ++   L +  G++GS+ SVG+RQLLCLAR +L+  K++VLDEATA+VD  TDR + + I+ RF   T+L IAHR + + D DK+IV+D+G ++E+     +    +G F+
Sbjct:   21 ILFSWMNGILYKGFKRNLTAEDLYELPQE---DQTTYNVKILEQEWIEEIRTAHRLGNYP--------RLYKSVLRALPGKVICKVLTFQFLRGLSTLSYTVLLWFFLRELGLGKSQLALSL-MVVGFTVVSISLAISRNQMELFGLYAGMRLKVALVGLIYKKILNSSRCSLSTVRTGHVINLISNDAKRIELFITNLCLAMLGPVSILVCIVMLCLFVGWQSLSGALFLFIIMLYGQLAAKRFAKLRGKAAAVTDKRLGAMSEVIHGIRAVKMYAWEWNYSDEVKGLRRKEMQIIRLKNLILSTFVALYSVSASIAALISII---TLIFSGIHLDSARIFTLINLLKTLEFAIVVHLGACLGTVLDAFVSIRRIEQFLLGTSSEINQISREGETTILSKTLTKRWIRWQDDS-CTLQGVSFAAGAGDLVIITGPVGSGKSTLLMTIQGELPLNAGSIRRHGHLAYVSQVPWVFSGTVRENITFGKEYDKAAYEKAIKVCDLAKDINRFPKGDLSCIGQRGVSLSGGQRARVSLARAVYADADIYLLDDPLSAVDAKVGSHLFKECIC--GALTNKVRILVTHQLQYLKHANSIIVLSDG--------------------KIAQKGTFQDIDVSHI-GIDVSKDSVIVS----------AAPVEGQQGNHNLIDGVPAVDMAD----------------EEEDQAVGSVKLSLYWKYFRAGLPAVVLFLIFIFCIITEASILAPMWWLSYLSE--------------------------MTPEKQASGSVLGVYAGLVGLSLLTATGMASLLF-IAALRSSENLHNAMTTTILKSPILFFDTNPSGRIMNRFSKDIGTMDDHIPLKFSWTVTLLFHFMGGLLFSAIVEYRLVLSAIPVFVAFLLICWFYLRSSRELQRLEAVRCSPVYSHFTDTLNGLEVIRSSRMEKGFWEQLIRHQDEQSMALSLVISARSWMNNNLDLVS--FLFVSAVAATAAITQQDPASTGMLLSLAIAMAQGTSYGVEKASEVENEMTSVERVISYTRLPSEPGYSRQTL--PCEDWPERGAVTFRDMSLVYREGTPSALDDITLEITAKQKVGIAGRTGAGKSSLLAALFRMPEP-GGEVLIDGIDLGTIDIQAARRAMAVITQDPVLFGGTLRRNLDPFGKFTDQEIWSAIESVQLLNTVRALPDQLMYQLGESGSTFSVGERQLLCLARALLQRCKVLVLDEATANVDYRTDRQVQQLIRSRFTGCTVLTIAHRLNTIMDYDKVIVLDKGHVVEYDTPEMLAGKQDGVFA 1224          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO37818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEN5])

HSP 1 Score: 441.81 bits (1135), Expect = 6.487e-132
Identity = 354/1347 (26.28%), Postives = 654/1347 (48.55%), Query Frame = 2
Query:  590 PEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVF-HIIFSFSRPFILKYLLKFISA-PETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLI--RLISLCSGVVNI--IWDT-LPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAM----NGYVSLKRVSLFLI-----ENKTKNYFSSCQDIRSV-----------IEIKNGSFSWR-SDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRT-NQADE-LNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFL----MVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQ---VLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFH-QSSSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGS------VIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSK 4498
            P+  ++I S+I F W++   Y   +  ++    + +     A+  T   ++  +  L+         + P+ +    W   KAL  V          A+V   +    + P +L +L+ ++    +    F + L     +T +  ++ Q+   + ++   ++ R+A    +Y+K + ++    +  ++  +INL+S D  ++  A    +  + SPF+++++   L+  IG  A  G+   +   P  +    W+   + +     D+R++ M EV++ ++ +K+Y+WE  +  ++ + R     LI  ++  + S   ++   +D+ + +   +T+++T   + P  + T         ++ +L      L YG+T  M    + + SL R+  FL+     E    +  +SCQ+ R             I + N +  W  +D  P+L  IN+  N+ +LV + G + SGK+SLL  ++GE+   +G+V  +G + YVPQ  W+   + ++NI+ SK Y E  Y+  +  CDL  D+ +  Q D  + G      SGGQ+ R+NLARAVY   +IYLLDDPLSA+DA V + +FE  I+  G+L N  R+ VT  +  L   D I+ +D  G+I + GD   + +  +D       +S  + F +  E                            KYHQ++ ++Q L            K++S+S  +     +  +  + ++S K Y++YF  R  L     I    +  I Q   +  + WL                             HM+            ++IYG +  G +  A    L + +     S+ +HD M+  +LK+ + ++    S +ILN FSKDI  +D  +P      +  I Q +AS  V   T    +  +VP+ L +  I ++YL ++ + + +   S SP+     +TL+G  +IR    +  F     ++ +  ++  ++      W+ +RLDF+    V  +      V+M +C+   L     GL++ Y+I  +  L + + Q  D+E    ++ER+ ++  ++ E         P+S WP  G ++F+  +L+Y E     L+N+N+ I+ GE++G+ GRTG+GK+SLV +LF++ +P  G ++IDD +I  ++I + RR I++  Q  T+FSG++R N+DPF+  +D  L   L    +   ++ + G L+F+  ++G++  VG+RQLLCLAR +L  +KIIV+DEATA+VD  TDR I ETI+ +F   T++ IAHR + + D DK++VM++G+ +EF    E++   +G  ++
Sbjct:   20 PKLRANILSKITFWWMNHIFYIGNKRPLEESDLYPLIEDDKAEYLTERLEKAWSKELE---------KIPMGKKPRFW---KALMRVCPVSEYFYIIALVLTDMANRMTLPVLLGFLISYLMGIRDLGASFRYVLPTGICLTSLGRNLAQHHYQNRSALLGMRFRAAATGILYNKVLRMSQSKLAKISSGHVINLVSNDIQRLDLATQNLFASLRSPFDLVVLGVLLWVLIGWQAVTGLAFALILIPYEAEMTGWVAKLRMQAARVTDRRLEVMNEVISGIRAVKMYAWEWPYRDVVRQIRRYGPVLIMRKIYGILSSFASLQHTYDSVICLIAFITLVFTGTRLTPYNIFT---------MVGLLSENRRSLVYGLTDGMQLIADCFASLDRIEHFLLIEELSETGGSSRKASCQEEREEENEEEKEGEPYIRVNNVACHWNGTDVSPVLSDINMDFNENKLVLVTGPVGSGKSSLLLTLLGELLPSEGSVKTRGEVVYVPQTAWVFSGTVRENILFSKPYDEERYQRTLEACDLAKDIVSLPQGDATILGERGASLSGGQKARVNLARAVYADGDIYLLDDPLSAVDAKVGKHIFENCIT--GVLENKIRILVTHQLQHLKNADYIMIMDR-GAISHEGDYQQVQDSGLDL------ESLEEEFRQGWE----------------------------KYHQLHDKEQPLSKEKQAVKKATKKDTSDSEPIQGMARKAEERHVGTISAKLYWRYF--RSGLHACLLILLVLLFLIAQASIISPNLWL----------------------------VHMSRMKWVEQKHKLNLIIYGCLVGGALFLAIIRGLLYYITTLRCSENLHDKMVVSILKTPVHFYDTNPSGRILNRFSKDIGIVDEFLPPTSLLALQYILQTLASVCVTCSTNYWAIFGVVPMLLGFIGINRYYLKTSREIKRMEAISQSPVLAHLADTLEGIVLIRTYHMENRFIQRFNEVQDHRSQIWFLVPHTARWMGIRLDFVCTAFVAIATFTGILVLMQMCFSGTL-----GLSLVYAISTVGQLQFAMRQTADVENMMTSVERVMSYTHLDEEPGYYIEKKAPES-WPAHGNVKFENVSLRYYEGGPQVLHNLNIDIKGGERVGVAGRTGAGKSSLVAALFRMPDP-EGKIIIDDQEIGQLNIQNTRRVISVITQNPTLFSGSLRINLDPFSRYDDAALWNVLEQVEMKDKVKELPGELYFELSESGNNFGVGERQLLCLARALLNKNKIIVMDEATANVDFNTDRSIQETIRSKFSGCTVITIAHRLNTILDYDKVLVMEKGQAMEFDSPDELLKRGDGMLTE 1271          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO37461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS4])

HSP 1 Score: 439.499 bits (1129), Expect = 1.645e-131
Identity = 344/1317 (26.12%), Postives = 624/1317 (47.38%), Query Frame = 2
Query:  620 ILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSR-------PFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRL----ISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITI--------AMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIE--IKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN--GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSS-SQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFS 4495
            ILF W++  +Y  F+  + +E  +++  +   D  T N      + L+ + N   ++   +  +  ++   K++      K+I   C +   + F F R         +L + L+ +   ++ L     + + F +  I  +I++N          ++++ A+   +Y K +N +  + ST     +INL+S D  +I   I+   + I  PF+I++    L   +G  +  G L L        +A       + +     D+R+ A++EV++ ++ +K+Y+WE  +   I   R  E+ +IRL    +S    + ++      +  ++T++++ +++ P  + T         ++N+L+S    L + I +         ++ +VS++R+  FL+   ++    SC+   +++   +      W+ DS   L+ ++ +   G+LV I G + SGK++LL  I GE+ +  G++   G ++YV Q  W+   + ++NI   K+Y +  Y+  I++CDL  D+      +L+  G   +  SGGQR R++LARAVY  ++IYLLDDPLSA+DA V   +F++ I   G L N  R+ VT  + +L + D II L +                     KI  + +F D    H   I  S ++ +         +  H  I                                    E+ D  + SV    Y+KYF A  S  +   IF F + T   +L+  W     S+                           + +  A+ +   +  GL+G   +       L F +    +S+ +H+ M   +LKS + +F  +   +I+N FSKDI  +D  IP   S  +  +F  M             +L  +P+ + + +I  FYL S+ + Q L     SP++  F +TL G  VIR+S+ +K F  +L +  ++ T  L +      W+   LD +    +F S + A     +  P+  G+ +S +I +    ++ + +  ++E    ++ER+ ++  + SE    ++ L  P  +WP  G + F+  +L Y E     L++I L I   +++GI GRTG+GK+ L+ +LF+L EP GG +LID +D+  IDI   RRA+ +  Q+  +F GT+R+N+DPF+   D  +  AL    L   + ++   L +  G++GS+ SVG+RQLLCLAR +L+  K++VLDEATA+VD  TDR + + I+ RF   T+L IAHR + + D DK+IV+D+G ++E+     +    +G F+
Sbjct:   21 ILFSWMNGILYKGFKRNLTAEDLYELPQE---DQTTYN-----VNILEQEWNEEIRTAHRLGNYPRLY---KSVLRALPGKVI---CKV---LTFQFLRGRSTLSYTVLLWFFLRELGLGKSQLALSL-MVVGFTVVSISRAISRNQMELFGLYAGMRLKVALIGLIYKKILNSSRCSLSTVRTGYVINLISNDAKRIELFISNFSMAILGPFKIVVCIVMLCLFVGWQSLSGALFLFIIMLYGQLAAKQFAKLRGKAAAVTDRRLGAVSEVIHGIRAMKMYAWEWNYSDEIKGLRRLEMQIIRLKNLILSTFVALYSVSASIAALISIITLIFSGIHLDPARIFT---------VINLLKS----LEFAIVVDLAECLREVLDAFVSIRRIEQFLLGASSEINRISCEGETTILSKTLTKRWIRWQDDS-CTLQGVSFAAGAGDLVIITGPVGSGKSTLLMTIQGELPLNAGSIRRHGHLAYVSQMSWVFSGTVRENITFGKEYGKAAYEKAIKVCDLAKDINRFPKGDLSCIGQRGVSLSGGQRTRVSLARAVYADADIYLLDDPLSAVDAKVGSHLFKECIC--GALTNKVRILVTHQLQYLKHADSIIVLSDG--------------------KIAQKGTFQDMDVSHI-GIDVSKDSVIDGAAPVEGQQGHHDLIDGA--------------------------PAVDMADEEEDQAVGSVRLSLYWKYFRAGLSAVVLLLIFIFCVFTEASILAPMWWLSYLSE--------------------------MTPEKQASGSVLGVYAGLVGLSLLTATGMASLLF-IAALRSSENLHNAMTTTILKSPILFFDTNPFGRIMNRFSKDIGTMDDHIPLKFSWTVTLLFHFMGVLLFSAIVEYRLVLSAIPVFVDFLLICWFYLRSSRELQRLEAVRCSPVYSHFTDTLTGLEVIRSSRMEKRFWEQLVRHQDEQTMALSLVISARRWMDNNLDLI--CFLFVSAVAATAAIIQQDPASTGMLLSLAIAMAQGTSYGVEKASEVENEMTSVERVISYTRLPSEPGYSRQTL--PCEDWPERGAVTFRDMSLVYREGTPSALDDITLEITAKQRVGIAGRTGAGKSFLLAALFRLPEP-GGEVLIDGVDLGTIDIQAARRAMAVITQDPVLFGGTLRRNLDPFDKFTDQEIWAALESVQLLNTVRALPDQLMYQLGESGSTFSVGERQLLCLARALLQRCKVLVLDEATANVDYRTDRQVQQLIRSRFTGCTVLTIAHRLNTIMDYDKVIVLDKGHVVEYDTPGMLAGKQDGVFA 1224          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 451/1361 (33.14%), Postives = 727/1361 (53.42%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVAD-------VNTMNFKR---KLTSTLKSKNNYHTKSRRPINE-------------HSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFG-FTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQA-DELN-GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFL--DENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSK--YHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKS-VSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML--IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDS---EWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
            +  +++ NPCPE  +S  SRI F W+   + S ++  ++ +  + ++ +    CV               KR   K+  + K   +   K  R + E               S+ W   AL   F    ++S    +   I  F  P IL+ L+ F++ P+ P + G F  A+ F+ T + S I Q   FH+   + +++R+A+  A+Y K++ I++ A+ + T  EI+NLMS D  + +  + Y  ++ S+P +++L   FL+  +G   LA + V++LM   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +S+ RE E+ +++  +    V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +       +       I I++G FSW     P LKR+N+ I +G LV +VG + SGK+SLL+A++GEM  ++G+VS+KGS++YVPQ  WI   + K+NI+  +K  E  Y  V+  C L  DL    A DE   G   +  SGGQ+QR++LARAVY    +YLLDDPLSA+DA V + +F+ VI   G+L + TR+ VT  +++L     ++ +   E   +  Y  +        +F+++ +    S    E TE +  S    + N           AS  SK    + N+ ++              NS++    K+ D D  +   V    +F Y  A G L    S+  F    +L + ++YWL   T DP +                                N  M   +YG +G  Q +  C + L+ S+G   AS+ +H  ML  VL+S + +F ++ S  ++N F+K++D IDS+IP  L   +  +F V+ S  +IL   P+  L+I  +G+LYF + +FY+ S+ Q + L   S SPI+  F+ETL G  VIRA  +++ F  E  + ++ N K  Y   V N WL++RL+F+GN +V  + + A+  R  L+P ++GL+ISY++ +   L W++    D+ETN +A+ER+  ++  E E    E+ + P +   +WP  G I    F L+Y  D    + NIN+ I  GEK+GIVGRTG+GK+SL   LF+++EP  G++ ID +DI  + + ++R  IT+ PQ+  +FSGT+R N+DPF+   D  + +AL  SHL  ++  +   L  +C + G +LS+GQRQLLCLAR +LR +K++VLDEATA++D ETD LI  TI+ +F   T+L IAHR + + D  +++V+D+G++ EF   S +I     ++   K
Sbjct:  199 SQAVKDPNPCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVEESEILIVKSPKKSREPSLLW---ALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRY-FHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILM--VPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQS----EETEPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQK--------------NSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVV---------------------------NGTQPNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKE---AEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAQKGAFYRMAK 1505          

HSP 2 Score: 71.2478 bits (173), Expect = 8.402e-12
Identity = 52/222 (23.42%), Postives = 103/222 (46.40%), Query Frame = 2
Query: 3854 LNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLY 4510
            L  +N+ I  G  + +VG  GSGK+SL+ +L   ++ + GS+              V+ ++   PQ++ I + T++ NI      ++    + +    L   LE +      + G+ G +LS GQ+Q + LAR +  +  + +LD+  ++VD    + I + +   +    + T +++ H  S L     ++VM  GEI E G   ++      +    ++Y
Sbjct:  658 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMY 866          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc6a (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101158001])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 418/1348 (31.01%), Postives = 712/1348 (52.82%), Query Frame = 2
Query:  575 NNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTF-----DVHYQCVADVNTMNFKRKLTSTLKSKNNYHTK----SRRPIN---------EHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTK----NYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDL--DFD-LRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSFSD---PFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQ--------INIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFN-DKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCK 4504
              NPCP + +S  S+ILF W    +   ++  +++   +     D  ++ ++D+    +  +     K + +  +     SR P           E SS ++L + L   FG   +     I+FH  F F+ P +L  LL FI  PE P + G+  A    +   L S+  +   +   T  ++V++A+   VY KS+ IN+ A+ T T  EI+NL+S DT K++  + Y   V  +P EI L   FL+  +G  A  G+  ++  FPLN          Q  +M++ D R++ M E+LN +K++K Y+WE  F + +   REKE+  ++   +   +    +++    +   M   YV +    V+ A+  FVS+ L+N+L++P++ LP+ I+  M   VSL+R+  +L   + K    +   S  D   V+ I+NG+FSW  +  P LKRI++ + +G LV +VG + SGK+SLL+A++GE     G V++KGS++YVPQ  WI+  + +DNI+  ++ ++  Y+ V+  C L  D D L    A E+ G   +  SGGQ+QR++LARAVY+K+++YLLDDPLSA+DA V Q +F+KVI   G+L + TR+ VT  ++FL   D I+ L  +G I   G    +         +    +F+D    FA  TE   ++       R++ R+  +          Q         N   Q +   +                  +     +K   YK YFK     G   +   +F +       +  SYWL     DP +                                +  + ++G +GF Q I      +  S+    AS+ +H  +L  VL+S + +F  + S  +LN F K+ID ID ++P  L  +++ +F+++    ++L   P+  ++I+P+  LY  +  FY+ ++CQ + L   S SPI+  FNET+QG  VIRA  ++  F  +  + ++ N    + + V   WL++ L+F+GN +V  + ++++  ++ ++P +VGL +S+S+ +  +L+W++  + D+E N +++ER++ +     E + + E    P + WP+ G IEF+ + L+Y +  +  L  I L I+  EKIGIVGRTG+GK+SL   +F+++E   G + ID ++I +I + D+R  IT+ PQ+  +FSG++R N+DPF+   D  +  +L L+HL  ++ ++   L+ +C + G +LS+GQRQL+CLAR +LR +KI+VLDEATA+VD ETD LI  TI+ +F + T+L IAHR + + D  ++IVMDRG I E    + +I+    ++  C+
Sbjct:  201 EKNPCPVKDASFLSKILFWWFTGLVVKGYRTPLEATDLWTLREEDTSHKIISDLQ-QEWGAECAKLQKQEKSLESAPVLGSRLPDQAQLLRKLQKEQSSGFFLLRTLARKFGPYFLTGTLCIIFHDAFMFAIPQVLSLLLGFIRDPEAPQWKGYFYATLMFLLSCLQSLFNHQYMYTCFTVGMRVKTAVMGLVYRKSLVINSAARRTCTVGEIVNLVSADTQKLMDFVVYFNAVWLAPIEIGLCLFFLWQHLGPSALAGIATVILIFPLNGFIAKKRSKLQEIQMKFMDGRVRLMNEILNGIKILKFYAWEKAFLEQVLGYREKELKALKKSQVLYSISIASFNSSSFLIAFAMFGVYVMLDERNVLDAQKVFVSMALINILKTPLSQLPFAISTTMQALVSLRRLGKYLCSEELKVDGVSKALSSSDGEDVV-IENGTFSWSKEGPPCLKRISVRVPRGSLVAVVGHVGSGKSSLLSAMLGETEKRSGQVTVKGSVAYVPQQAWIQNATVQDNILFGREKLKTWYQRVLEACALLPDLDILPAGDATEI-GEKGLNLSGGQKQRVSLARAVYRKADLYLLDDPLSAVDAHVGQHIFDKVIGPKGVLKDRTRILVTHGMSFLPQADLILVLI-DGEITESGSYQEL---------LSHHGAFADFIHTFAS-TEKKESAIQRAGSRRSNARLSMVDFMPFSRDLSQEQLIGGDTTNTNLQNMEPVSENDQDQVPEDLGKLTEADKAHTGRVKLDMYKKYFKTI---GLAIIIPIVFLYAFQQGASLAYSYWLSMWADDPVV-------------------------NGTQTDRDLKLAVFGALGFVQGIAIFGTTVAISICGIIASRQLHMDLLVNVLRSPMAFFESTPSGNLLNRFVKEIDAIDCMVPEGLKMMLSYVFKLVEVCIIVLIATPIAAVIILPLAFLYAFVQSFYVATSCQLRRLEAVSRSPIYTHFNETVQGASVIRAFGEQSRFIMQANERVDFNQTSYFPRFVATRWLAVNLEFVGNGVVLAAAVLSVIGKSTVSPGIVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVNEYADTPKEASWNTEGSALPLA-WPQSGTIEFQDYGLQYRKGLELALKGITLQIQKREKIGIVGRTGAGKSSLALGIFRILEAAKGRIFIDGVNIAEIGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDIYTDEEIWSSLELAHLKDFVSNLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDTLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGYISEMDSPANLISQRGQFYRMCR 1505          

HSP 2 Score: 64.3142 bits (155), Expect = 1.241e-9
Identity = 67/282 (23.76%), Postives = 125/282 (44.33%), Query Frame = 2
Query: 1712 NGYVSLKRVSLFLIENKTKNYFSSCQDI------RSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKG-------------SMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELN-----GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSEKSF 2485
            N  VS++RV+ +    K  ++ +    +         IE ++    +R   E  LK I + I K E +GIVG+  +GK+SL   I   +    G + I G              ++ +PQ+P +   S + N+     Y + +  + + +  L  D  +N  D+LN     G + +  S GQRQ + LARA+ +K++I +LD+  +A+D +    + +  I       + T L +   +N +    ++I +D  G I      +N+ +    F ++  E   
Sbjct: 1235 NNIVSVERVNEYADTPKEASWNTEGSALPLAWPQSGTIEFQDYGLQYRKGLELALKGITLQIQKREKIGIVGRTGAGKSSLALGIFRILEAAKGRIFIDGVNIAEIGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDIYTDEEIWSSLELAHLK-DFVSNLPDKLNHECSEGGENL--SLGQRQLVCLARALLRKTKILVLDEATAAVD-LETDTLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVMD-RGYISEMDSPANLISQRGQFYRMCREAGL 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 442/1328 (33.28%), Postives = 708/1328 (53.31%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVAD-------VNTMNFKR---KLTSTLKSKNNYHTKSRRPINE-------------HSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFG-FTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQA-DELN-GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFL--DENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHAS--IKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKS-VSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML--IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDS---EWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLED 4405
            +  +++ NPCPE  +S  SRI F W+   + S ++  ++ +  + ++ +    CV               KR   K+  + K   +   K  R + E               S+ W   AL   F    ++S    +   I  F  P IL+ L+ F++ P+ P + G F  A+ F+ T + S I Q   FH+   + +++R+A+  A+Y K++ I++ A+ + T  EI+NLMS D  + +  + Y  ++ S+P +++L   FL+  +G   LA + V++LM   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +S+ RE E+ +++  +    V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +       +       I I++G FSW     P LKR+N+ I +G LV +VG + SGK+SLL+A++GEM  ++G+VS+KGS++YVPQ  WI   + K+NI+  +K  E  Y  V+  C L  DL    A DE   G   +  SGGQ+QR++LARAVY    +YLLDDPLSA+DA V + +F+ VI   G+L + TR+ VT  +++L     ++ +   E   +  Y  +        +F+++ +    S    E TE +  S    + N           AS   K    + N+ ++              NS++    K+ D D  +   V    +F Y  A G L    S+  F    +L + ++YWL   T DP +                                N  M   +YG +G  Q +  C + L+ S+G   AS+ +H  ML  VL+S + +F ++ S  ++N F+K++D IDS+IP  L   +  +F V+ S  +IL   P+  L+I  +G+LYF + +FY+ S+ Q + L   S SPI+  F+ETL G  VIRA  +++ F  E  + ++ N K  Y   V N WL++RL+F+GN +V  + + A+  R  L+P ++GL+ISY++ +   L W++    D+ETN +A+ER+  ++  E E    E+ + P +   +WP  G I    F L+Y  D    + NIN+ I  GEK+GIVGRTG+GK+SL   LF+++EP  G++ ID +DI  + + ++R  IT+ PQ+  +FSGT+R N+DPF+   D  + +AL  SHL  ++  +   L  +C + G +LS+GQRQLLCLAR +LR +K++VLDEATA++D ETD LI  TI+ +F   T+L IAHR + + D
Sbjct:  199 SQAVKDPNPCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVEESEILIVKSPKKSREPSLLW---ALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQR-YFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILM--VPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQS----EETEPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQK--------------NSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVV---------------------------NGTQPNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKE---AEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMD 1472          

HSP 2 Score: 71.633 bits (174), Expect = 6.985e-12
Identity = 52/222 (23.42%), Postives = 103/222 (46.40%), Query Frame = 2
Query: 3854 LNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLY 4510
            L  +N+ I  G  + +VG  GSGK+SL+ +L   ++ + GS+              V+ ++   PQ++ I + T++ NI      ++    + +    L   LE +      + G+ G +LS GQ+Q + LAR +  +  + +LD+  ++VD    + I + +   +    + T +++ H  S L     ++VM  GEI E G   ++      +    ++Y
Sbjct:  658 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMY 866          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 442/1328 (33.28%), Postives = 708/1328 (53.31%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVAD-------VNTMNFKR---KLTSTLKSKNNYHTKSRRPINE-------------HSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFG-FTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQA-DELN-GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFL--DENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHAS--IKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKS-VSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML--IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDS---EWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLED 4405
            +  +++ NPCPE  +S  SRI F W+   + S ++  ++ +  + ++ +    CV               KR   K+  + K   +   K  R + E               S+ W   AL   F    ++S    +   I  F  P IL+ L+ F++ P+ P + G F  A+ F+ T + S I Q   FH+   + +++R+A+  A+Y K++ I++ A+ + T  EI+NLMS D  + +  + Y  ++ S+P +++L   FL+  +G   LA + V++LM   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +S+ RE E+ +++  +    V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +       +       I I++G FSW     P LKR+N+ I +G LV +VG + SGK+SLL+A++GEM  ++G+VS+KGS++YVPQ  WI   + K+NI+  +K  E  Y  V+  C L  DL    A DE   G   +  SGGQ+QR++LARAVY    +YLLDDPLSA+DA V + +F+ VI   G+L + TR+ VT  +++L     ++ +   E   +  Y  +        +F+++ +    S    E TE +  S    + N           AS   K    + N+ ++              NS++    K+ D D  +   V    +F Y  A G L    S+  F    +L + ++YWL   T DP +                                N  M   +YG +G  Q +  C + L+ S+G   AS+ +H  ML  VL+S + +F ++ S  ++N F+K++D IDS+IP  L   +  +F V+ S  +IL   P+  L+I  +G+LYF + +FY+ S+ Q + L   S SPI+  F+ETL G  VIRA  +++ F  E  + ++ N K  Y   V N WL++RL+F+GN +V  + + A+  R  L+P ++GL+ISY++ +   L W++    D+ETN +A+ER+  ++  E E    E+ + P +   +WP  G I    F L+Y  D    + NIN+ I  GEK+GIVGRTG+GK+SL   LF+++EP  G++ ID +DI  + + ++R  IT+ PQ+  +FSGT+R N+DPF+   D  + +AL  SHL  ++  +   L  +C + G +LS+GQRQLLCLAR +LR +K++VLDEATA++D ETD LI  TI+ +F   T+L IAHR + + D
Sbjct:  199 SQAVKDPNPCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVEESEILIVKSPKKSREPSLLW---ALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQR-YFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILM--VPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQS----EETEPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQK--------------NSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVV---------------------------NGTQPNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKE---AEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMD 1472          

HSP 2 Score: 71.633 bits (174), Expect = 7.795e-12
Identity = 52/222 (23.42%), Postives = 103/222 (46.40%), Query Frame = 2
Query: 3854 LNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLY 4510
            L  +N+ I  G  + +VG  GSGK+SL+ +L   ++ + GS+              V+ ++   PQ++ I + T++ NI      ++    + +    L   LE +      + G+ G +LS GQ+Q + LAR +  +  + +LD+  ++VD    + I + +   +    + T +++ H  S L     ++VM  GEI E G   ++      +    ++Y
Sbjct:  658 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMY 866          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 442/1328 (33.28%), Postives = 708/1328 (53.31%), Query Frame = 2
Query:  560 NSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQ----CVAD-------VNTMNFKR---KLTSTLKSKNNYHTKSRRPINE-------------HSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFG-FTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGS--LASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKN---YFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQA-DELN-GVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFL--DENGSIKYYGDVSNISNDAIDFMKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHAS--IKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKS-VSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYML--IYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQS-SSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDS---EWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLED 4405
            +  +++ NPCPE  +S  SRI F W+   + S ++  ++ +  + ++ +    CV               KR   K+  + K   +   K  R + E               S+ W   AL   F    ++S    +   I  F  P IL+ L+ F++ P+ P + G F  A+ F+ T + S I Q   FH+   + +++R+A+  A+Y K++ I++ A+ + T  EI+NLMS D  + +  + Y  ++ S+P +++L   FL+  +G   LA + V++LM   P+N++     + YQ  +M+ KD RIK M E+LN +KV+KLY+WE  F + +S+ RE E+ +++  +    V    W   P  V L+    YV I    V+ AE  FVS+ L N+LR P+ +LP  I+  +   VSLKR+ +FL   + +       +       I I++G FSW     P LKR+N+ I +G LV +VG + SGK+SLL+A++GEM  ++G+VS+KGS++YVPQ  WI   + K+NI+  +K  E  Y  V+  C L  DL    A DE   G   +  SGGQ+QR++LARAVY    +YLLDDPLSA+DA V + +F+ VI   G+L + TR+ VT  +++L     ++ +   E   +  Y  +        +F+++ +    S    E TE +  S    + N           AS   K    + N+ ++              NS++    K+ D D  +   V    +F Y  A G L    S+  F    +L + ++YWL   T DP +                                N  M   +YG +G  Q +  C + L+ S+G   AS+ +H  ML  VL+S + +F ++ S  ++N F+K++D IDS+IP  L   +  +F V+ S  +IL   P+  L+I  +G+LYF + +FY+ S+ Q + L   S SPI+  F+ETL G  VIRA  +++ F  E  + ++ N K  Y   V N WL++RL+F+GN +V  + + A+  R  L+P ++GL+ISY++ +   L W++    D+ETN +A+ER+  ++  E E    E+ + P +   +WP  G I    F L+Y  D    + NIN+ I  GEK+GIVGRTG+GK+SL   LF+++EP  G++ ID +DI  + + ++R  IT+ PQ+  +FSGT+R N+DPF+   D  + +AL  SHL  ++  +   L  +C + G +LS+GQRQLLCLAR +LR +K++VLDEATA++D ETD LI  TI+ +F   T+L IAHR + + D
Sbjct:  237 SQAVKDPNPCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVEESEILIVKSPKKSREPSLLW---ALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQR-YFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILM--VPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQS----EETEPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQK--------------NSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVV---------------------------NGTQPNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKE---AEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMD 1510          

HSP 2 Score: 71.2478 bits (173), Expect = 8.319e-12
Identity = 52/222 (23.42%), Postives = 103/222 (46.40%), Query Frame = 2
Query: 3854 LNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETI---KHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLY 4510
            L  +N+ I  G  + +VG  GSGK+SL+ +L   ++ + GS+              V+ ++   PQ++ I + T++ NI      ++    + +    L   LE +      + G+ G +LS GQ+Q + LAR +  +  + +LD+  ++VD    + I + +   +    + T +++ H  S L     ++VM  GEI E G   ++      +    ++Y
Sbjct:  696 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMY 904          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000018910.1 (SMESG000018910.1)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 672/673 (99.85%), Postives = 673/673 (100.00%), Query Frame = 2
Query:   77 MTINVLHVLQLTSCSYFLIQFLLYLHKRHYETSRPIVRINFNKGYILCYSLNFLMVILLSFETIKNYSRNELFSSFIYYMWSVTTILVVVLFEIRRRTMHPMCYILFSYLTFTTSLCIIRYCQEFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNV 2095
            MTINVLHVLQLTSCSYFLIQFLLYLHKRHYETSRPIVRINFNKGYILCYSLNFLMVILLSFETIKNYSRNELFSSFIYYMWSVTTILVVVLFEIRRRTMHPMCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKN+
Sbjct:    1 MTINVLHVLQLTSCSYFLIQFLLYLHKRHYETSRPIVRINFNKGYILCYSLNFLMVILLSFETIKNYSRNELFSSFIYYMWSVTTILVVVLFEIRRRTMHPMCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNM 673          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000018912.1 (SMESG000018912.1)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 685/686 (99.85%), Postives = 685/686 (99.85%), Query Frame = 2
Query: 2459 MKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVXXXXXXXXXXXXXXXXXXXXEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILXXXXXXXXXXXXXXXXXXXHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSSSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTXXXXXXXXXXXXXXYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLXXXXXXXXXXXXXXXXXXTMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLYEC 4516
            MKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVNNSEINKNSSNSRSLSQSKSEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILNNTIIGNFDNKNNNNQNHNHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSSSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTFPLFLLLIVPIGLLYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLIDDIDIRDIDITDVRRAITMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNL FDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLYEC
Sbjct:    1 MKIKSEKSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQFLMVNNSEINKNSSNSRSLSQSKSEDFDTEIKSVSYKAYFKYFLARGSLQLFCSIFAFGILTILQVLSSYWLEKLTSDPNILNNTIIGNFDNKNNNNQNHNHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIHDCMLNKVLKSKLQYFHQSSSQILNFFSKDIDNIDSLIPNNLSEVINCIFQVMASFFVILHTFPLFLLLIVPIGLLYFIILKFYLPSACQTQMLCVKSSSPIFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLSLRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQYVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLIDDIDIRDIDITDVRRAITMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLDFDCGDNGSSLSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVMDRGEIIEFGKTSEIINNPNGYFSKCKLYEC 686          

HSP 2 Score: 68.5514 bits (166), Expect = 2.941e-11
Identity = 62/239 (25.94%), Postives = 106/239 (44.35%), Query Frame = 2
Query: 1805 IEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAV-------------SIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNVIRIC-----------DLDFDLRTNQADELNGVDRMLCSGGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILANTTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDA 2449
            IE K  +  +  D +  L  IN+ I  GE +GIVG+  SGKTSL+ ++   +  + G++              ++ +++  PQ   I   + + NI       ++  K  + +            +LDFD   N +           S GQRQ + LAR + + S+I +LD+  +++D    + + E +        N+T L +    + L  LDKII +D  G I  +G  S I N+ 
Sbjct:  449 IEFKKFNLKYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGSLLIDDIDIRDIDITDVRRAITMFPQESTIFSGTIRQNIDPFNFLEDHVLKQALNLSHLGPWLESINGNLDFDCGDNGSS---------LSVGQRQLLCLARVILRNSKIIVLDEATASVDQETDRLIMETIKHR---FINSTILIIAHRTSGLEDLDKIIVMDR-GEIIEFGKTSEIINNP 674          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000018910.1 (SMESG000018910.1)

HSP 1 Score: 1088.56 bits (2814), Expect = 0.000e+0
Identity = 574/575 (99.83%), Postives = 575/575 (100.00%), Query Frame = 2
Query:  371 MHPMCYILFSYLTFTTSLCIIRYCQEFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNV 2095
            MHPMCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKN+
Sbjct:    1 MHPMCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNM 575          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000018910.1 (SMESG000018910.1)

HSP 1 Score: 1079.7 bits (2791), Expect = 0.000e+0
Identity = 571/572 (99.83%), Postives = 572/572 (100.00%), Query Frame = 2
Query:  380 MCYILFSYLTFTTSLCIIRYCQEFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNV 2095
            MCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKN+
Sbjct:    1 MCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNM 572          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000018910.1 (SMESG000018910.1)

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 557/673 (82.76%), Postives = 575/673 (85.44%), Query Frame = 2
Query:   77 MTINVLHVLQLTSCSYFLIQFLLYLHKRHYETSRPIVRINFNKGYILCYSLNFLMVILLSFETIKNYSRNELFSSFIYYMWSVTTILVVVLFEIRRRTMHPMCYILFSYLTFTTSLCIIRYCQEFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLLTMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVSLKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNV 2095
            MTINVLHVLQLTSCSYFLIQFLLYLHKRHYETSRPIVRINFNKGYILCYSLNFLMVILLSFETIKNYSRNELFSSFIYYMWSVTTILVVVLFEIRRRTMHPMCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESL  +        E     ++ +C  +  +  D     V +     +V +          T+ S  L N  R              N Y+     S+  I+N + ++ S  + I                    LKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKN+
Sbjct:    1 MTINVLHVLQLTSCSYFLIQFLLYLHKRHYETSRPIVRINFNKGYILCYSLNFLMVILLSFETIKNYSRNELFSSFIYYMWSVTTILVVVLFEIRRRTMHPMCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSLIFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIKSESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWWLTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFFGFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININNEAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEIGSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNMKVIKLYSWESLSSQYNLGYTSNERAFDNVVDICQYIPKLC-DNCRSDVCICCFVEHVKV----------TYGSFALRNNYR--------------NEYIR----SVIEIKNGSFSWRSDSEPI--------------------LKRINISINKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWIRKISTKDNIILSKKYIENDYKNM 624          

HSP 2 Score: 135.191 bits (339), Expect = 3.444e-32
Identity = 61/63 (96.83%), Postives = 63/63 (100.00%), Query Frame = 1
Query: 1531 SSQYNLGYTSNERAFDNVVDICQYIPKLCDNCRSDVCICCFVEHVKVTYGSFALRNNYRNEWL 1719
            SSQYNLGYTSNERAFDNVVDICQYIPKLCDNCRSDVCICCFVEHVKVTYGSFALRNNYRNE++
Sbjct:  462 SSQYNLGYTSNERAFDNVVDICQYIPKLCDNCRSDVCICCFVEHVKVTYGSFALRNNYRNEYI 524          
The following BLAST results are available for this feature:
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCC10.000e+032.70ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+032.70ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+032.46ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+032.46ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+033.60ATP binding cassette subfamily C member 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrp-10.000e+031.73pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-20.000e+031.69pep chromosome:WBcel235:X:563719:572701:-1 gene:WB... [more]
mrp-10.000e+031.73pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+031.65pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+031.47pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRP0.000e+031.12gene:FBgn0032456 transcript:FBtr0090025[more]
MRP8.441e-1131.17gene:FBgn0032456 transcript:FBtr0090026[more]
MRP0.000e+031.17gene:FBgn0032456 transcript:FBtr0090023[more]
MRP1.034e-1031.24gene:FBgn0032456 transcript:FBtr0090022[more]
MRP0.000e+030.95gene:FBgn0032456 transcript:FBtr0090021[more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc12.544e-1633.43ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc30.000e+031.10ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc6b.22.866e-933.26ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc6b.25.398e-932.84ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc6b.25.141e-932.81ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCC10.000e+033.73ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+033.70ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+033.58ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+033.53ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+035.05ATP binding cassette subfamily C member 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcc10.000e+032.72ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+031.01ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+031.16ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc24.702e-1030.72ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc61.922e-15227.26ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F364|MRP1_CHICK0.000e+033.28Multidrug resistance-associated protein 1 OS=Gallu... [more]
sp|O35379|MRP1_MOUSE0.000e+032.72Multidrug resistance-associated protein 1 OS=Mus m... [more]
sp|Q8CG09|MRP1_RAT0.000e+032.48Multidrug resistance-associated protein 1 OS=Rattu... [more]
sp|P33527|MRP1_HUMAN0.000e+032.70Multidrug resistance-associated protein 1 OS=Homo ... [more]
sp|Q8HXQ5|MRP1_BOVIN0.000e+032.72Multidrug resistance-associated protein 1 OS=Bos t... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A093SCZ80.000e+033.92Multidrug resistance-associated protein 1 (Fragmen... [more]
A0A091QFK80.000e+033.43Multidrug resistance-associated protein 1 (Fragmen... [more]
A0A093CK560.000e+034.10Multidrug resistance-associated protein 1 (Fragmen... [more]
A0A091S8C90.000e+033.16Multidrug resistance-associated protein 1 (Fragmen... [more]
A0A091GNP10.000e+033.33Multidrug resistance-associated protein 1 (Fragmen... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc19.611e-1633.41ATP binding cassette subfamily C member 1 [Source:... [more]
abcc11.037e-1533.09ATP binding cassette subfamily C member 1 [Source:... [more]
abcc30.000e+031.49ATP binding cassette subfamily C member 3 [Source:... [more]
abcc30.000e+031.53ATP binding cassette subfamily C member 3 [Source:... [more]
abcc30.000e+031.63ATP binding cassette subfamily C member 3 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc38.511e-9330.57ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
ENSPMAT00000007076.11.351e-8332.01pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 g... [more]
ENSPMAT00000006454.14.905e-7635.39pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:... [more]
ENSPMAT00000001536.11.058e-7531.13pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 ge... [more]
ABCC84.802e-6831.34ATP binding cassette subfamily C member 8 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BPT18.842e-15129.15ABC type transmembrane transporter of MRP/CFTR fam... [more]
YBT12.675e-14527.75Transporter of the ATP-binding cassette (ABC) fami... [more]
VMR18.466e-13927.93Vacuolar membrane protein; involved in multiple dr... [more]
YOR11.086e-8728.32Plasma membrane ATP-binding cassette (ABC) transpo... [more]
YCF12.664e-8636.00Vacuolar glutathione S-conjugate transporter; ABC-... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412574.546e-14728.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383557.337e-13627.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374451.065e-13226.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378186.487e-13226.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374611.645e-13126.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc18.402e-1233.14multidrug resistance-associated protein 1 [Source:... [more]
abcc6a1.241e-931.01multidrug resistance-associated protein 1 [Source:... [more]
abcc16.985e-1233.28multidrug resistance-associated protein 1 [Source:... [more]
abcc17.795e-1233.28multidrug resistance-associated protein 1 [Source:... [more]
abcc18.319e-1233.28multidrug resistance-associated protein 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018910.10.000e+099.85SMESG000018910.1[more]
SMESG000018912.12.941e-1199.85SMESG000018912.1[more]
SMESG000018910.10.000e+099.83SMESG000018910.1[more]
SMESG000018910.10.000e+099.83SMESG000018910.1[more]
SMESG000018910.13.444e-3282.76SMESG000018910.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029981 ID=SMED30029981|Name=Multidrug resistance-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4628bp
TTTTTTTTAACGTATTTTAAAAGTGATTTTTATTTAACATAAAATTTTAG
GTTTTTAGGAATTTAGAAAAGTTTTAATGACAATAAACGTTCTTCATGTG
CTACAATTAACGTCTTGTTCTTATTTTCTCATTCAATTTTTATTATATTT
ACATAAACGCCATTATGAGACCTCTCGACCTATTGTTCGAATTAATTTTA
ACAAAGGATACATTTTGTGTTATAGTTTAAATTTCCTAATGGTGATACTG
TTGAGTTTCGAAACAATCAAAAATTATTCAAGAAATGAATTGTTTAGTTC
GTTTATTTATTATATGTGGTCTGTAACAACTATTCTTGTTGTTGTTCTAT
TTGAAATTCGTAGACGAACTATGCATCCAATGTGCTATATATTGTTTTCT
TACTTAACATTCACGACTTCGTTATGCATAATTAGATATTGCCAAGAATT
TTATGAATTAAGTGATGAAATACATTCAGAAAGTAGCAGTATCGGAATTT
TGTTGATATTGAATTTGATGTCATTAATATTTTCTTCAATCAGCTCATAT
TCTCCGGAAAATTCTGTTATCGAAAATAATAATCCTTGTCCAGAAGAATA
TTCCTCGATTCCCTCTAGAATTTTGTTCATGTGGCTAGACAGATATATCT
ATTCTTGGTTTCAAAACGGTATAAAAAGTGAATCGACATTCGATGTCCAT
TATCAATGTGTTGCCGATGTCAATACAATGAATTTTAAACGAAAACTAAC
TAGCACTTTAAAATCTAAAAATAACTATCATACAAAATCAAGGCGTCCTA
TCAATGAACACAGCAGTGTTTGGTGGTTGACCAAGGCATTATTTCATGTG
TTTGGTTCGAAGCTCATTATCAGTTGGTGTGCAATAGTATTTCATATCAT
TTTTTCATTTTCCCGACCTTTTATTTTAAAGTACTTATTAAAATTCATAA
GTGCTCCAGAAACTCCATTGTTTTTCGGGTTTACTCTAGCAATTTCATTT
TTAATCACCGGTATACTATCCAGTATCACTCAAAACTGTTGTTTTCACCT
GACTTCAACTACGAGTCTGCAAGTTCGCTCAGCTATTGCTAGTGCCGTAT
ATTCAAAGTCAATAAATATAAATAACGAAGCTAAAAGCACTTTCACGAAT
GCTGAAATAATCAATTTGATGAGTACTGATACTGATAAAATTGTTACAGC
TATAGCTTATTCATGGATTGTTATATCAAGCCCATTTGAAATCATTTTAA
TATTTGCCTTTCTTTTCAATGAAATTGGATCGTTAGCTTCAATCGGCGTC
CTTGTATTAATGGGGACTTTTCCCTTGAACAGTATTGCAATGAGTTGGCT
TCAGCACTATCAAACCGAAGAAATGGAATGGAAAGATAAACGAATCAAGG
CTATGACTGAAGTTTTGAATAATATGAAAGTTATTAAATTATATAGCTGG
GAATCATTGTTTTTCAAAATAATATCGAGAAATAGGGAGAAAGAAGTCAA
TTTAATAAGACTAATTTCATTGTGTTCAGGAGTAGTCAATATAATTTGGG
ATACACTTCCAATGAGCGTGCTTTTGACAATGTTGTGGACATATGTCAAT
ATATTCCCAAATTATGTGATAACTGCAGAAGCGACGTTTGTATCTGTTGT
TTTGTTGAACATGTTAAGGTCACCTATGGCAGTTTTGCCTTACGGAATAA
CTATCGCAATGAATGGTTATGTTTCCTTGAAGCGAGTCAGTCTTTTTTTA
ATAGAAAACAAAACGAAAAATTATTTTTCAAGTTGTCAAGACATCAGATC
AGTCATTGAAATAAAAAATGGCTCATTCTCATGGCGTTCTGATTCAGAAC
CTATTTTGAAACGTATAAATATTAGTATAAATAAAGGTGAGTTAGTTGGA
ATTGTTGGCAAAATTGCGTCTGGTAAAACGTCTTTGTTGAATGCAATAAT
TGGAGAAATGTGTATTTTAGACGGAGCAGTTTCTATTAAGGGAAGTATGT
CGTATGTTCCACAAAATCCTTGGATCAGAAAGATTTCCACAAAAGATAAC
ATAATTTTATCAAAAAAATACATTGAAAATGATTACAAAAATGTTATAAG
GATTTGTGATTTAGATTTTGATTTACGAACTAATCAAGCAGATGAATTAA
ATGGCGTTGATAGAATGCTGTGCAGTGGAGGACAGAGGCAACGGATAAAT
TTAGCTAGAGCTGTGTATCAAAAAAGTGAAATTTACTTACTTGATGATCC
TTTGTCTGCTCTTGATGCAGTTGTTGCACAAAAGGTATTTGAAAAAGTTA
TTTCAAATAATGGAATATTGGCTAATACGACACGTTTGTTTGTCACACAA
AATATTAATTTTCTAAATTATTTGGATAAAATAATTTTTCTTGATGAAAA
TGGTTCAATAAAGTATTATGGCGATGTTTCAAATATTTCCAACGATGCCA
TAGATTTTATGAAAATCAAGTCTGAAAAATCTTTTTCCGATCCATTTGCT
GAGCACACTGAAAGCATTTTCACGTCAAACAATAACTGTGTAATGAATCG
TAATTCCTGTCGAATTCACAAGATTTTACATGCCTCAATTAAATCAAAAT
ATCACCAAATAAACATTAGAAAACAATTTTTAATGGTAAATAACTCGGAG
ATTAATAAGAACTCCTCCAATAGTAGAAGCTTGAGTCAAAGTAAAAGTGA
AGATTTTGATACAGAAATCAAATCTGTGTCTTATAAAGCTTATTTCAAAT
ATTTTCTTGCTCGAGGCTCTCTGCAATTATTTTGTTCAATATTTGCATTT
GGTATATTGACTATTTTGCAGGTTTTGAGCAGCTATTGGCTGGAAAAGCT
CACTTCAGATCCCAATATTTTAAACAATACTATTATAGGAAATTTCGATA
ATAAAAATAATAATAATCAAAATCATAACCACATGACTTATTCATATGAT
TACCACGCTACCGCTAATTATTACATGCTTATTTACGGATTAATAGGATT
TGGGCAGATAATTTTTGCCTGTTTTTTCTATTTGACCTTTTCATTGGGAA
ATGCAAATGCATCAAAGGCTATCCATGATTGCATGCTGAATAAAGTTTTG
AAATCAAAATTACAATATTTTCATCAATCTAGCAGTCAAATACTAAACTT
TTTCAGTAAGGATATAGATAACATTGATAGTTTGATACCAAACAATTTAT
CTGAAGTGATAAATTGCATTTTTCAAGTAATGGCTTCGTTTTTCGTTATA
CTTCATACATTTCCATTATTCCTGCTATTAATTGTACCAATTGGATTGCT
ATATTTTATAATTTTGAAATTTTATTTGCCATCAGCTTGTCAAACACAAA
TGCTTTGCGTCAAATCCAGTTCCCCGATCTTTCGATTTTTTAATGAAACT
CTTCAAGGCCGGCCTGTTATTCGTGCGTCTAAACAAAAAAAGCATTTTCA
ATTTGAACTATTCAAGTTACTAAATGACAATACTAAATTTCTTTATATCC
AGAACGTCCTTAACCTTTGGTTATCACTGAGACTAGATTTTCTTGGTAAT
ATTTTAGTATTTGGATCGGTAATCATGGCAATTTGCTACCGGAATAAATT
GACCCCCAGCCTGGTGGGTCTCACAATTAGCTATTCCATAGATATAATAG
ACTTATTAAATTGGATGATTATCCAATATGTAGATTTAGAAACGAATTCA
ATGGCACTGGAACGATTGAGTAATTTTAATGCAATGGAATCAGAGTTTAA
TGATAAGGAATATCTCTACCATCCTGATTCCGAGTGGCCCCGGTTCGGGA
AAATAGAATTTAAAAAATTTAATTTAAAATATGTAGAAGATTGTAAATTT
TGCCTTAATAATATTAATTTGGTTATTGAACACGGTGAAAAAATTGGAAT
TGTTGGTCGAACAGGTTCTGGAAAAACAAGTCTTGTACAGTCGCTTTTTA
AATTAGTAGAGCCGATTGGAGGATCTCTTTTGATTGATGACATTGACATA
AGGGACATTGATATTACCGATGTCAGAAGGGCGATTACCATGTTTCCACA
AGAATCAACTATATTTTCTGGAACTATTCGACAAAATATTGATCCATTTA
ATTTTCTTGAAGATCATGTACTCAAACAAGCTCTTAATTTGTCGCATTTG
GGACCATGGTTGGAAAGCATTAATGGCAATCTTCATTTTGATTGTGGTGA
TAATGGCTCCAGTTTATCAGTTGGACAGAGACAACTGTTATGTTTGGCCA
GAGTTATTTTACGAAATTCTAAAATTATCGTTCTTGATGAAGCGACTGCA
TCAGTAGATCAAGAAACGGATAGACTAATTATGGAGACAATAAAACATAG
ATTTATTAATAGTACAATTTTGATAATAGCACACAGGACGAGTGGCTTAG
AAGATCTTGACAAAATTATAGTTATGGACAGAGGTGAAATTATTGAATTT
GGAAAGACGAGTGAGATTATTAACAACCCAAACGGATATTTTTCAAAGTG
TAAACTTTATGAGTGTTGATGGCGTATTATTATTTTTTTAAGAAATGTTT
TGAAAAGAGATTTTTCATGATTCTGATTTTAAAATTCTAAGCATTTAAAT
TCGGTTAAGATATTTTTTTCCATGTAAT
back to top

protein sequence of SMED30029981-orf-1

>SMED30029981-orf-1 ID=SMED30029981-orf-1|Name=SMED30029981-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1481bp
MTINVLHVLQLTSCSYFLIQFLLYLHKRHYETSRPIVRINFNKGYILCYS
LNFLMVILLSFETIKNYSRNELFSSFIYYMWSVTTILVVVLFEIRRRTMH
PMCYILFSYLTFTTSLCIIRYCQEFYELSDEIHSESSSIGILLILNLMSL
IFSSISSYSPENSVIENNNPCPEEYSSIPSRILFMWLDRYIYSWFQNGIK
SESTFDVHYQCVADVNTMNFKRKLTSTLKSKNNYHTKSRRPINEHSSVWW
LTKALFHVFGSKLIISWCAIVFHIIFSFSRPFILKYLLKFISAPETPLFF
GFTLAISFLITGILSSITQNCCFHLTSTTSLQVRSAIASAVYSKSININN
EAKSTFTNAEIINLMSTDTDKIVTAIAYSWIVISSPFEIILIFAFLFNEI
GSLASIGVLVLMGTFPLNSIAMSWLQHYQTEEMEWKDKRIKAMTEVLNNM
KVIKLYSWESLFFKIISRNREKEVNLIRLISLCSGVVNIIWDTLPMSVLL
TMLWTYVNIFPNYVITAEATFVSVVLLNMLRSPMAVLPYGITIAMNGYVS
LKRVSLFLIENKTKNYFSSCQDIRSVIEIKNGSFSWRSDSEPILKRINIS
INKGELVGIVGKIASGKTSLLNAIIGEMCILDGAVSIKGSMSYVPQNPWI
RKISTKDNIILSKKYIENDYKNVIRICDLDFDLRTNQADELNGVDRMLCS
GGQRQRINLARAVYQKSEIYLLDDPLSALDAVVAQKVFEKVISNNGILAN
TTRLFVTQNINFLNYLDKIIFLDENGSIKYYGDVSNISNDAIDFMKIKSE
KSFSDPFAEHTESIFTSNNNCVMNRNSCRIHKILHASIKSKYHQINIRKQ
FLMVNNSEINKNSSNSRSLSQSKSEDFDTEIKSVSYKAYFKYFLARGSLQ
LFCSIFAFGILTILQVLSSYWLEKLTSDPNILNNTIIGNFDNKNNNNQNH
NHMTYSYDYHATANYYMLIYGLIGFGQIIFACFFYLTFSLGNANASKAIH
DCMLNKVLKSKLQYFHQSSSQILNFFSKDIDNIDSLIPNNLSEVINCIFQ
VMASFFVILHTFPLFLLLIVPIGLLYFIILKFYLPSACQTQMLCVKSSSP
IFRFFNETLQGRPVIRASKQKKHFQFELFKLLNDNTKFLYIQNVLNLWLS
LRLDFLGNILVFGSVIMAICYRNKLTPSLVGLTISYSIDIIDLLNWMIIQ
YVDLETNSMALERLSNFNAMESEFNDKEYLYHPDSEWPRFGKIEFKKFNL
KYVEDCKFCLNNINLVIEHGEKIGIVGRTGSGKTSLVQSLFKLVEPIGGS
LLIDDIDIRDIDITDVRRAITMFPQESTIFSGTIRQNIDPFNFLEDHVLK
QALNLSHLGPWLESINGNLHFDCGDNGSSLSVGQRQLLCLARVILRNSKI
IVLDEATASVDQETDRLIMETIKHRFINSTILIIAHRTSGLEDLDKIIVM
DRGEIIEFGKTSEIINNPNGYFSKCKLYEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008559xenobiotic-transporting ATPase activity
GO:0015431glutathione S-conjugate-exporting ATPase activity
GO:0022857transmembrane transporter activity
GO:0042910xenobiotic transporter activity
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0000166nucleotide binding
GO:0005215transporter activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0042493response to drug
GO:0042908xenobiotic transport
GO:0050729positive regulation of inflammatory response
GO:0071716leukotriene transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR036640ABC1_TM_sf
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR011527ABC1_TM_dom
IPR017871ABC_transporter_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016323basolateral plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 1269..1454
e-value: 8.3E-12
score: 55.2
coord: 603..777
e-value: 2.1E-7
score: 40.6
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 594..726
e-value: 2.9E-16
score: 60.2
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 1260..1408
e-value: 1.9E-28
score: 99.7
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 577..800
score: 18.207
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 1245..1477
score: 18.901
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 865..1226
e-value: 5.3E-29
score: 103.3
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 255..556
e-value: 1.8E-15
score: 58.9
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 253..554
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 888..1223
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 557..814
e-value: 3.4E-54
score: 185.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1227..1477
e-value: 1.3E-73
score: 249.5
NoneNo IPR availablePANTHERPTHR24223:SF350CANALICULAR MULTISPECIFIC ORGANIC ANION TRANSPORTER 2coord: 37..1473
NoneNo IPR availablePANTHERPTHR24223FAMILY NOT NAMEDcoord: 37..1473
NoneNo IPR availableCDDcd18595ABC_6TM_MRP1_2_3_6_D1_likecoord: 265..553
e-value: 5.57778E-86
score: 280.51
NoneNo IPR availableCDDcd03244ABCC_MRP_domain2coord: 1241..1459
e-value: 1.4498E-88
score: 285.156
NoneNo IPR availableCDDcd18603ABC_6TM_MRP1_2_3_6_D2_likecoord: 901..1214
e-value: 2.93046E-81
score: 267.422
NoneNo IPR availableTMHMMTMhelixcoord: 966..988
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 1177..1199
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 892..914
NoneNo IPR availableTMHMMTMhelixcoord: 1148..1170
NoneNo IPR availableTMHMMTMhelixcoord: 296..318
NoneNo IPR availableTMHMMTMhelixcoord: 254..276
NoneNo IPR availableTMHMMTMhelixcoord: 403..425
NoneNo IPR availableTMHMMTMhelixcoord: 76..93
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 506..528
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 474..491
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
NoneNo IPR availableTMHMMTMhelixcoord: 1056..1078
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 263..534
e-value: 4.3E-20
score: 72.5
coord: 902..1186
e-value: 9.0E-20
score: 71.5
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 904..1206
score: 28.181
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 268..546
score: 30.751
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 1380..1394
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 699..713
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 572..789
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1237..1475