SMED30029980

Overview
NameSMED30029980
Smed IDSMED30029980
Length (bp)600
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30029980 (SMED30029980) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029980 (SMED30029980) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30029980 (SMED30029980) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30029980 (SMED30029980) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029980

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029980SMESG000005589.1 SmedASXL_019356SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029980SMESG000005589.1 SmedASXL_019356SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30029980SMESG000005589.1 dd_Smed_v4_2921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029980SMESG000005589.1 dd_Smed_v4_2921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029980SMESG000005589.1 Contig46602newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30029980SMESG000005589.1 Contig46602uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30029980SMESG000005589.1 dd_Smed_v4_2921_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029980SMESG000005589.1 SMED_04546_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029980SMESG000005589.1 SMED_04546_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029980SMESG000005589.1 SMED_24356_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029980SMESG000005589.1 SMED_24356_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30029980 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.014900:11010..11677 +2115
Homology
BLAST of SMED30029980 vs. Ensembl Human
Match: DUT (deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:HGNC:3078])

HSP 1 Score: 211.46 bits (537), Expect = 8.887e-70
Identity = 102/144 (70.83%), Postives = 115/144 (79.86%), Query Frame = -1
Query:   58 VGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 489
            VG   LRF +LSE+A  P RGSA AAGYDL SA D  IP   K +VKTDIQIALP GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  PE+ E ++LDDTERG GG+GSTG N
Sbjct:   24 VGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 167          
BLAST of SMED30029980 vs. Ensembl Human
Match: DUT (deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:HGNC:3078])

HSP 1 Score: 210.305 bits (534), Expect = 1.789e-69
Identity = 102/144 (70.83%), Postives = 115/144 (79.86%), Query Frame = -1
Query:   58 VGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 489
            VG   LRF +LSE+A  P RGSA AAGYDL SA D  IP   K +VKTDIQIALP GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  PE+ E ++LDDTERG GG+GSTG N
Sbjct:   21 VGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 164          
BLAST of SMED30029980 vs. Ensembl Human
Match: DUT (deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:HGNC:3078])

HSP 1 Score: 208.379 bits (529), Expect = 4.634e-69
Identity = 100/140 (71.43%), Postives = 113/140 (80.71%), Query Frame = -1
Query:   58 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 477
             LRF +LSE+A  P RGSA AAGYDL SA D  IP   K +VKTDIQIALP GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  PE+ E ++LDDTERG GG+GSTG N
Sbjct:    2 QLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 141          
BLAST of SMED30029980 vs. Ensembl Human
Match: DUT (deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:HGNC:3078])

HSP 1 Score: 210.69 bits (535), Expect = 2.366e-68
Identity = 102/144 (70.83%), Postives = 115/144 (79.86%), Query Frame = -1
Query:   58 VGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 489
            VG   LRF +LSE+A  P RGSA AAGYDL SA D  IP   K +VKTDIQIALP GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  PE+ E ++LDDTERG GG+GSTG N
Sbjct:  109 VGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 252          
BLAST of SMED30029980 vs. Ensembl Human
Match: DUT (deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:HGNC:3078])

HSP 1 Score: 198.749 bits (504), Expect = 4.085e-64
Identity = 96/136 (70.59%), Postives = 108/136 (79.41%), Query Frame = -1
Query:   82 VGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDG 489
            VG   LRF +LSE+A  P RGSA AAGYDL SA D  IP   K +VKTDIQIALP GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  PE+ E ++LDDTERG G
Sbjct:   86 VGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG 221          
BLAST of SMED30029980 vs. Ensembl Celegans
Match: dut-1 (DeoxyUTPase; Deoxyuridinetriphosphatase [Source:UniProtKB/TrEMBL;Acc:G5EET2])

HSP 1 Score: 171.014 bits (432), Expect = 8.465e-51
Identity = 87/145 (60.00%), Postives = 104/145 (71.72%), Query Frame = -1
Query:   64 KSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 498
            K+      ++  K ++NA  P  GSA AAG DL SA D  +PA+GK  V T IQ+ALP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF + DF V KGDRIAQL+CE+I +    + ESL+ TERG GG+GSTG
Sbjct:  342 KTSATSVTIQITKSNDNAQMPTYGSAEAAGADLYSAEDVTVPARGKLCVSTGIQMALPIGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFGENDFEVKKGDRIAQLVCEQIALCTYSKVESLEVTERGAGGFGSTG 486          

HSP 2 Score: 170.629 bits (431), Expect = 1.125e-50
Identity = 88/139 (63.31%), Postives = 100/139 (71.94%), Query Frame = -1
Query:   58 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 474
            +RF +L+ENA TP  GS  AAG DL SA D  +PA GK  V T IQ+ LP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF+D  F V KGDRIAQLICEKI          L++T+RG GG+GSTG N
Sbjct:  187 VRFTQLNENAQTPTYGSEEAAGADLYSAEDITVPAHGKCCVSTGIQMELPFGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFTDNAFEVKKGDRIAQLICEKIGHCVYEAASELENTDRGAGGFGSTGQN 325          

HSP 3 Score: 154.836 bits (390), Expect = 1.171e-44
Identity = 80/137 (58.39%), Postives = 95/137 (69.34%), Query Frame = -1
Query:   64 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 474
            +RF ++  +A  P  GS  +AG DL SA D ++PA GK  V T +QI LP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF+   F V  GDRIA+LICE+I      E +SL  T RG GG+GSTG
Sbjct:   31 IRFTEMVGDAQKPTYGSISSAGADLYSAEDVVVPANGKLCVSTGLQIELPIGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFNTTAFEVKTGDRIAKLICEQIGNGTYEEVKSLPSTNRGAGGFGSTG 167          
BLAST of SMED30029980 vs. Ensembl Celegans
Match: dut-1 (DeoxyUTPase; Deoxyuridinetriphosphatase [Source:UniProtKB/TrEMBL;Acc:G5EET2])

HSP 1 Score: 171.014 bits (432), Expect = 8.465e-51
Identity = 87/145 (60.00%), Postives = 104/145 (71.72%), Query Frame = -1
Query:   64 KSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 498
            K+      ++  K ++NA  P  GSA AAG DL SA D  +PA+GK  V T IQ+ALP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF + DF V KGDRIAQL+CE+I +    + ESL+ TERG GG+GSTG
Sbjct:  342 KTSATSVTIQITKSNDNAQMPTYGSAEAAGADLYSAEDVTVPARGKLCVSTGIQMALPIGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFGENDFEVKKGDRIAQLVCEQIALCTYSKVESLEVTERGAGGFGSTG 486          

HSP 2 Score: 170.629 bits (431), Expect = 1.125e-50
Identity = 88/139 (63.31%), Postives = 100/139 (71.94%), Query Frame = -1
Query:   58 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 474
            +RF +L+ENA TP  GS  AAG DL SA D  +PA GK  V T IQ+ LP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF+D  F V KGDRIAQLICEKI          L++T+RG GG+GSTG N
Sbjct:  187 VRFTQLNENAQTPTYGSEEAAGADLYSAEDITVPAHGKCCVSTGIQMELPFGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFTDNAFEVKKGDRIAQLICEKIGHCVYEAASELENTDRGAGGFGSTGQN 325          

HSP 3 Score: 154.836 bits (390), Expect = 1.171e-44
Identity = 80/137 (58.39%), Postives = 95/137 (69.34%), Query Frame = -1
Query:   64 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 474
            +RF ++  +A  P  GS  +AG DL SA D ++PA GK  V T +QI LP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF+   F V  GDRIA+LICE+I      E +SL  T RG GG+GSTG
Sbjct:   31 IRFTEMVGDAQKPTYGSISSAGADLYSAEDVVVPANGKLCVSTGLQIELPIGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFNTTAFEVKTGDRIAKLICEQIGNGTYEEVKSLPSTNRGAGGFGSTG 167          
BLAST of SMED30029980 vs. Ensembl Celegans
Match: dut-1 (DeoxyUTPase; Deoxyuridinetriphosphatase [Source:UniProtKB/TrEMBL;Acc:G5EET2])

HSP 1 Score: 171.014 bits (432), Expect = 8.465e-51
Identity = 87/145 (60.00%), Postives = 104/145 (71.72%), Query Frame = -1
Query:   64 KSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 498
            K+      ++  K ++NA  P  GSA AAG DL SA D  +PA+GK  V T IQ+ALP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF + DF V KGDRIAQL+CE+I +    + ESL+ TERG GG+GSTG
Sbjct:  342 KTSATSVTIQITKSNDNAQMPTYGSAEAAGADLYSAEDVTVPARGKLCVSTGIQMALPIGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFGENDFEVKKGDRIAQLVCEQIALCTYSKVESLEVTERGAGGFGSTG 486          

HSP 2 Score: 170.629 bits (431), Expect = 1.125e-50
Identity = 88/139 (63.31%), Postives = 100/139 (71.94%), Query Frame = -1
Query:   58 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 474
            +RF +L+ENA TP  GS  AAG DL SA D  +PA GK  V T IQ+ LP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF+D  F V KGDRIAQLICEKI          L++T+RG GG+GSTG N
Sbjct:  187 VRFTQLNENAQTPTYGSEEAAGADLYSAEDITVPAHGKCCVSTGIQMELPFGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFTDNAFEVKKGDRIAQLICEKIGHCVYEAASELENTDRGAGGFGSTGQN 325          

HSP 3 Score: 154.836 bits (390), Expect = 1.171e-44
Identity = 80/137 (58.39%), Postives = 95/137 (69.34%), Query Frame = -1
Query:   64 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 474
            +RF ++  +A  P  GS  +AG DL SA D ++PA GK  V T +QI LP G YGR+APRSGLA K+FIDVGAGVID DYRG V VLLFNF+   F V  GDRIA+LICE+I      E +SL  T RG GG+GSTG
Sbjct:   31 IRFTEMVGDAQKPTYGSISSAGADLYSAEDVVVPANGKLCVSTGLQIELPIGYYGRVAPRSGLAAKHFIDVGAGVIDSDYRGEVKVLLFNFNTTAFEVKTGDRIAKLICEQIGNGTYEEVKSLPSTNRGAGGFGSTG 167          
BLAST of SMED30029980 vs. Ensembl Fly
Match: dUTPase (gene:FBgn0250837 transcript:FBtr0331196)

HSP 1 Score: 205.682 bits (522), Expect = 9.948e-68
Identity = 94/139 (67.63%), Postives = 116/139 (83.45%), Query Frame = -1
Query:   61 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGL 477
            +LRF KL+ENA+ P+RGSA AAG DL SA D ++PA+GK IVKTD+Q+ +PEG YGR+APRSGLA KNFIDVGAGV+D+DYRGN+GV+LFN SD DF V  GDRIAQ ICE+I  P+LV  + L+DTERG+ G+GSTG+
Sbjct:    7 VLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGV 145          
BLAST of SMED30029980 vs. Ensembl Fly
Match: dUTPase (gene:FBgn0250837 transcript:FBtr0080156)

HSP 1 Score: 205.682 bits (522), Expect = 9.948e-68
Identity = 94/139 (67.63%), Postives = 116/139 (83.45%), Query Frame = -1
Query:   61 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGL 477
            +LRF KL+ENA+ P+RGSA AAG DL SA D ++PA+GK IVKTD+Q+ +PEG YGR+APRSGLA KNFIDVGAGV+D+DYRGN+GV+LFN SD DF V  GDRIAQ ICE+I  P+LV  + L+DTERG+ G+GSTG+
Sbjct:    7 VLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGV 145          
BLAST of SMED30029980 vs. Ensembl Fly
Match: dUTPase (gene:FBgn0250837 transcript:FBtr0331195)

HSP 1 Score: 205.682 bits (522), Expect = 9.948e-68
Identity = 94/139 (67.63%), Postives = 116/139 (83.45%), Query Frame = -1
Query:   61 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGL 477
            +LRF KL+ENA+ P+RGSA AAG DL SA D ++PA+GK IVKTD+Q+ +PEG YGR+APRSGLA KNFIDVGAGV+D+DYRGN+GV+LFN SD DF V  GDRIAQ ICE+I  P+LV  + L+DTERG+ G+GSTG+
Sbjct:    7 VLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGV 145          
BLAST of SMED30029980 vs. Ensembl Fly
Match: dUTPase (gene:FBgn0250837 transcript:FBtr0080157)

HSP 1 Score: 205.297 bits (521), Expect = 1.887e-67
Identity = 94/139 (67.63%), Postives = 116/139 (83.45%), Query Frame = -1
Query:   61 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGL 477
            +LRF KL+ENA+ P+RGSA AAG DL SA D ++PA+GK IVKTD+Q+ +PEG YGR+APRSGLA KNFIDVGAGV+D+DYRGN+GV+LFN SD DF V  GDRIAQ ICE+I  P+LV  + L+DTERG+ G+GSTG+
Sbjct:   21 VLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGV 159          
BLAST of SMED30029980 vs. Ensembl Zebrafish
Match: dut (deoxyuridine triphosphatase [Source:ZFIN;Acc:ZDB-GENE-041010-93])

HSP 1 Score: 192.586 bits (488), Expect = 2.284e-62
Identity = 93/140 (66.43%), Postives = 113/140 (80.71%), Query Frame = -1
Query:   58 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 477
            +L+F KL+E+A TP RGS  AAGYDL SA D  I    K +VKTDIQIA+P G YGR+APRSGLA K+FIDVGAGV+D+DYRGN+GV++FNF+ + F V KGDRIAQLICEKI  P+L E ++LD+TERG GG+GSTG N
Sbjct:   48 VLKFAKLTEHATTPSRGSNRAAGYDLYSAYDYSIGPMDKTLVKTDIQIAVPHGYYGRVAPRSGLAVKHFIDVGAGVVDEDYRGNLGVVIFNFNKEPFEVKKGDRIAQLICEKICYPDLQELQTLDETERGAGGFGSTGTN 187          
BLAST of SMED30029980 vs. Ensembl Zebrafish
Match: CABZ01074745.1 (deoxyuridine 5'-triphosphate nucleotidohydrolase-like [Source:NCBI gene;Acc:110438480])

HSP 1 Score: 156.762 bits (395), Expect = 2.728e-49
Identity = 76/113 (67.26%), Postives = 92/113 (81.42%), Query Frame = -1
Query:   58 SAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 396
            SA D  I    K +VKTDIQIA+P G YGR+APRSGLA K+FIDVGAGV+D+DYRGN+GV++FNF+ + F V KGDRIAQLICEKI  P+L E ++LD+TERG GG+GSTG N
Sbjct:    2 SAYDYSIGPMDKTLVKTDIQIAVPHGYYGRVAPRSGLAVKHFIDVGAGVVDEDYRGNLGVVIFNFNKEPFEVKKGDRIAQLICEKICYPDLQELQTLDETERGAGGFGSTGTN 114          
BLAST of SMED30029980 vs. Ensembl Xenopus
Match: ENSXETT00000055355.1 (deoxyuridine triphosphatase [Source:NCBI gene;Acc:101733437])

HSP 1 Score: 204.142 bits (518), Expect = 2.562e-66
Identity = 100/144 (69.44%), Postives = 117/144 (81.25%), Query Frame = -1
Query:   49 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG-LNLKS 477
            +L+F KLS+ A TP RGS  AAGYDL SA D +IPA  K +VKTDIQI++P GCYGR+APRSGLA K FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDR+AQLICE+IL PEL E ++LDDTERG GG+GST  L+L S
Sbjct:   58 VLKFAKLSDQAYTPTRGSTRAAGYDLYSAYDYVIPALDKMVVKTDIQISVPTGCYGRVAPRSGLAAKYFIDVGAGVIDEDYRGNVGVVLFNFGKEAFEVKKGDRVAQLICERILYPELEEVQALDDTERGAGGFGSTAILHLTS 201          
BLAST of SMED30029980 vs. Ensembl Xenopus
Match: ENSXETT00000055356.1 (deoxyuridine triphosphatase [Source:NCBI gene;Acc:101733437])

HSP 1 Score: 179.104 bits (453), Expect = 9.050e-57
Identity = 85/122 (69.67%), Postives = 99/122 (81.15%), Query Frame = -1
Query:  112 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECE 477
            +L+F KLS+ A TP RGS  AAGYDL SA D +IPA  K +VKTDIQI++P GCYGR+APRSGLA K FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDR+AQLICE+IL PEL E +
Sbjct:   58 VLKFAKLSDQAYTPTRGSTRAAGYDLYSAYDYVIPALDKMVVKTDIQISVPTGCYGRVAPRSGLAAKYFIDVGAGVIDEDYRGNVGVVLFNFGKEAFEVKKGDRVAQLICERILYPELEEVQ 179          
BLAST of SMED30029980 vs. Ensembl Xenopus
Match: wdr13 (WD repeat domain 13 [Source:Xenbase;Acc:XB-GENE-5810758])

HSP 1 Score: 137.117 bits (344), Expect = 6.404e-41
Identity = 68/115 (59.13%), Postives = 81/115 (70.43%), Query Frame = -1
Query:   58 LCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 402
               A D +IPA  K +VKTDIQI++P GCYGR+A               GVID+DYRGNVGV+LFNF  + F V KGDR+AQLICE+IL PEL E ++LDDTERG GG+GSTG N
Sbjct:   52 FAHAYDYVIPALDKMVVKTDIQISVPTGCYGRVA---------------GVIDEDYRGNVGVVLFNFGKEAFEVKKGDRVAQLICERILYPELEEVQALDDTERGAGGFGSTGQN 151          
BLAST of SMED30029980 vs. Ensembl Mouse
Match: Dut (deoxyuridine triphosphatase [Source:MGI Symbol;Acc:MGI:1346051])

HSP 1 Score: 202.601 bits (514), Expect = 1.178e-66
Identity = 99/139 (71.22%), Postives = 112/139 (80.58%), Query Frame = -1
Query:   58 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 474
            LRF +LSE+A  P RGSA AAGYDL SA D  I    K IVKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  P+L E ++LDDTERG GG+GSTG N
Sbjct:   24 LRFVRLSEHATAPTRGSARAAGYDLFSAYDYTISPMEKAIVKTDIQIAVPSGCYGRVAPRSGLAVKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERISYPDLEEVQTLDDTERGSGGFGSTGKN 162          
BLAST of SMED30029980 vs. Ensembl Mouse
Match: Dut (deoxyuridine triphosphatase [Source:MGI Symbol;Acc:MGI:1346051])

HSP 1 Score: 202.601 bits (514), Expect = 4.207e-66
Identity = 99/139 (71.22%), Postives = 112/139 (80.58%), Query Frame = -1
Query:   58 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 474
            LRF +LSE+A  P RGSA AAGYDL SA D  I    K IVKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  P+L E ++LDDTERG GG+GSTG N
Sbjct:   62 LRFVRLSEHATAPTRGSARAAGYDLFSAYDYTISPMEKAIVKTDIQIAVPSGCYGRVAPRSGLAVKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERISYPDLEEVQTLDDTERGSGGFGSTGKN 200          
BLAST of SMED30029980 vs. UniProt/SwissProt
Match: sp|P33316|DUT_HUMAN (Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4)

HSP 1 Score: 210.69 bits (535), Expect = 1.136e-67
Identity = 102/144 (70.83%), Postives = 115/144 (79.86%), Query Frame = -1
Query:   58 VGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 489
            VG   LRF +LSE+A  P RGSA AAGYDL SA D  IP   K +VKTDIQIALP GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+I  PE+ E ++LDDTERG GG+GSTG N
Sbjct:  109 VGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 252          
BLAST of SMED30029980 vs. UniProt/SwissProt
Match: sp|P70583|DUT_RAT (Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Rattus norvegicus OX=10116 GN=Dut PE=2 SV=3)

HSP 1 Score: 205.297 bits (521), Expect = 3.163e-66
Identity = 99/139 (71.22%), Postives = 115/139 (82.73%), Query Frame = -1
Query:   58 LRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 474
            LRF +LSE+A  P RGSA AAGYDL SA D  IP+  K +VKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGVID+DYRGNVGV+LFNF  + F V KGDRIAQLICE+IL P+L E ++LD+TERG GG+GSTG N
Sbjct:   67 LRFVRLSEHATAPTRGSARAAGYDLYSAYDYTIPSMEKALVKTDIQIAVPSGCYGRVAPRSGLAVKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERILYPDLEEVQTLDNTERGSGGFGSTGKN 205          
BLAST of SMED30029980 vs. UniProt/SwissProt
Match: sp|Q10FF9|DUT_ORYSJ (Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Oryza sativa subsp. japonica OX=39947 GN=DUT PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 3.653e-63
Identity = 92/139 (66.19%), Postives = 111/139 (79.86%), Query Frame = -1
Query:   61 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGL 477
            +L+ KKLSENA+ P RGSALAAGYDL SA + ++PA+GK +V TD+ IA+PEG Y R+APRSGLA K+ IDVGAGVID DYRG VGV+LFN SD DF V  GDRIAQ+I E I+ PE+ E E LD T RG+GG+GSTG+
Sbjct:   33 LLKVKKLSENAVLPSRGSALAAGYDLSSAAEVVVPARGKAMVPTDLSIAIPEGTYARVAPRSGLALKHSIDVGAGVIDADYRGPVGVILFNHSDTDFAVKPGDRIAQMIIEVIVTPEVAEVEDLDATVRGEGGFGSTGV 171          
BLAST of SMED30029980 vs. UniProt/SwissProt
Match: sp|Q9STG6|DUT_ARATH (Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Arabidopsis thaliana OX=3702 GN=DUT PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.307e-63
Identity = 92/139 (66.19%), Postives = 111/139 (79.86%), Query Frame = -1
Query:   61 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGL 477
              + KKLSE A+ P RGS L+AGYDL SA+D  +PA+GK ++ TD+ IA+PEG Y RIAPRSGLAWK+ IDVGAGVID DYRG VGV+LFN SD DF V  GDRIAQLI EKI+ P++VE + LD+T RGDGG+GSTG+
Sbjct:   28 FFKVKKLSEKAVIPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLAWKHSIDVGAGVIDADYRGPVGVILFNHSDADFEVKFGDRIAQLIIEKIVTPDVVEVDDLDETVRGDGGFGSTGV 166          
BLAST of SMED30029980 vs. UniProt/SwissProt
Match: sp|Q54BW5|DUT_DICDI (Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Dictyostelium discoideum OX=44689 GN=dut PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.087e-62
Identity = 90/144 (62.50%), Postives = 115/144 (79.86%), Query Frame = -1
Query:   49 KMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKS 480
            +  + KKLS+ A+ P RGS  AAGYDL SA + ++PA GK +  TD+QIA+P+G YGRIAPRSGLAWKNFID GAGVID DYRGNVGV+LFN SD DF VA GDR+AQLI E+I+ PE +E + +D+T+RG GG+GSTG+ +++
Sbjct:   36 ETFKVKKLSDKAIIPQRGSKGAAGYDLSSAHELVVPAHGKALAMTDLQIAIPDGTYGRIAPRSGLAWKNFIDCGAGVIDSDYRGNVGVVLFNHSDVDFKVAVGDRVAQLIFERIVTPEPLEVDEIDETQRGAGGFGSTGVKVQN 179          
BLAST of SMED30029980 vs. TrEMBL
Match: A0A348HAP4 (Deoxyuridine triphosphatase OS=Dugesia ryukyuensis OX=79738 GN=Dr-dut PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.626e-80
Identity = 112/148 (75.68%), Postives = 134/148 (90.54%), Query Frame = -1
Query:   49 MVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKS 492
            M   K+LRFKKLSENA  P RGS LAAG+DLCSA +C+IPA+GK++VKTDIQI+LPEGCYGR+APRSGLA K+FIDVGAGVIDQDYRGNVG+++FNFS+ +FP++KGDRIAQLICE+I  PEL+ECESLD+TERG+GGYGSTG+N  S
Sbjct:    1 MSALKVLRFKKLSENATVPSRGSVLAAGFDLCSAENCVIPARGKQLVKTDIQISLPEGCYGRVAPRSGLALKHFIDVGAGVIDQDYRGNVGIVMFNFSENEFPISKGDRIAQLICERIYTPELLECESLDETERGEGGYGSTGINNSS 148          
BLAST of SMED30029980 vs. TrEMBL
Match: H2ZPZ1 (dUTPase domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 8.936e-73
Identity = 104/149 (69.80%), Postives = 125/149 (83.89%), Query Frame = -1
Query:   58 KAKSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 504
            K + +    +L+F KL+ NA +P RGSALAAGYDL SA D I+PA+GK+++KTDIQI LP+GCYGR+APRSGL  K+FIDVGAGVIDQDYRGNVGV+LFNF D DF V KGDRIAQLICE+I +PEL E E+L++TERGDGG+GSTG N
Sbjct:   24 KKQKVAHNPVLKFAKLTANARSPTRGSALAAGYDLYSAYDVIVPARGKQLIKTDIQINLPDGCYGRVAPRSGLTHKHFIDVGAGVIDQDYRGNVGVILFNFKDTDFEVKKGDRIAQLICERIFLPELQELETLENTERGDGGFGSTGHN 172          
BLAST of SMED30029980 vs. TrEMBL
Match: A0A210QMJ6 (Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00954 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 5.980e-72
Identity = 108/148 (72.97%), Postives = 129/148 (87.16%), Query Frame = -1
Query:   64 KAKSM-VGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 504
            K+K+M +   +L+F KL+ENA+TP RGS LAAGYDL SA + IIPA+GK++VKTDIQIALP+GCYGR+APRSGLA K+FIDVGAGVIDQDYRGNVGV+LFNF +K+F V KG+RIAQLICE+I +PEL ECE LDDT+RG  GYGSTG
Sbjct:   15 KSKTMPLDNVILKFAKLTENALTPTRGSKLAAGYDLYSAYNHIIPARGKQVVKTDIQIALPDGCYGRVAPRSGLAAKHFIDVGAGVIDQDYRGNVGVVLFNFGEKEFEVKKGERIAQLICERIYIPELDECEDLDDTDRGSSGYGSTG 162          
BLAST of SMED30029980 vs. TrEMBL
Match: V3ZLC2 (dUTPase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_196086 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 3.525e-71
Identity = 108/147 (73.47%), Postives = 123/147 (83.67%), Query Frame = -1
Query:   64 KAKSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 504
            + K  V   +L+F KL+  A+TP RGS LAAGYDL SA + I+PAK K +VKTDIQIALP+GCYGR+APRSGLA KNFIDVGAGVIDQDYRGNVGV+LFNFSDKDF V KG+RIAQL+CE+I +PEL E  SLD TERGDGGYGSTG
Sbjct:   21 RVKMAVDNVVLKFAKLTAEALTPTRGSKLAAGYDLYSAYEVIVPAKDKAVVKTDIQIALPDGCYGRVAPRSGLAVKNFIDVGAGVIDQDYRGNVGVVLFNFSDKDFKVEKGNRIAQLLCERIYIPELQEEISLDKTERGDGGYGSTG 167          
BLAST of SMED30029980 vs. TrEMBL
Match: A0A1W2WM70 (deoxyuridine 5'-triphosphate nucleotidohydrolase-like OS=Ciona intestinalis OX=7719 GN=LOC100183847 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.304e-69
Identity = 103/140 (73.57%), Postives = 119/140 (85.00%), Query Frame = -1
Query:   58 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 477
            +L+F KL+ENA  P RGS L+AGYDL SA D IIPA+GK +VKTDIQIALP+GCYGR+APRSGL  K+FIDVGAGVIDQDYRGNVGV+LFNF+D DF V KGDRIAQLICE+I +P+L E E LD+T RG GG+GSTG N
Sbjct:   45 VLKFAKLTENASKPTRGSKLSAGYDLYSAYDIIIPARGKNLVKTDIQIALPDGCYGRVAPRSGLTHKHFIDVGAGVIDQDYRGNVGVILFNFNDVDFQVHKGDRIAQLICERIFLPDLQELEKLDETVRGSGGFGSTGHN 184          
BLAST of SMED30029980 vs. Ensembl Cavefish
Match: dut (deoxyuridine triphosphatase [Source:NCBI gene;Acc:103021487])

HSP 1 Score: 206.068 bits (523), Expect = 1.439e-67
Identity = 99/145 (68.28%), Postives = 119/145 (82.07%), Query Frame = -1
Query:   64 KSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 498
            KS + + +LRF KL+ENA TP RGS+ AAGYDL SA D  I    K IVKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGV+D+DYRGNVGV+LFNFS + F V KGDR+AQL+CE+I  P+LVE ++LD+TERG GG+GSTG
Sbjct:   55 KSRIEEGVLRFAKLTENATTPTRGSSKAAGYDLYSAYDYSIGPMDKAIVKTDIQIAVPHGCYGRVAPRSGLAAKHFIDVGAGVVDEDYRGNVGVVLFNFSKETFEVKKGDRVAQLVCERICYPDLVEQKTLDETERGSGGFGSTG 199          
BLAST of SMED30029980 vs. Ensembl Cavefish
Match: dut (deoxyuridine triphosphatase [Source:NCBI gene;Acc:103021487])

HSP 1 Score: 182.185 bits (461), Expect = 3.757e-58
Identity = 87/127 (68.50%), Postives = 103/127 (81.10%), Query Frame = -1
Query:  118 KSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVE 498
            KS + + +LRF KL+ENA TP RGS+ AAGYDL SA D  I    K IVKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGV+D+DYRGNVGV+LFNFS + F V KGDR+AQL+CE+I  P+LVE
Sbjct:   55 KSRIEEGVLRFAKLTENATTPTRGSSKAAGYDLYSAYDYSIGPMDKAIVKTDIQIAVPHGCYGRVAPRSGLAAKHFIDVGAGVVDEDYRGNVGVVLFNFSKETFEVKKGDRVAQLVCERICYPDLVE 181          
BLAST of SMED30029980 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010451.1 (pep scaffold:Pmarinus_7.0:GL481028:15436:23520:-1 gene:ENSPMAG00000009462.1 transcript:ENSPMAT00000010451.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 1.733e-57
Identity = 91/135 (67.41%), Postives = 107/135 (79.26%), Query Frame = -1
Query:   91 KKMLRFKKLSENAMTPLRGSALAAGYDL---CSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIA-PRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTER 483
            + +LRF KLS NA+ P +GSA AAG+DL   CSA D  IP   + +V+TDIQIALPEGCYGRIA PRSGLA K+ IDVGAGV+D+DYRGNVGV+LFNF  K F V +GDRIAQLICEKI  P+L EC SL++TER
Sbjct:   17 RALLRFAKLSANAVAPCKGSAKAAGFDLHSVCSAYDYEIPPMDRLVVQTDIQIALPEGCYGRIAAPRSGLAAKHGIDVGAGVVDEDYRGNVGVVLFNFGKKPFVVKRGDRIAQLICEKIFYPQLEECTSLENTER 151          
BLAST of SMED30029980 vs. Ensembl Yeast
Match: DUT1 (Deoxyuridine triphosphate diphosphatase (dUTPase); catalyzes hydrolysis of dUTP to dUMP and PPi, thereby preventing incorporation of uracil into DNA during replication; critical for the maintenance of genetic stability; also has diphosphatase activity on deoxyinosine triphosphate; human homolog DUT allows growth of yeast haploid dut1 null mutant after sporulation of heterozygous diploid [Source:SGD;Acc:S000000456])

HSP 1 Score: 155.992 bits (393), Expect = 2.189e-49
Identity = 76/140 (54.29%), Postives = 101/140 (72.14%), Query Frame = -1
Query:   64 KMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKIL-MPELVECESLDDTERGDGGYGSTG 480
            K+L+ +  S +A  P +GSA AAGYD+ ++ D  IPA G+ +V TDI   +P G YGRIAPRSGLA KN I  GAGV+D+DY G V V+LFN S +DF + KGDR+AQLI EKI+   ++V  +SL+++ RG GG+GSTG
Sbjct:    7 KVLKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLAVKNGIQTGAGVVDRDYTGEVKVVLFNHSQRDFAIKKGDRVAQLILEKIVDDAQIVVVDSLEESARGAGGFGSTG 146          
BLAST of SMED30029980 vs. Ensembl Nematostella
Match: EDO46592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPL3])

HSP 1 Score: 193.741 bits (491), Expect = 1.040e-63
Identity = 92/150 (61.33%), Postives = 116/150 (77.33%), Query Frame = -1
Query:   64 FNYKAKSMVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTG 513
            ++Y+ ++   + +L FKKL++  + P RGS+ AAGYDL SA D  IPA+GK +VKTDI +A+P+GCYGR+APRS LAWK+ IDVGAGVID+DYRGNVGV+LFN     + V +GDRIAQLI E+I  P +VE E LD TERG GGYGSTG
Sbjct:   15 YSYEERA---ETVLYFKKLTKLGLPPTRGSSHAAGYDLYSAYDVSIPAQGKALVKTDIAVAIPDGCYGRVAPRSSLAWKHQIDVGAGVIDRDYRGNVGVVLFNLGSSAYEVKQGDRIAQLIVERIQTPSIVEVEDLDSTERGAGGYGSTG 161          
BLAST of SMED30029980 vs. Ensembl Nematostella
Match: EDO27498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T934])

HSP 1 Score: 97.4413 bits (241), Expect = 3.715e-26
Identity = 56/123 (45.53%), Postives = 75/123 (60.98%), Query Frame = -1
Query:   61 AAGYDLCSAIDCIIPAKGKE--IVKTDIQIALPEGCYGRIAPRSGLAWKNFIDV--GAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGL 417
            +AG D+ + I   I  K  E  IVKT + I LP G   ++  RSGLA KN I V    G ID DYRG +GV+L N S+++F +  G+RIAQL+  K    E +  E L +T RG+GG+GSTG+
Sbjct:   21 SAGMDIRANISQSIILKPLERVIVKTGLFIELPIGYEAQVRSRSGLAAKNGITVLNAPGTIDADYRGEIGVILVNLSNENFTIENGERIAQLVIAKHERAEWIPVEELSETTRGEGGFGSTGV 143          
BLAST of SMED30029980 vs. Ensembl Medaka
Match: dut (deoxyuridine triphosphatase [Source:NCBI gene;Acc:101171897])

HSP 1 Score: 210.69 bits (535), Expect = 3.025e-69
Identity = 100/142 (70.42%), Postives = 116/142 (81.69%), Query Frame = -1
Query:   58 KKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLN 483
            + +LRF KLSENA TP RGS+ AAGYDL SA D  I    K IVKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGV+D+DYRGN+GV+LFNFS + F V KGDR+AQL+CE+I  PEL E E+LDDTERG GG+GSTG N
Sbjct:   63 RTVLRFAKLSENATTPTRGSSKAAGYDLYSAYDYTIGPMDKAIVKTDIQIAVPHGCYGRVAPRSGLAAKHFIDVGAGVVDEDYRGNLGVVLFNFSKETFEVKKGDRVAQLVCERICYPELEEQETLDDTERGSGGFGSTGRN 204          
BLAST of SMED30029980 vs. Ensembl Medaka
Match: dut (deoxyuridine triphosphatase [Source:NCBI gene;Acc:101171897])

HSP 1 Score: 180.259 bits (456), Expect = 7.754e-58
Identity = 86/124 (69.35%), Postives = 100/124 (80.65%), Query Frame = -1
Query:  112 KKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECE 483
            + +LRF KLSENA TP RGS+ AAGYDL SA D  I    K IVKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGV+D+DYRGN+GV+LFNFS + F V KGDR+AQL+CE+I  PEL E E
Sbjct:   29 RTVLRFAKLSENATTPTRGSSKAAGYDLYSAYDYTIGPMDKAIVKTDIQIAVPHGCYGRVAPRSGLAAKHFIDVGAGVVDEDYRGNLGVVLFNFSKETFEVKKGDRVAQLVCERICYPELEEQE 152          
BLAST of SMED30029980 vs. Ensembl Medaka
Match: dut (deoxyuridine triphosphatase [Source:NCBI gene;Acc:101171897])

HSP 1 Score: 181.03 bits (458), Expect = 1.008e-57
Identity = 86/124 (69.35%), Postives = 100/124 (80.65%), Query Frame = -1
Query:  112 KKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECE 483
            + +LRF KLSENA TP RGS+ AAGYDL SA D  I    K IVKTDIQIA+P GCYGR+APRSGLA K+FIDVGAGV+D+DYRGN+GV+LFNFS + F V KGDR+AQL+CE+I  PEL E E
Sbjct:   63 RTVLRFAKLSENATTPTRGSSKAAGYDLYSAYDYTIGPMDKAIVKTDIQIAVPHGCYGRVAPRSGLAAKHFIDVGAGVVDEDYRGNLGVVLFNFSKETFEVKKGDRVAQLVCERICYPELEEQE 186          
BLAST of SMED30029980 vs. Planmine SMEST
Match: SMESG000005589.1 (SMESG000005589.1)

HSP 1 Score: 304.294 bits (778), Expect = 3.688e-107
Identity = 150/150 (100.00%), Postives = 150/150 (100.00%), Query Frame = -1
Query:   43 MVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKSGL 492
            MVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKSGL
Sbjct:    1 MVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKSGL 150          
BLAST of SMED30029980 vs. Planmine SMEST
Match: SMESG000005589.1 (SMESG000005589.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.367e-103
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = -1
Query:   43 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKSGL 477
            MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKSGL
Sbjct:    1 MLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTDIQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDKDFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKSGL 145          
The following BLAST results are available for this feature:
BLAST of SMED30029980 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUT8.887e-7070.83deoxyuridine triphosphatase [Source:HGNC Symbol;Ac... [more]
DUT1.789e-6970.83deoxyuridine triphosphatase [Source:HGNC Symbol;Ac... [more]
DUT4.634e-6971.43deoxyuridine triphosphatase [Source:HGNC Symbol;Ac... [more]
DUT2.366e-6870.83deoxyuridine triphosphatase [Source:HGNC Symbol;Ac... [more]
DUT4.085e-6470.59deoxyuridine triphosphatase [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dut-18.465e-5160.00DeoxyUTPase; Deoxyuridinetriphosphatase [Source:U... [more]
dut-18.465e-5160.00DeoxyUTPase; Deoxyuridinetriphosphatase [Source:U... [more]
dut-18.465e-5160.00DeoxyUTPase; Deoxyuridinetriphosphatase [Source:U... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dUTPase9.948e-6867.63gene:FBgn0250837 transcript:FBtr0331196[more]
dUTPase9.948e-6867.63gene:FBgn0250837 transcript:FBtr0080156[more]
dUTPase9.948e-6867.63gene:FBgn0250837 transcript:FBtr0331195[more]
dUTPase1.887e-6767.63gene:FBgn0250837 transcript:FBtr0080157[more]
back to top
BLAST of SMED30029980 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dut2.284e-6266.43deoxyuridine triphosphatase [Source:ZFIN;Acc:ZDB-G... [more]
CABZ01074745.12.728e-4967.26deoxyuridine 5'-triphosphate nucleotidohydrolase-l... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000055355.12.562e-6669.44deoxyuridine triphosphatase [Source:NCBI gene;Acc:... [more]
ENSXETT00000055356.19.050e-5769.67deoxyuridine triphosphatase [Source:NCBI gene;Acc:... [more]
wdr136.404e-4159.13WD repeat domain 13 [Source:Xenbase;Acc:XB-GENE-58... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dut1.178e-6671.22deoxyuridine triphosphatase [Source:MGI Symbol;Acc... [more]
Dut4.207e-6671.22deoxyuridine triphosphatase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of SMED30029980 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P33316|DUT_HUMAN1.136e-6770.83Deoxyuridine 5'-triphosphate nucleotidohydrolase, ... [more]
sp|P70583|DUT_RAT3.163e-6671.22Deoxyuridine 5'-triphosphate nucleotidohydrolase O... [more]
sp|Q10FF9|DUT_ORYSJ3.653e-6366.19Deoxyuridine 5'-triphosphate nucleotidohydrolase O... [more]
sp|Q9STG6|DUT_ARATH8.307e-6366.19Deoxyuridine 5'-triphosphate nucleotidohydrolase O... [more]
sp|Q54BW5|DUT_DICDI2.087e-6262.50Deoxyuridine 5'-triphosphate nucleotidohydrolase O... [more]
back to top
BLAST of SMED30029980 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A348HAP41.626e-8075.68Deoxyuridine triphosphatase OS=Dugesia ryukyuensis... [more]
H2ZPZ18.936e-7369.80dUTPase domain-containing protein OS=Ciona savigny... [more]
A0A210QMJ65.980e-7272.97Deoxyuridine 5'-triphosphate nucleotidohydrolase, ... [more]
V3ZLC23.525e-7173.47dUTPase domain-containing protein OS=Lottia gigant... [more]
A0A1W2WM702.304e-6973.57deoxyuridine 5'-triphosphate nucleotidohydrolase-l... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dut1.439e-6768.28deoxyuridine triphosphatase [Source:NCBI gene;Acc:... [more]
dut3.757e-5868.50deoxyuridine triphosphatase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010451.11.733e-5767.41pep scaffold:Pmarinus_7.0:GL481028:15436:23520:-1 ... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DUT12.189e-4954.29Deoxyuridine triphosphate diphosphatase (dUTPase);... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO465921.040e-6361.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274983.715e-2645.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30029980 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dut3.025e-6970.42deoxyuridine triphosphatase [Source:NCBI gene;Acc:... [more]
dut7.754e-5869.35deoxyuridine triphosphatase [Source:NCBI gene;Acc:... [more]
dut1.008e-5769.35deoxyuridine triphosphatase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SMED30029980 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005589.13.688e-107100.00SMESG000005589.1[more]
SMESG000005589.11.367e-103100.00SMESG000005589.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029980 ID=SMED30029980|Name=SMED30029980|organism=Schmidtea mediterranea sexual|type=transcript|length=600bp
TATAAATTGACAAAAACATTTATTTACATAACATTAGATCTATAAACCAG
ATTTTAAGTTTAATCCAGTTGACCCATAACCACCATCACCACGTTCAGTA
TCATCAAGTGATTCACATTCAACTAATTCAGGCATTAGAATTTTTTCACA
AATAAGTTGAGCAATTCTGTCTCCTTTTGCTACTGGAAAATCTTTGTCGG
AAAAATTAAACAATAATACTCCAACATTCCCACGATAATCTTGATCAATA
ACTCCAGCCCCAACATCGATAAAATTTTTCCAAGCTAGACCACTTCTAGG
TGCAATTCTTCCATAACAACCTTCTGGTAATGCAATTTGAATATCAGTTT
TCACAATTTCCTTTCCTTTTGCTGGAATAATACAATCTATAGCACTACAT
AAGTCATATCCAGCTGCCAATGCTGAACCTCTTAACGGAGTCATTGCATT
TTCAGATAGCTTTTTAAATCTAAGCATCTTTTTACCTACCATACTTTTCG
CTTTATAATTGAATAATATATAATTGAATAATAAAACAAGTTATTTTAAA
TTATATAAAAATAATTGTGTACAATTTCTAATTATGGGTGGTTGGAAATT
back to top

protein sequence of SMED30029980-orf-1

>SMED30029980-orf-1 ID=SMED30029980-orf-1|Name=SMED30029980-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
MVGKKMLRFKKLSENAMTPLRGSALAAGYDLCSAIDCIIPAKGKEIVKTD
IQIALPEGCYGRIAPRSGLAWKNFIDVGAGVIDQDYRGNVGVLLFNFSDK
DFPVAKGDRIAQLICEKILMPELVECESLDDTERGDGGYGSTGLNLKSGL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036157dUTPase-like_sf
IPR008181dUTPase_1
IPR033704dUTPase_trimeric
IPR029054dUTPase-like
IPR008180dUTPase/dCTP_deaminase
Vocabulary: molecular function
TermDefinition
GO:0000287magnesium ion binding
GO:0004170dUTP diphosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0046081dUTP catabolic process
GO:0006226dUMP biosynthetic process
GO:0046080dUTP metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036157dUTPase-like superfamilyGENE3DG3DSA:2.70.40.10coord: 2..145
e-value: 1.3E-55
score: 188.9
IPR036157dUTPase-like superfamilySUPERFAMILYSSF51283dUTPase-likecoord: 5..144
IPR008181Deoxyuridine triphosphate nucleotidohydrolaseTIGRFAMTIGR00576TIGR00576coord: 7..143
e-value: 7.0E-53
score: 176.2
IPR008181Deoxyuridine triphosphate nucleotidohydrolasePANTHERPTHR11241DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASEcoord: 5..143
IPR029054dUTPase-likePFAMPF00692dUTPasecoord: 16..143
e-value: 3.1E-44
score: 149.8
IPR033704dUTPase, trimericCDDcd07557trimeric_dUTPasecoord: 27..114
e-value: 1.04287E-31
score: 106.81