Retinoblastoma-binding protein 5 homolog

Overview
NameRetinoblastoma-binding protein 5 homolog
Smed IDSMED30029979
Length (bp)1603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retinoblastoma-binding protein 5 homolog (SMED30029979) t-SNE clustered cells

Violin plots show distribution of expression levels for Retinoblastoma-binding protein 5 homolog (SMED30029979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retinoblastoma-binding protein 5 homolog (SMED30029979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retinoblastoma-binding protein 5 homolog (SMED30029979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029979SMESG000077004.1 SmedASXL_013281SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029979SMESG000077004.1 SmedASXL_013281SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30029979SMESG000077004.1 dd_Smed_v4_4897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029979SMESG000077004.1 dd_Smed_v4_4897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30029979SMESG000077004.1 dd_Smed_v4_4897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029979SMESG000077004.1 Contig48689uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029979SMESG000077004.1 Contig48689newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30029979SMESG000077004.1 HO007192ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30029979SMESG000077004.1 HO007192ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30029979SMESG000077004.1 HO007192ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30029979SMESG000077004.1 DN308991ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30029979SMESG000077004.1 DN308991ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30029979SMESG000077004.1 DN308991ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Human
Match: RBBP5 (RB binding protein 5, histone lysine methyltransferase complex subunit [Source:HGNC Symbol;Acc:HGNC:9888])

HSP 1 Score: 496.508 bits (1277), Expect = 2.663e-171
Identity = 269/517 (52.03%), Postives = 351/517 (67.89%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD+++GD  + FR P P+LKVQ+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V+         + K+ QS  + S P  KK K   I+L     DEVHPL+  +   K      +KK  + R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGK------SKKKQAGRPKGSKGKEK 495          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Human
Match: RBBP5 (RB binding protein 5, histone lysine methyltransferase complex subunit [Source:HGNC Symbol;Acc:HGNC:9888])

HSP 1 Score: 494.582 bits (1272), Expect = 4.701e-171
Identity = 271/518 (52.32%), Postives = 348/518 (67.18%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMKK 1536
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD+++GD  + FR P P+LKVQ+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V+         + K+ QS  + S P  KK K   I+L     DEVHPL           LGV     S + Q  R K  K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPL-----------LGVKGDGKSKKKQAGRPKGSK 491          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Human
Match: WDR5 (WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12757])

HSP 1 Score: 73.9442 bits (180), Expect = 9.475e-14
Identity = 66/289 (22.84%), Postives = 129/289 (44.64%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGD-----GEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            +++F+  G  +A    D  I+IW     +  K IS H   +  V+WS DS  L+SAS D  + IWD+ +G  L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D  ++++   D ++          +     TG+   K C   +     G++I +GS + + +Y+W   +  +V+ L G   + ++    HP   +I S +
Sbjct:   50 SVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW---DYSKG---------KCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS-EDNLVYIWNLQTKEIVQKLQGHT-DVVISTACHPTENIIASAA 320          

HSP 2 Score: 61.6178 bits (148), Expect = 1.135e-9
Identity = 49/173 (28.32%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    I A+F    G +I +G+    V I+N Q  ++V+  +
Sbjct:  129 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Human
Match: SNRNP40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:HGNC Symbol;Acc:HGNC:30857])

HSP 1 Score: 71.2478 bits (173), Expect = 1.066e-12
Identity = 63/289 (21.80%), Postives = 126/289 (43.60%), Query Frame = 1
Query:  145 QFNRCGNLIAIGCNDGRIEIWD-YCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGN------HWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSN 990
            +F+  G+ +A    D  I +W+ Y        +  H   V  + ++ D   L SASTD  +++WD  TG+ ++  +     +   +  R   +++        V L  +  + +I  F++   + +  +F+     I +G     + +++ +  ++  T R       S+  +  S  G   L N  D  +RV++ +           P  +   I  GN      +  +C +S DG  I AGS  +  +Y+W+ +S  ++  L G  G ++ +V +HP  P+I+S S+
Sbjct:   73 KFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQV-LAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMR---GHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFA--------PKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRF-VYVWDTTSRRILYKLPGHAG-SINEVAFHPDEPIIISASS 347          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Human
Match: WDR44 (WD repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:30512])

HSP 1 Score: 68.1662 bits (165), Expect = 2.790e-11
Identity = 70/309 (22.65%), Postives = 117/309 (37.86%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIW------DYCTRRMIKY------------------------------------------------ISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIV--ASFDRRGTYIYTGNSKGKVTIYNSQNLQV-----VRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLW 882
            T++F+ CG L+A    D  + IW      DY     +KY                                                   H   +  +SWS++   LLS+S D  + +W I   + L  F+    V  + FHPRD    L   L     + N +  ++  L  E D    ++  A+F + G Y   G   G+   Y++++L+      VR+ R  N     I  IE        L+   D  IR+Y+ +D++         S++ +  V  +   K  FS D  Y+ +GS  ++ +Y+W
Sbjct:  516 TMKFSHCGRLLASAGQDNVVRIWALKNAFDYFNNMRMKYNTEGRVSPSPSQESLSSSKSDTDTGVCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYF-LLSSSMDKTVRLWHISRRECLCCFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWN-IPDKKVALWNEVDGQTKLITAANFCQNGKYAVIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSL--------SMKYKGYVNSSSQIKASFSHDFTYLVSGSEDKY-VYIW 813          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Celegans
Match: rbbp-5 (Retinoblastoma-binding protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:Q09309])

HSP 1 Score: 268.085 bits (684), Expect = 7.338e-84
Identity = 147/408 (36.03%), Postives = 228/408 (55.88%), Query Frame = 1
Query:   25 LELLE-AFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFE---DDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXX-XXXXXXXXXXXXXKQIDTEKDKNAEDIEVDIETIEPISALLSSDEEN 1233
            +E+L+  +   +PE  + HL     D  +  ++C       +FNR G+++A+GC DGR+ I+D+ TR + +  SAH  PV  +SWSRD RKLL++S DN I+++D++ G  L   R    V    FHPR+  K +V  +   P +       +++L  +     ++     S+DR+G YI  G  KGK+ IYN++ L+ V    C       I+ I    +    + N  DRVIR Y  +D+        +   ++ D+V    W+  C   DG Y+C  S K HS+Y+WE ++G+L+KILHG KGE LLDV WHP RP+I+S++       VS+W Q  V+NWSAFAP+F+EL+EN +Y E+       +++  +  T K ++AED  +D+  + P   L SSDEE+
Sbjct:    2 VEILDRTYGAQFPEELECHL-----DLQNASANCC------KFNRWGSIVAVGCTDGRVLIYDFMTRNIARTFSAHCLPVSCLSWSRDGRKLLTSSADNSIAMFDVLAGTLLHRIRFNSMVTFAMFHPRNDNKAIVLQVNKQPTVEQFSPRIQTVLANDTPGSSDESASCVSYDRKGKYIIAGTGKGKLLIYNAETLKCVAW--CKQNTVQQIRQIIVPMKSRFIITNTQDRVIRTYELEDLLHQRGQMVEAKYKVLDMVNKAAWKNVCTDSDGLYVCGASTKAHSLYIWESNTGSLIKILHGNKGEALLDVQWHPTRPIILSIAQGT----VSMWTQAHVENWSAFAPEFQELEENEKYIEKENEFDMEDEDADEDMTSKSQDAEDDIIDVVNVRPEDYLASSDEED 392          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 72.7886 bits (177), Expect = 1.451e-13
Identity = 68/286 (23.78%), Postives = 133/286 (46.50%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSG----DGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVS 981
            + +F+ CG  +     D  ++IW+       + ++ H   V  ++WS DSR ++SAS D  + I++I+T    +T +     V    F+P+  + ++V       V +  V     I      +D     SF+R G+ I +G+  G V I+++ N Q ++T    +  N  +  ++FS  G+  L +  D  ++++   D ++ G T       L+      + + C F+      G++I +GS +   IY+W   +  +V+ L G   + +L    HP++ +I S
Sbjct:   92 SAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQ--SSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTL--VDDENPPVAFVKFSPNGKYILASNLDSTLKLW---DFSK-GKT-------LKQYTGHENSKYCIFANFSVTGGKWIISGS-EDCKIYIWNLQTREIVQCLEGHT-QPVLASDCHPVQNIIAS 360          

HSP 2 Score: 65.855 bits (159), Expect = 2.422e-11
Identity = 49/168 (29.17%), Postives = 81/168 (48.21%), Query Frame = 1
Query:  130 YAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVR 615
            Y     FN   +L+  G  D  + IWD  T   IK + AH  PV +VS++RD   + S S D  + IWD   G  ++T      P PV  V+F P    K ++     + + L   S  +++ Q+   +++   I A+F    G +I +G+   K+ I+N Q  ++V+
Sbjct:  173 YVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENP-PVAFVKFSPNG--KYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQ 337          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 72.7886 bits (177), Expect = 1.451e-13
Identity = 68/286 (23.78%), Postives = 133/286 (46.50%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSG----DGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVS 981
            + +F+ CG  +     D  ++IW+       + ++ H   V  ++WS DSR ++SAS D  + I++I+T    +T +     V    F+P+  + ++V       V +  V     I      +D     SF+R G+ I +G+  G V I+++ N Q ++T    +  N  +  ++FS  G+  L +  D  ++++   D ++ G T       L+      + + C F+      G++I +GS +   IY+W   +  +V+ L G   + +L    HP++ +I S
Sbjct:   92 SAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQ--SSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTL--VDDENPPVAFVKFSPNGKYILASNLDSTLKLW---DFSK-GKT-------LKQYTGHENSKYCIFANFSVTGGKWIISGS-EDCKIYIWNLQTREIVQCLEGHT-QPVLASDCHPVQNIIAS 360          

HSP 2 Score: 65.855 bits (159), Expect = 2.422e-11
Identity = 49/168 (29.17%), Postives = 81/168 (48.21%), Query Frame = 1
Query:  130 YAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVR 615
            Y     FN   +L+  G  D  + IWD  T   IK + AH  PV +VS++RD   + S S D  + IWD   G  ++T      P PV  V+F P    K ++     + + L   S  +++ Q+   +++   I A+F    G +I +G+   K+ I+N Q  ++V+
Sbjct:  173 YVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENP-PVAFVKFSPNG--KYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQ 337          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Celegans
Match: wdr-5.2 (WD repeat-containing protein wdr-5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q93847])

HSP 1 Score: 63.929 bits (154), Expect = 1.040e-10
Identity = 57/178 (32.02%), Postives = 82/178 (46.07%), Query Frame = 1
Query:  130 YAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQ--RSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTA 639
            Y     FN  G LIA G  D  I IW       I  I  H  PV SV ++RD   L S S D  + IWD  TG  ++T      P P+  V+F P +   IL   L +    L    YQ  R + ++   +++   + A+F    G +I +G+   KV I+N Q  ++++T    NTA
Sbjct:  192 YVFCCCFNPSGTLIASGSFDETIRIWCARNGNTIFSIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLIDEEHP-PITHVKFSP-NGKYILASNLNNT---LKLWDYQKLRVLKEYTGHENSKYCVAANFSVTGGKWIVSGSEDHKVYIWNLQTREILQTLDGHNTA 364          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Celegans
Match: F55F8.3 (Periodic tryptophan protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91341])

HSP 1 Score: 58.151 bits (139), Expect = 1.413e-8
Identity = 59/268 (22.01%), Postives = 109/268 (40.67%), Query Frame = 1
Query:  103 VSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGI-------VASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG--DT--DPDPSLQLRDIVT------GNHWRKCCFSGDGEYICAGS 855
            V K+ + +    T +++  G+L+A G  DG+++IW+  +         H   V +V W++  R +LSAS D  +   D+       T   P P             +++   +          +   I  FE  + L I       ++S D  G +I +G+    + ++   + Q   T   ++ A      ++FS  G+   +  +D VI  +  +++   G  DT  D DP+   RD +T         + +  FS DG  + AG 
Sbjct:  353 VMKQQAHSLRITTAEYSPDGSLMATGAEDGKVKIWNSRSSFCTVTFDEHTSGVTAVKWTQSGRAILSASLDGTVRAHDLKRYRNFRTLVCPEPTQLATLAVDKAGDLVIAGAKEV--------FNIYIWSFETGHLLDILSGHESAISSIDIHGNHIVSGSWDRTIKMWTIVDSQ-AETVEVSHEA----LDVKFSPAGDEIAVLTSDGVITFFEAKEMINLGSIDTKLDTDPARGSRDTITRQSAAKTKTFTRIRFSPDGNLLLAGG 607          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Fly
Match: Rbbp5 (gene:FBgn0036973 transcript:FBtr0078242)

HSP 1 Score: 495.352 bits (1274), Expect = 5.874e-172
Identity = 261/507 (51.48%), Postives = 354/507 (69.82%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFR--CTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKD-KNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQ----SETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQR 1515
            MNLELLE+F QNYPE  DG L+            C + A+T  FN+ G L+A+GCNDGRI IWD+ TR + K ISAHVHPVCS+SW+R+  KLLSASTDN++ IWD++TG+    +R P PVLKVQF PR+  ++LVCP+R+A V++      R  L  + D DL IVASFDRRG +IYTGN+KGK+ + + +  +VV +FR     ++ +++KSIEF+RRG+ FLIN +DRVIRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYICAGS +QH++Y+WE+S G LVKILHG KGE LLDVVWHP+RP+I S+S+ +    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDI DEDK +D   D +  E+IEVD++ +EP++A  SSDEE E  + +  L   PE+E PED    ++      V    ++     +  M+ K ++ ++ ++ LP+A  DE HPL+SS K +K  Q  V  K ++ R ++
Sbjct:    1 MNLELLESFGQNYPEEFDGSLD------------CISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLTRGIAKIISAHVHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGELEHKYRFPSPVLKVQFDPRNDNRLLVCPMRYAAVLVEVGGTHRC-LPLDSDGDLNIVASFDRRGKHIYTGNAKGKILVLDVETFEVVASFRIIVGTSSATAVKSIEFARRGDAFLINTSDRVIRVYDSKEIITLGKDGEPEPIQKLQDLVNKTTWKKCCFSGDGEYICAGSARQHALYIWEKSIGNLVKILHGTKGELLLDVVWHPVRPIIASISSGL----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIADEDKSVDLNADAQQDEEIEVDVQKVEPVAAFCSSDEEGEDENALQFLPMAPEVEDPEDGWTGQDGLEPSAVMLGHMEPHDYEDDIMASKRRRMQLYDVSLPDAPTDETHPLISS-KASKDKQQPVGGKKAAGRTKK 489          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 74.7146 bits (182), Expect = 3.470e-14
Identity = 68/289 (23.53%), Postives = 130/289 (44.98%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGD-----GEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
             ++F+  G  +A    D  I+IW     +  K IS H   +  V+WS DSR L+S S D  + +W++ TG +L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D  ++++   D ++          +     TG+   K C   +     G++I +GS + + +Y+W   S  +V+ L G   +T+L    HP   +I S +
Sbjct:   77 AVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW---DYSKG---------KCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS-EDNMVYIWNLQSKEVVQKLQGHT-DTVLCTACHPTENIIASAA 347          

HSP 2 Score: 61.2326 bits (147), Expect = 7.262e-10
Identity = 50/173 (28.90%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    I A+F    G +I +G+    V I+N Q+ +VV+  +
Sbjct:  156 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 74.7146 bits (182), Expect = 3.470e-14
Identity = 68/289 (23.53%), Postives = 130/289 (44.98%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGD-----GEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
             ++F+  G  +A    D  I+IW     +  K IS H   +  V+WS DSR L+S S D  + +W++ TG +L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D  ++++   D ++          +     TG+   K C   +     G++I +GS + + +Y+W   S  +V+ L G   +T+L    HP   +I S +
Sbjct:   77 AVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW---DYSKG---------KCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS-EDNMVYIWNLQSKEVVQKLQGHT-DTVLCTACHPTENIIASAA 347          

HSP 2 Score: 61.2326 bits (147), Expect = 7.262e-10
Identity = 50/173 (28.90%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    I A+F    G +I +G+    V I+N Q+ +VV+  +
Sbjct:  156 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Fly
Match: Smu1 (gene:FBgn0038666 transcript:FBtr0083721)

HSP 1 Score: 68.5514 bits (166), Expect = 6.591e-12
Identity = 67/297 (22.56%), Postives = 131/297 (44.11%), Query Frame = 1
Query:  145 QFNRCGNLIAIGCNDGRIEIWDYCT---RRMIKY-----ISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFR------LPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQ-DVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYI-CAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            QF+  G  +  G  DG +E+W++ T   R+ +KY            V ++++SRDS  + S + D  I +W IITG  L  F       + C    +QF  RD +++L     +  V L+ +   + + +F+  +     A+F   G  + + +S G V +++ +  + V T++      +    +   +  E F++      + + N Q  + R+  +             G  +     S  GE+I CAG  +   +Y +  SSG L + L+  + + ++ +  HP + ++ S S
Sbjct:  221 QFSPDGQYLITGSVDGFLEVWNFTTGKVRKDLKYQAQDQFMMMEQAVLALNFSRDSEMVASGAQDGQIKVWRIITGQCLRKFEKAHTKGITC----LQF-SRDNSQVLSASFDYT-VRLHGLKSGKMLKEFKGHSSFVNEATFTPDGHSVLSASSDGTVKVWSLKTTECVATYKPLGNELAVNTVLILPKNPEHFIVCNRSNTVVIMNMQGQIVRSFSSGKRE---------GGAFISATLSPRGEFIYCAG--EDQVLYCFSVSSGKLERTLNVHEKD-VIGLTHHPHQNLLASYS 499          

HSP 2 Score: 55.4546 bits (132), Expect = 8.676e-8
Identity = 46/202 (22.77%), Postives = 87/202 (43.07%), Query Frame = 1
Query:  136 ITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMI-KYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFED-DNDLGI--VASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNC 729
            + L F+R   ++A G  DG+I++W   T + + K+  AH   +  + +SRD+ ++LSAS D  + +  + +G  L+ F+     +       D   +L        V + ++     +  ++   N+L +  V    +   +    N    V I N Q  Q+VR+F        +  S   S RGE       D+V+  ++ 
Sbjct:  268 LALNFSRDSEMVASGAQDGQIKVWRIITGQCLRKFEKAHTKGITCLQFSRDNSQVLSASFDYTVRLHGLKSGKMLKEFKGHSSFVNEATFTPDGHSVLSAS-SDGTVKVWSLKTTECVATYKPLGNELAVNTVLILPKNPEHFIVCNRSNTVVIMNMQG-QIVRSFSSGKREGGAFISATLSPRGEFIYCAGEDQVLYCFSV 467          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Fly
Match: Smu1 (gene:FBgn0038666 transcript:FBtr0304690)

HSP 1 Score: 68.5514 bits (166), Expect = 6.591e-12
Identity = 67/297 (22.56%), Postives = 131/297 (44.11%), Query Frame = 1
Query:  145 QFNRCGNLIAIGCNDGRIEIWDYCT---RRMIKY-----ISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFR------LPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQ-DVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYI-CAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            QF+  G  +  G  DG +E+W++ T   R+ +KY            V ++++SRDS  + S + D  I +W IITG  L  F       + C    +QF  RD +++L     +  V L+ +   + + +F+  +     A+F   G  + + +S G V +++ +  + V T++      +    +   +  E F++      + + N Q  + R+  +             G  +     S  GE+I CAG  +   +Y +  SSG L + L+  + + ++ +  HP + ++ S S
Sbjct:  221 QFSPDGQYLITGSVDGFLEVWNFTTGKVRKDLKYQAQDQFMMMEQAVLALNFSRDSEMVASGAQDGQIKVWRIITGQCLRKFEKAHTKGITC----LQF-SRDNSQVLSASFDYT-VRLHGLKSGKMLKEFKGHSSFVNEATFTPDGHSVLSASSDGTVKVWSLKTTECVATYKPLGNELAVNTVLILPKNPEHFIVCNRSNTVVIMNMQGQIVRSFSSGKRE---------GGAFISATLSPRGEFIYCAG--EDQVLYCFSVSSGKLERTLNVHEKD-VIGLTHHPHQNLLASYS 499          

HSP 2 Score: 55.4546 bits (132), Expect = 8.676e-8
Identity = 46/202 (22.77%), Postives = 87/202 (43.07%), Query Frame = 1
Query:  136 ITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMI-KYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFED-DNDLGI--VASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNC 729
            + L F+R   ++A G  DG+I++W   T + + K+  AH   +  + +SRD+ ++LSAS D  + +  + +G  L+ F+     +       D   +L        V + ++     +  ++   N+L +  V    +   +    N    V I N Q  Q+VR+F        +  S   S RGE       D+V+  ++ 
Sbjct:  268 LALNFSRDSEMVASGAQDGQIKVWRIITGQCLRKFEKAHTKGITCLQFSRDNSQVLSASFDYTVRLHGLKSGKMLKEFKGHSSFVNEATFTPDGHSVLSAS-SDGTVKVWSLKTTECVATYKPLGNELAVNTVLILPKNPEHFIVCNRSNTVVIMNMQG-QIVRSFSSGKREGGAFISATLSPRGEFIYCAGEDQVLYCFSV 467          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Zebrafish
Match: rbbp5 (retinoblastoma binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-886])

HSP 1 Score: 490.73 bits (1262), Expect = 1.340e-169
Identity = 261/498 (52.41%), Postives = 342/498 (68.67%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQ---------KDNRNIDFVEVVTR---KRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNK 1464
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+SWSRD  KL+SASTDN +S WD++TGD  + FR P P+LK+Q+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VA+FDRRG YIYTGN+KGK+ + N+    +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W++CCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI A  SSDEE E    +  L   PE+E PE+            N + D     T    K+     + +P  KK +   I+L    +DEVHPL+  +  +K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLSWSRDGHKLVSASTDNIVSQWDVLTGDCDQRFRFPSPILKLQYHPRDMNKVLVCPMKSAPVLLTLSDSKHVVLPVDDDSDLNVVAAFDRRGEYIYTGNAKGKILVLNTDTQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKRCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIPAFCSSDEELEDYKALLYLPIAPEVEDPEENPFGPPPDATAQNASTDDGSTHTGPGDKKRHPSADGAPPKKKIRTTTIELQGVPSDEVHPLLGVKGDSK 482          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 74.7146 bits (182), Expect = 3.357e-14
Identity = 65/288 (22.57%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSG----DGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            +++F+  G  +A    D  I+IW     +  K IS H   +  V+WS DS  L+SAS D  + IWD+ +G  L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D  ++++           D      L+      + + C F+      G++I +GS + + +Y+W   +  +V+ L G   + ++    HP   +I S +
Sbjct:   50 SVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW-----------DYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS-EDNMVYIWNLQTKEIVQKLQGHT-DVVISTACHPTENIIASAA 320          

HSP 2 Score: 62.003 bits (149), Expect = 6.198e-10
Identity = 49/173 (28.32%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    I A+F    G +I +G+    V I+N Q  ++V+  +
Sbjct:  129 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Zebrafish
Match: wdr44 (WD repeat domain 44 [Source:NCBI gene;Acc:569045])

HSP 1 Score: 68.9366 bits (167), Expect = 8.416e-12
Identity = 72/306 (23.53%), Postives = 116/306 (37.91%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIW------DYCTRRMIKY---------------------------------------------ISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIV--ASFDRRGTYIYTGNSKGKVTIYNSQNLQV-----VRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLW 882
            T++F+ CG L+A    D  + IW      DY     IKY                                                H   +  +SWS++   LLS+S D  + +W I   + L  F+    V  + FHPRD    L   L    + L  +  ++  L  E D    ++  A+F + G Y   G   G+   Y+++ L+      VR+ R  N     I  IE        L+   D  IR+Y+ +D++         S++ +  V  +   K  FS D  YI +GS  ++ +Y+W
Sbjct:  253 TMKFSHCGRLLATAGQDNIVRIWVLKNAYDYFNNMRIKYNTEGRVSPSPSQESLCSSKSDTEGGVRDADTEDRNVPFRQVPFCKYKGHTADLLDLSWSKNYF-LLSSSMDKTVRLWHISRRECLCCFQHIDFVTAIAFHPRDDRYFLSGSL-DGKLRLWNIPDKKVALWNEVDGQTRLITAANFCQNGKYAVIGTYDGRCIFYDTERLKYHTQIHVRSTRGRNRVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSL--------SMKYKGYVNSSSQIKASFSHDYSYIVSGSEDKY-VYIW 547          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Zebrafish
Match: ahi1 (Abelson helper integration site 1 [Source:ZFIN;Acc:ZDB-GENE-060803-1])

HSP 1 Score: 68.5514 bits (166), Expect = 1.409e-11
Identity = 70/300 (23.33%), Postives = 128/300 (42.67%), Query Frame = 1
Query:  136 ITLQFNRCGNLIAIGCNDGR---IEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP--VLKVQFHPRDCTKILVCP----LRHAPVILNTVSYQRSILQFEDDNDLGI-VASFDRRGTYIYTGNSKGKVTIYNSQNL-----------QVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWR---KCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQ-KGETLLDVVWHP 960
             TL F+  G  +A  C D     I I++  + +++   + H+  V  + WSRD + LL+AS+D  + +W++     L    LP P  V   +FHP+  + +        LR   V +  V+ Q  +LQ  D +   I    FD  G+ +++ ++ G + ++ ++ +            + R  +  +    SI S+E    G   LI+  D V+RV + +             L ++  +   ++R      F+  G +I AGS +    Y+W   +G  V +         L  V +HP
Sbjct:  550 FTLCFSHDGRALAAACADRDAFPIIIYEIPSGKVLSSFNGHLSVVYDLCWSRDDKGLLTASSDGTVRVWNVERLQTLAHKTLPHPSFVYCAKFHPQAQSLVATGGYDGVLRVWNVDVQDVNGQ--LLQEFDGHKTFINTLCFDPEGSRMFSADNSGLIIVWGTKVMPGSRRGATSQWSIEREIKEADLNGISINSLEVHPNGRRLLIHAKDSVLRVMDLR------------ILAVKKYIGATNYRDRINSTFTPCGSFIFAGS-EDGLAYVWNSETGDQVAVYSELCYSSALRAVAFHP 834          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Zebrafish
Match: ahi1 (Abelson helper integration site 1 [Source:ZFIN;Acc:ZDB-GENE-060803-1])

HSP 1 Score: 68.5514 bits (166), Expect = 1.423e-11
Identity = 70/300 (23.33%), Postives = 128/300 (42.67%), Query Frame = 1
Query:  136 ITLQFNRCGNLIAIGCNDGR---IEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP--VLKVQFHPRDCTKILVCP----LRHAPVILNTVSYQRSILQFEDDNDLGI-VASFDRRGTYIYTGNSKGKVTIYNSQNL-----------QVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWR---KCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQ-KGETLLDVVWHP 960
             TL F+  G  +A  C D     I I++  + +++   + H+  V  + WSRD + LL+AS+D  + +W++     L    LP P  V   +FHP+  + +        LR   V +  V+ Q  +LQ  D +   I    FD  G+ +++ ++ G + ++ ++ +            + R  +  +    SI S+E    G   LI+  D V+RV + +             L ++  +   ++R      F+  G +I AGS +    Y+W   +G  V +         L  V +HP
Sbjct:  550 FTLCFSHDGRALAAACADRDAFPIIIYEIPSGKVLSSFNGHLSVVYDLCWSRDDKGLLTASSDGTVRVWNVERLQTLAHKTLPHPSFVYCAKFHPQAQSLVATGGYDGVLRVWNVDVQDVNGQ--LLQEFDGHKTFINTLCFDPEGSRMFSADNSGLIIVWGTKVMPGSRRGATSQWSIEREIKEADLNGISINSLEVHPNGRRLLIHAKDSVLRVMDLR------------ILAVKKYIGATNYRDRINSTFTPCGSFIFAGS-EDGLAYVWNSETGDQVAVYSELCYSSALRAVAFHP 834          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Xenopus
Match: alg2 (ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xenbase;Acc:XB-GENE-494529])

HSP 1 Score: 486.878 bits (1252), Expect = 3.407e-168
Identity = 262/494 (53.04%), Postives = 341/494 (69.03%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXK-QIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEV--------VTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNK 1464
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S+WD+++GD  + FR P P+LKVQFHPRD  ++LVCP++ APV+L        +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  +    +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK + +      AED EVD+ +++PI+A  SSDE+ E    +  L   PE+E PE+       D V++          +KR  S   + P  KK K   ID+     DEVHPL+  +  +K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGDCDQRFRFPSPILKVQFHPRDQNRVLVCPMKSAPVMLTLSDSSHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTNTQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGGDAAEDEEVDVTSVDPIAAFCSSDEDLEDTKALLYLPIAPEVEDPEENPYGPPPDAVQMSLSEDGVATDKKRQASSDGVQPPKKKPKTTTIDIQGVPNDEVHPLLGVKGDSK 478          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Xenopus
Match: alg2 (ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xenbase;Acc:XB-GENE-494529])

HSP 1 Score: 478.789 bits (1231), Expect = 1.731e-164
Identity = 257/490 (52.45%), Postives = 336/490 (68.57%), Query Frame = 1
Query:   31 LLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXK-QIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEV--------VTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNK 1464
             LE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S+WD+++GD  + FR P P+LKVQFHPRD  ++LVCP++ APV+L        +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  +    +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK + +      AED EVD+ +++PI+A  SSDE+ E    +  L   PE+E PE+       D V++          +KR  S   + P  KK K   ID+     DEVHPL+  +  +K
Sbjct:    5 FLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGDCDQRFRFPSPILKVQFHPRDQNRVLVCPMKSAPVMLTLSDSSHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTNTQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGGDAAEDEEVDVTSVDPIAAFCSSDEDLEDTKALLYLPIAPEVEDPEENPYGPPPDAVQMSLSEDGVATDKKRQASSDGVQPPKKKPKTTTIDIQGVPNDEVHPLLGVKGDSK 478          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Xenopus
Match: alg2 (ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xenbase;Acc:XB-GENE-494529])

HSP 1 Score: 477.248 bits (1227), Expect = 2.246e-164
Identity = 257/490 (52.45%), Postives = 336/490 (68.57%), Query Frame = 1
Query:   31 LLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXK-QIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEV--------VTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNK 1464
             LE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S+WD+++GD  + FR P P+LKVQFHPRD  ++LVCP++ APV+L        +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  +    +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK + +      AED EVD+ +++PI+A  SSDE+ E    +  L   PE+E PE+       D V++          +KR  S   + P  KK K   ID+     DEVHPL+  +  +K
Sbjct:    5 FLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGDCDQRFRFPSPILKVQFHPRDQNRVLVCPMKSAPVMLTLSDSSHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTNTQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGGDAAEDEEVDVTSVDPIAAFCSSDEDLEDTKALLYLPIAPEVEDPEENPYGPPPDAVQMSLSEDGVATDKKRQASSDGVQPPKKKPKTTTIDIQGVPNDEVHPLLGVKGDSK 478          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Xenopus
Match: alg2 (ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xenbase;Acc:XB-GENE-494529])

HSP 1 Score: 477.248 bits (1227), Expect = 2.637e-164
Identity = 257/490 (52.45%), Postives = 336/490 (68.57%), Query Frame = 1
Query:   31 LLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXK-QIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEV--------VTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNK 1464
             LE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S+WD+++GD  + FR P P+LKVQFHPRD  ++LVCP++ APV+L        +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  +    +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK + +      AED EVD+ +++PI+A  SSDE+ E    +  L   PE+E PE+       D V++          +KR  S   + P  KK K   ID+     DEVHPL+  +  +K
Sbjct:    5 FLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGDCDQRFRFPSPILKVQFHPRDQNRVLVCPMKSAPVMLTLSDSSHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTNTQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGGDAAEDEEVDVTSVDPIAAFCSSDEDLEDTKALLYLPIAPEVEDPEENPYGPPPDAVQMSLSEDGVATDKKRQASSDGVQPPKKKPKTTTIDIQGVPNDEVHPLLGVKGDSK 478          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Xenopus
Match: alg2 (ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xenbase;Acc:XB-GENE-494529])

HSP 1 Score: 477.633 bits (1228), Expect = 4.613e-164
Identity = 257/490 (52.45%), Postives = 336/490 (68.57%), Query Frame = 1
Query:   31 LLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXK-QIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEV--------VTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNK 1464
             LE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S+WD+++GD  + FR P P+LKVQFHPRD  ++LVCP++ APV+L        +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  +    +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK + +      AED EVD+ +++PI+A  SSDE+ E    +  L   PE+E PE+       D V++          +KR  S   + P  KK K   ID+     DEVHPL+  +  +K
Sbjct:    5 FLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGDCDQRFRFPSPILKVQFHPRDQNRVLVCPMKSAPVMLTLSDSSHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTNTQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGGDAAEDEEVDVTSVDPIAAFCSSDEDLEDTKALLYLPIAPEVEDPEENPYGPPPDAVQMSLSEDGVATDKKRQASSDGVQPPKKKPKTTTIDIQGVPNDEVHPLLGVKGDSK 478          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Mouse
Match: Rbbp5 (retinoblastoma binding protein 5, histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1918367])

HSP 1 Score: 495.352 bits (1274), Expect = 5.305e-171
Identity = 269/517 (52.03%), Postives = 350/517 (67.70%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD+++GD  + FR P P+LKVQ+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V          + K+ QS  + S P  KK K   I+L     DEVHPL+  +   K      +KK  + R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVPSSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGK------SKKKQAGRPKGSKGKEK 495          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Mouse
Match: Rbbp5 (retinoblastoma binding protein 5, histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1918367])

HSP 1 Score: 495.352 bits (1274), Expect = 5.367e-171
Identity = 269/517 (52.03%), Postives = 350/517 (67.70%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD+++GD  + FR P P+LKVQ+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V          + K+ QS  + S P  KK K   I+L     DEVHPL+  +   K      +KK  + R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVPSSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGK------SKKKQAGRPKGSKGKEK 495          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Mouse
Match: Rbbp5 (retinoblastoma binding protein 5, histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1918367])

HSP 1 Score: 322.398 bits (825), Expect = 1.173e-105
Identity = 190/379 (50.13%), Postives = 247/379 (65.17%), Query Frame = 1
Query:  436 LRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCT-NTANS-SIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMKK 1536
            ++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR T  T+N+ +IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V          + K+ QS  + S P  KK K   I+L     DEVHPL           LGV     S + Q  R K  K
Sbjct:    1 MKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVPSSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPL-----------LGVKGDGKSKKKQAGRPKGSK 364          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Mouse
Match: Rbbp5 (retinoblastoma binding protein 5, histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1918367])

HSP 1 Score: 323.168 bits (827), Expect = 1.609e-105
Identity = 188/378 (49.74%), Postives = 250/378 (66.14%), Query Frame = 1
Query:  436 LRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCT-NTANS-SIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            ++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR T  T+N+ +IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V          + K+ QS  + S P  KK K   I+L     DEVHPL+  +   K      +KK  + R +  + K K
Sbjct:    1 MKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVPSSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGK------SKKKQAGRPKGSKGKEK 368          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Mouse
Match: Rbbp5 (retinoblastoma binding protein 5, histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1918367])

HSP 1 Score: 201.445 bits (511), Expect = 4.989e-62
Identity = 90/148 (60.81%), Postives = 115/148 (77.70%), Query Frame = 1
Query:  133 AITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGK 576
            A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD+++GD  + FR P P+LKVQ+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK
Sbjct:    2 ALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGK 149          
BLAST of Retinoblastoma-binding protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q9VPH8|RBBP5_DROME (Retinoblastoma-binding protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=Rbbp5 PE=1 SV=2)

HSP 1 Score: 495.352 bits (1274), Expect = 5.888e-171
Identity = 261/507 (51.48%), Postives = 354/507 (69.82%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFR--CTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKD-KNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQ----SETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQR 1515
            MNLELLE+F QNYPE  DG L+            C + A+T  FN+ G L+A+GCNDGRI IWD+ TR + K ISAHVHPVCS+SW+R+  KLLSASTDN++ IWD++TG+    +R P PVLKVQF PR+  ++LVCP+R+A V++      R  L  + D DL IVASFDRRG +IYTGN+KGK+ + + +  +VV +FR     ++ +++KSIEF+RRG+ FLIN +DRVIRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYICAGS +QH++Y+WE+S G LVKILHG KGE LLDVVWHP+RP+I S+S+ +    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDI DEDK +D   D +  E+IEVD++ +EP++A  SSDEE E  + +  L   PE+E PED    ++      V    ++     +  M+ K ++ ++ ++ LP+A  DE HPL+SS K +K  Q  V  K ++ R ++
Sbjct:    1 MNLELLESFGQNYPEEFDGSLD------------CISLAVTCAFNKYGTLLAVGCNDGRIVIWDFLTRGIAKIISAHVHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGELEHKYRFPSPVLKVQFDPRNDNRLLVCPMRYAAVLVEVGGTHRC-LPLDSDGDLNIVASFDRRGKHIYTGNAKGKILVLDVETFEVVASFRIIVGTSSATAVKSIEFARRGDAFLINTSDRVIRVYDSKEIITLGKDGEPEPIQKLQDLVNKTTWKKCCFSGDGEYICAGSARQHALYIWEKSIGNLVKILHGTKGELLLDVVWHPVRPIIASISSGL----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIADEDKSVDLNADAQQDEEIEVDVQKVEPVAAFCSSDEEGEDENALQFLPMAPEVEDPEDGWTGQDGLEPSAVMLGHMEPHDYEDDIMASKRRRMQLYDVSLPDAPTDETHPLISS-KASKDKQQPVGGKKAAGRTKK 489          
BLAST of Retinoblastoma-binding protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q15291|RBBP5_HUMAN (Retinoblastoma-binding protein 5 OS=Homo sapiens OX=9606 GN=RBBP5 PE=1 SV=2)

HSP 1 Score: 496.508 bits (1277), Expect = 1.279e-170
Identity = 269/517 (52.03%), Postives = 351/517 (67.89%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD+++GD  + FR P P+LKVQ+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V+         + K+ QS  + S P  KK K   I+L     DEVHPL+  +   K      +KK  + R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGK------SKKKQAGRPKGSKGKEK 495          
BLAST of Retinoblastoma-binding protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q8BX09|RBBP5_MOUSE (Retinoblastoma-binding protein 5 OS=Mus musculus OX=10090 GN=Rbbp5 PE=1 SV=2)

HSP 1 Score: 495.352 bits (1274), Expect = 3.754e-170
Identity = 269/517 (52.03%), Postives = 350/517 (67.70%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVE-------VVTRKRLQSETEMS-PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD+++GD  + FR P P+LKVQ+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VASFDRRG YIYTGN+KGK+ +  + +  +V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W+KCCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ +++PI+A  SSDEE E    +  L   PE+E PE+       D V          + K+ QS  + S P  KK K   I+L     DEVHPL+  +   K      +KK  + R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVPSSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGK------SKKKQAGRPKGSKGKEK 495          
BLAST of Retinoblastoma-binding protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q09309|RBBP5_CAEEL (Retinoblastoma-binding protein homolog 5 OS=Caenorhabditis elegans OX=6239 GN=rbbp-5 PE=3 SV=3)

HSP 1 Score: 268.085 bits (684), Expect = 9.334e-83
Identity = 147/408 (36.03%), Postives = 228/408 (55.88%), Query Frame = 1
Query:   25 LELLE-AFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFE---DDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXX-XXXXXXXXXXXXXKQIDTEKDKNAEDIEVDIETIEPISALLSSDEEN 1233
            +E+L+  +   +PE  + HL     D  +  ++C       +FNR G+++A+GC DGR+ I+D+ TR + +  SAH  PV  +SWSRD RKLL++S DN I+++D++ G  L   R    V    FHPR+  K +V  +   P +       +++L  +     ++     S+DR+G YI  G  KGK+ IYN++ L+ V    C       I+ I    +    + N  DRVIR Y  +D+        +   ++ D+V    W+  C   DG Y+C  S K HS+Y+WE ++G+L+KILHG KGE LLDV WHP RP+I+S++       VS+W Q  V+NWSAFAP+F+EL+EN +Y E+       +++  +  T K ++AED  +D+  + P   L SSDEE+
Sbjct:    2 VEILDRTYGAQFPEELECHL-----DLQNASANCC------KFNRWGSIVAVGCTDGRVLIYDFMTRNIARTFSAHCLPVSCLSWSRDGRKLLTSSADNSIAMFDVLAGTLLHRIRFNSMVTFAMFHPRNDNKAIVLQVNKQPTVEQFSPRIQTVLANDTPGSSDESASCVSYDRKGKYIIAGTGKGKLLIYNAETLKCVAW--CKQNTVQQIRQIIVPMKSRFIITNTQDRVIRTYELEDLLHQRGQMVEAKYKVLDMVNKAAWKNVCTDSDGLYVCGASTKAHSLYIWESNTGSLIKILHGNKGEALLDVQWHPTRPIILSIAQGT----VSMWTQAHVENWSAFAPEFQELEENEKYIEKENEFDMEDEDADEDMTSKSQDAEDDIIDVVNVRPEDYLASSDEED 392          
BLAST of Retinoblastoma-binding protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q54MH6|RBBE_DICDI (Retinoblastoma-binding-like protein E OS=Dictyostelium discoideum OX=44689 GN=rbbE PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 8.759e-67
Identity = 133/385 (34.55%), Postives = 221/385 (57.40%), Query Frame = 1
Query:   19 MNLELLEAFHQ-NYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCND--GRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHA-PVILNTVSYQRSILQFE---------DDNDLGIV--------------ASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQ--HSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENV 1086
            MNL L++ F Q + PE  + +L     D  + +S+CA+      FNR G L+A+GC    G+I +WD+ T+++++ +  H   V S+SWSR+ +KLL+AS D  + +WD+ T   L +  L  P+L  +FHPR+    L+   +   P++LN  S +++ L  +         ++N  G++              ASF+RRG  I+ G+S G +++ + +++ + R F+   ++N+++K IEFSR     L++ +D+V+R+ + +              + +D V   HW+KCCFS + EY+  G   +  HSI++W   SG+LVK L G K E L+DVVWHPLRP+IVS+S +     + +W     +NWS+FAPDF+EL+EN+
Sbjct:    1 MNLCLIDPFKQSDVPETVEYYL----VDPKNIKSNCAS------FNRRGTLLAVGCASPIGKILVWDFDTKKIVRTLYHHTGCVNSISWSRNGKKLLTASNDGSLVLWDLATSKILYSLELESPILFAEFHPRNNDLCLIVLQKGTDPILLNFKSSEKTPLNIKSLVTSYIKREENSTGVIPTSVNSNYNGVATFASFNRRGEKIFFGDSCGMISVLDFKSMTIDRQFKVA-SSNTTVKQIEFSRNHRFMLVSSSDKVLRLISLESTNLYQQM-----REYQDSVNRMHWKKCCFSSNNEYVVGGMNHKSIHSIFIWS-VSGSLVKDLEGPK-EGLVDVVWHPLRPIIVSISFTGV---IYVWTAYFEENWSSFAPDFQELEENL 364          
BLAST of Retinoblastoma-binding protein 5 homolog vs. TrEMBL
Match: A0A0X9DCF1 (RBBP5 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1008.44 bits (2606), Expect = 0.000e+0
Identity = 504/506 (99.60%), Postives = 504/506 (99.60%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMKK 1536
            MNLELL AFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQ HPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDIEDEDKQIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMKK
Sbjct:    1 MNLELLGAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQCHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDIEDEDKQIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMKK 506          
BLAST of Retinoblastoma-binding protein 5 homolog vs. TrEMBL
Match: A0A0X3PLV1 (Retinoblastoma-binding protein 5 homolog OS=Schistocephalus solidus OX=70667 GN=RBBP5 PE=4 SV=1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 323/517 (62.48%), Postives = 406/517 (78.53%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTA-NSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKNAE-DIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKIC------------EIDLPNASADEVHPLVSSRKQNKLGQLGVNKKF---SSSRGQRD 1518
            MNLELLEAFHQNYPEA DGHLERIKKDE  K+S CAT+ +TLQFNR G+LIAIGCNDGR+EIWD+ TRR+ K + AH HPVCS+SWSR+SR+LLSASTDN +S+W++ITGD  +TF  PCPV+KVQF+PR  T++LVCPLRH PV++ T +   +I+  EDDND  IVAS+DRRG  IY+GNSKGKV IY+S+ L+++ +FR T TA N+++KSIEFSRRG+ FL+NCADR+IRVYNC D   +  +DP+P  +LRD+VTG+HWRKCCFSGDGE+ICAGSMKQHSIY+WER+SGTLVKILHGQKGETLLDVVWHPLRP++VS+SNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFD+EDEDK+ + EKD   E D+ +++E IEP++A+LSSDEE EP D++  LS +P+++ P++       D    V    L+  ++ SP +K+ +               IDLP+A +DE+HPL+ S+KQ      G N  +   S+  G+ D
Sbjct:   33 MNLELLEAFHQNYPEAADGHLERIKKDEPGKDSGCATFVVTLQFNRAGSLIAIGCNDGRVEIWDFITRRIAKILVAHSHPVCSLSWSRNSRQLLSASTDNSVSVWNVITGDCEKTFTFPCPVMKVQFNPRKSTEVLVCPLRHPPVLIETDTGTPTIIHPEDDNDFSIVASYDRRGARIYSGNSKGKVCIYDSKTLKLINSFRSTMTATNAAVKSIEFSRRGDFFLLNCADRIIRVYNCSDAIES--SDPEPVQKLRDLVTGHHWRKCCFSGDGEFICAGSMKQHSIYIWERASGTLVKILHGQKGETLLDVVWHPLRPIVVSISNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDVEDEDKK-EVEKDDGVEQDVIIEVERIEPVAAMLSSDEETEPEDVLMFLSISPDVDNPDELSGGE--DSNPAVAGDSLRKHSDQSPPSKRGRTAASGGASVPTRSFSIDLPDAPSDEIHPLLGSKKQMGKTYAGNNCSYGGGSTGAGKAD 544          
BLAST of Retinoblastoma-binding protein 5 homolog vs. TrEMBL
Match: A0A3Q0KNK7 (Putative retinoblastoma binding protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 329/524 (62.79%), Postives = 401/524 (76.53%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKNAEDIE---------------VDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPED--------QKDNRNIDFVEVVTRKRLQSETEMS--PKTKKRK----------ICEIDLPNASADEVHPLVSSRKQNKLGQLGVN 1485
            MNLELLEAFHQNYPEA DG+LERIKKD+ SK++ CATYAITLQFNR G+L+AIGCNDGRIEIWD+ TRR+ K + AH HPVCS+SWSRDS++LLSASTDN +SIW++++    +TF+ PCPV+KVQF+ R   ++LVCP+RHAPV++N  S   +I+Q ED+NDL IVAS+DRRG YIYTGNSKGKV IY +++ Q++ +F+ T+ AN++IKSIEF+RRGE FL+NCADRVIRVYNC+D      TDP+P  +L+D+VTG+HWRKCCFSGDGEYICAGSMKQHSIYLWER+SGTLVKILHGQKGETLLDVVWHPLRP+IVS+SNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFD+EDEDK I  E++KNA  ++               +DIET+EP+ ALLSSDE+ E  D++  LS +PE++ P+D           N       +  RKR  S +  S  P +K  K             I LP A +DEVHPLV +RKQ+     G N
Sbjct:    1 MNLELLEAFHQNYPEAADGYLERIKKDDGSKDAGCATYAITLQFNRVGSLLAIGCNDGRIEIWDHVTRRISKVLVAHAHPVCSLSWSRDSKRLLSASTDNTVSIWNVLSSACEQTFQFPCPVMKVQFNARKPDQLLVCPMRHAPVVINIPSGAPTIVQPEDENDLSIVASYDRRGRYIYTGNSKGKVCIYETKDFQLISSFKSTSAANAAIKSIEFARRGEYFLLNCADRVIRVYNCEDALNANVTDPEPIKKLKDLVTGSHWRKCCFSGDGEYICAGSMKQHSIYLWERASGTLVKILHGQKGETLLDVVWHPLRPIIVSISNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDVEDEDKMI--EENKNAISLKSLHTKCYNDEEEDVEIDIETMEPVQALLSSDEDEECEDILMYLSISPEVDNPDDLSGGEESVSTQNSERPTTGLSNRKRPDSPSMQSNGPLSKHSKSLDQNQSIPPTVSIHLPGAQSDEVHPLVGNRKQSVKSISGTN 522          
BLAST of Retinoblastoma-binding protein 5 homolog vs. TrEMBL
Match: A0A5K4EQJ9 (Putative retinoblastoma binding protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 328/510 (64.31%), Postives = 400/510 (78.43%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQI-DTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPED--------QKDNRNIDFVEVVTRKRLQSETEMS--PKTKKRK----------ICEIDLPNASADEVHPLVSSRKQNKLGQLGVN 1485
            MNLELLEAFHQNYPEA DG+LERIKKD+ SK++ CATYAITLQFNR G+L+AIGCNDGRIEIWD+ TRR+ K + AH HPVCS+SWSRDS++LLSASTDN +SIW++++    +TF+ PCPV+KVQF+ R   ++LVCP+RHAPV++N  S   +I+Q ED+NDL IVAS+DRRG YIYTGNSKGKV IY +++ Q++ +F+ T+ AN++IKSIEF+RRGE FL+NCADRVIRVYNC+D      TDP+P  +L+D+VTG+HWRKCCFSGDGEYICAGSMKQHSIYLWER+SGTLVKILHGQKGETLLDVVWHPLRP+IVS+SNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFD+EDEDK I + + +   ED+E+DIET+EP+ ALLSSDE+ E  D++  LS +PE++ P+D           N       +  RKR  S +  S  P +K  K             I LP A +DEVHPLV +RKQ+     G N
Sbjct:    1 MNLELLEAFHQNYPEAADGYLERIKKDDGSKDAGCATYAITLQFNRVGSLLAIGCNDGRIEIWDHVTRRISKVLVAHAHPVCSLSWSRDSKRLLSASTDNTVSIWNVLSSACEQTFQFPCPVMKVQFNARKPDQLLVCPMRHAPVVINIPSGAPTIVQPEDENDLSIVASYDRRGRYIYTGNSKGKVCIYETKDFQLISSFKSTSAANAAIKSIEFARRGEYFLLNCADRVIRVYNCEDALNANVTDPEPIKKLKDLVTGSHWRKCCFSGDGEYICAGSMKQHSIYLWERASGTLVKILHGQKGETLLDVVWHPLRPIIVSISNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDVEDEDKMIEENKNNDEEEDVEIDIETMEPVQALLSSDEDEECEDILMYLSISPEVDNPDDLSGGEESVSTQNSERPTTGLSNRKRPDSPSMQSNGPLSKHSKSLDQNQSIPPTVSIHLPGAQSDEVHPLVGNRKQSVKSISGTN 510          
BLAST of Retinoblastoma-binding protein 5 homolog vs. TrEMBL
Match: A0A068YGU4 (Wd40 repeat OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000910100 PE=4 SV=1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 313/490 (63.88%), Postives = 388/490 (79.18%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTA-NSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKR-KICE------------IDLPNASADEVHPLVS 1446
            MNLELLEAFHQNYPEA DGHLERIKKDE      CAT+ +T+QFNR G+L+A+GCNDGRIEIWD+ TRR+ K I AH HPVCS+SWSR+SR+LLSASTDN +SIW+I+TGD    F  PCPV+KVQF+PR+  ++LVCPLRH PV+++ ++ +  IL+ E++ND  +VAS+DRRGT+IYTGNS+GKV IY+++ L+VV  FR  +TA N++IKSIEF+RRG+ FL+NCADR IR+YNC D   +  ++P+P  +LRD+VTG+HWRKCCFSGDGE++CAGSMKQHSIY+WER+SGTL KILHGQKGETLLDVVWHPLRP+IVS+SNS+TKEQ+SIWAQTQVQNWSAFAPDFKELDENVEYEERESEFD+EDEDK  D + D   +DI VD+ET+EP++ALLSSDEE EP D++  LS +PE++ P++         V       +Q  +  SP T KR KI E            IDLP+A  DEVHPLV 
Sbjct:    1 MNLELLEAFHQNYPEAADGHLERIKKDE---SGGCATFVVTIQFNRPGSLVAVGCNDGRIEIWDFVTRRIAKIIVAHSHPVCSISWSRNSRQLLSASTDNTVSIWNIVTGDCERIFTFPCPVMKVQFNPRNPAELLVCPLRHPPVLIDVITGKPIILKQEEENDPSVVASYDRRGTHIYTGNSRGKVCIYDTKTLKVVNQFRSISTATNAAIKSIEFARRGDFFLLNCADRFIRIYNCSDALES--SEPEPLQKLRDLVTGSHWRKCCFSGDGEFVCAGSMKQHSIYIWERASGTLFKILHGQKGETLLDVVWHPLRPIIVSVSNSITKEQISIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDLEDEDKVEDEKPDDVEQDIIVDVETVEPVAALLSSDEEREPDDILMFLSISPEVDNPDELSGGEEQSSVPA----EVQKPSGASPTTSKRAKISEKAAPSQPSQTYTIDLPDAPVDEVHPLVG 481          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Cavefish
Match: rbbp5 (retinoblastoma binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-886])

HSP 1 Score: 489.574 bits (1259), Expect = 3.479e-168
Identity = 266/522 (50.96%), Postives = 352/522 (67.43%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTANS-SIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLS--SDEENEPVDLIFLLSTTPEIEQPED-----------QKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD++TGD  + FR P P+LK+Q+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VA+FDRRG YIYTGN+KGK+ + N+    +V +FR  T T+NS +IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W++CCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   N AED EVD+ +++PI A  S  SDEE E    +  L   PE+E PE+           Q  + +        +K+ Q   + +P  KK +   I+L    +DEVHPL+  +  +K      +KK ++ R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLTGDCDQRFRFPSPILKLQYHPRDADKVLVCPMKSAPVLLTLSDSKHVVLPVDDDSDLNVVAAFDRRGEYIYTGNAKGKILVLNTDTQDLVASFRVTTGTSNSTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKRCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGANAAEDEEVDVTSVDPIPAFCSSFSDEELEDHKALLYLPIAPEVEDPEENPFGPPPDGGGQNPSEDGSAHTGGDKKQRQPSADGAPPKKKARTTTIELQGVPSDEVHPLLGVKGDSK------SKKKTAGRPKGTKGKEK 500          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Cavefish
Match: rbbp5 (retinoblastoma binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-886])

HSP 1 Score: 461.455 bits (1186), Expect = 5.459e-158
Identity = 249/484 (51.45%), Postives = 332/484 (68.60%), Query Frame = 1
Query:  133 AITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTANS-SIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLS--SDEENEPVDLIFLLSTTPEIEQPED-----------QKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD++TGD  + FR P P+LK+Q+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VA+FDRRG YIYTGN+KGK+ + N+    +V +FR  T T+NS +IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W++CCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   N AED EVD+ +++PI A  S  SDEE E    +  L   PE+E PE+           Q  + +        +K+ Q   + +P  KK +   I+L    +DEVHPL+  +  +K      +KK ++ R +  + K K
Sbjct:    2 ALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLTGDCDQRFRFPSPILKLQYHPRDADKVLVCPMKSAPVLLTLSDSKHVVLPVDDDSDLNVVAAFDRRGEYIYTGNAKGKILVLNTDTQDLVASFRVTTGTSNSTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKRCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGANAAEDEEVDVTSVDPIPAFCSSFSDEELEDHKALLYLPIAPEVEDPEENPFGPPPDGGGQNPSEDGSAHTGGDKKQRQPSADGAPPKKKARTTTIELQGVPSDEVHPLLGVKGDSK------SKKKTAGRPKGTKGKEK 475          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Cavefish
Match: rbbp5 (retinoblastoma binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-886])

HSP 1 Score: 461.07 bits (1185), Expect = 1.750e-157
Identity = 249/484 (51.45%), Postives = 332/484 (68.60%), Query Frame = 1
Query:  133 AITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTANS-SIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLS--SDEENEPVDLIFLLSTTPEIEQPED-----------QKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD++TGD  + FR P P+LK+Q+HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VA+FDRRG YIYTGN+KGK+ + N+    +V +FR  T T+NS +IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W++CCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   N AED EVD+ +++PI A  S  SDEE E    +  L   PE+E PE+           Q  + +        +K+ Q   + +P  KK +   I+L    +DEVHPL+  +  +K      +KK ++ R +  + K K
Sbjct:    2 ALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLTGDCDQRFRFPSPILKLQYHPRDADKVLVCPMKSAPVLLTLSDSKHVVLPVDDDSDLNVVAAFDRRGEYIYTGNAKGKILVLNTDTQDLVASFRVTTGTSNSTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKRCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGANAAEDEEVDVTSVDPIPAFCSSFSDEELEDHKALLYLPIAPEVEDPEENPFGPPPDGGGQNPSEDGSAHTGGDKKQRQPSADGAPPKKKARTTTIELQGVPSDEVHPLLGVKGDSK------SKKKTAGRPKGTKGKEK 475          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 75.0998 bits (183), Expect = 2.391e-14
Identity = 65/288 (22.57%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSG----DGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            +++F+  G  +A    D  I+IW     +  K IS H   +  V+WS DS  L+SAS D  + IWD+ +G  L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D  ++++           D      L+      + + C F+      G++I +GS + + +Y+W   +  +V+ L G   + ++    HP   +I S +
Sbjct:   50 SVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW-----------DYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS-EDNMVYIWNLQTKEIVQKLQGHT-DVVISTACHPTENIIASAA 320          

HSP 2 Score: 62.003 bits (149), Expect = 4.548e-10
Identity = 49/173 (28.32%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    I A+F    G +I +G+    V I+N Q  ++V+  +
Sbjct:  129 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 74.3294 bits (181), Expect = 4.215e-14
Identity = 65/288 (22.57%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSG----DGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            +++F+  G  +A    D  I+IW     +  K +S H   +  V+WS DS  L+SAS D  + IWD+ +G  L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   +++S + Q ++T    +  N  +  ++FS  G+  L    D  ++++           D      L+      + + C F+      G++I +GS + H +Y+W   +  +V+ L G   + ++    HP   +I S +
Sbjct:   47 SVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQ--SNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW-----------DYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGS-EDHMVYIWNLQTKEIVQKLQGH-ADVVIATACHPSENIIASAA 317          

HSP 2 Score: 58.5362 bits (140), Expect = 5.591e-9
Identity = 46/173 (26.59%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NL+  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    +WD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    + A+F    G +I +G+    V I+N Q  ++V+  +
Sbjct:  126 SNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQ 295          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Sea Lamprey
Match: rbbp5 (retinoblastoma binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-886])

HSP 1 Score: 455.677 bits (1171), Expect = 2.449e-156
Identity = 252/492 (51.22%), Postives = 328/492 (66.67%), Query Frame = 1
Query:   37 EAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRG---ECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKNA-EDIEVDIETIEPISALLSSDEENE--------PVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKR-LQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNK 1464
            E+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI +WD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S+WD+++GD  + FR P P+LKVQFHPRD  ++LVCP++ APV+L     +   L  +DD+DL IVASFDRRG Y+YTGN+KGK+ +  +    +V +FR  T T+N ++IKSIEF+R+G    CFLIN ADR+IRVY+  ++   G D +P+P  +L+D+V    W+KCCFSGDGEYICAGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK        +A ED EVD+ +++PI+   SSDEE E        P+              P D       D      +KR   SE  +SPK KK K   ++L   + +E+HPL+  +   K
Sbjct:   18 ESFGQNYPEEADGTLD------------CISMALTCAFNRRGTLLAVGCNDGRIVVWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGDCEQRFRFPVPILKVQFHPRDPNRVLVCPMKSAPVLLTLSDSKHVCLPVDDDSDLNIVASFDRRGEYMYTGNAKGKILVLKTDTQDLVASFRVTTGTSNTTAIKSIEFARKGRNSSCFLINTADRIIRVYDSLEILTCGKDGEPEPIQKLQDLVNRTPWKKCCFSGDGEYICAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEMTGADALEDEEVDVTSVDPIATFCSSDEETEDSHALLYLPISPEVEEPEENPYGPPPDALSTPGADEPSSQDKKRPASSEGPLSPKKKKTKTTNVELQGVAPEELHPLLCVKGDGK 493          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 73.559 bits (179), Expect = 1.713e-14
Identity = 61/289 (21.11%), Postives = 126/289 (43.60%), Query Frame = 1
Query:  145 QFNRCGNLIAIGCNDGRIEIWD-YCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGN------HWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSN 990
            +F+  GN +A    D  I +W+ Y       ++  H   +  + +S D   + ++STD  + +WD  TG+ ++  +     +   F  R   +++        V L     + S+  F++     +  +F+     I +G     + +++ +  +++ T +     N S+  +  S  G   L N  D  +R+++ +           P  +   I  GN      +  KC +S DG  + AGS  +  +Y+W+ +S  ++  L G  G ++ DV +HP  P+++S +N
Sbjct:   64 KFHPNGNTLASAGFDRTILMWNVYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTYQC-LSVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMK---GHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFA--------PMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRF-VYIWDTTSRRILYKLPGHAG-SVNDVAFHPEEPIVLSCAN 338          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Sea Lamprey
Match: thoc3 (THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14])

HSP 1 Score: 54.6842 bits (130), Expect = 2.140e-8
Identity = 30/99 (30.30%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  136 ITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVC 432
            I ++F+  G   A G  D  + +WD      ++ +S    PV ++S+S D + L SAS D+ I I D+ TG+ L       P   V +HP+       C
Sbjct:  199 ICIKFDPTGKYFATGSADALVSLWDANELTCVRCLSRLDWPVRTLSFSHDGKMLASASEDHFIDIADVDTGEKLWEVHCDSPTFTVAWHPKRPLLAFAC 297          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003168.1 (pep scaffold:Pmarinus_7.0:GL476396:632759:655100:1 gene:ENSPMAG00000002868.1 transcript:ENSPMAT00000003168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 3.699e-8
Identity = 29/90 (32.22%), Postives = 47/90 (52.22%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYIS---AHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQF 399
            +++F+  GN  A    DG+I I+D  + + +  +    AH   + +V WS DS +L+SAS D  + +WD+  G A  TF +   V   Q 
Sbjct:  194 SVRFSPNGNFFATAGADGQIFIYDGASGQKVSSLGGEKAHDGGIYAVCWSPDSTQLMSASGDRTVRLWDVAAGRATTTFTMGAEVNDQQL 283          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Sea Lamprey
Match: wdr36 (WD repeat domain 36 [Source:ZFIN;Acc:ZDB-GENE-030131-464])

HSP 1 Score: 49.2914 bits (116), Expect = 1.822e-6
Identity = 21/86 (24.42%), Postives = 47/86 (54.65%), Query Frame = 1
Query:  148 FNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHP 405
             +R   L+A+ C+D  + ++D   +++++ ++ H   +   ++S D R LL+AS D  +  WD+ +G  ++   +  PV+ +   P
Sbjct:  480 LHRDSGLLAVWCDDLSVLVFDVEIKKIVRVLNGHGAQITDATFSPDGRWLLTASMDRSVRTWDLPSGWYIDVLAVSSPVVSLSMSP 565          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Yeast
Match: SWD1 (Subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3 on lysine 4 and is required in transcriptional silencing near telomeres; WD40 beta propeller superfamily member with similarity to mammalian Rbbp7 [Source:SGD;Acc:S000000064])

HSP 1 Score: 147.517 bits (371), Expect = 1.356e-39
Identity = 103/334 (30.84%), Postives = 158/334 (47.31%), Query Frame = 1
Query:  142 LQFNRCGNLIAIGCNDGRIEIWDYCTRRMI----KYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIIT-GDALETFRLPCPVLKVQF---HPRDCTKIL-------VCPLRHAPVI-LNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGD-GEYICAGSM--KQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENV 1086
            LQF+ CG+ +A+GC +G + I+D  T R I      + AHV P+ S++WS D R LL++S D  I +WD+      L+  R   P+   Q+     R C   +       V    + PV  L + S ++ +    D   + +     +    I  G SKG +  Y   +L            +S+IK +  S+ GE   INC+DR IR Y       N   +     + +D++    W    FS +  EY+ A +     H +Y+WE +SGTLV++L G + E L+D+ W      IV  SN      V +W+      WSA APDF+E++ENV
Sbjct:   32 LQFSPCGDYLALGCANGALVIYDMDTFRPICVPGNMLGAHVRPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSKPLKEIRFDSPIWGCQWLDAKRRLCVATIFEESDAYVIDFSNDPVASLLSKSDEKQLSSTPDHGYVLVCTVHTKHPNIIIVGTSKGWLDFYKFHSLYQTECIHSLKITSSNIKHLIVSQNGERLAINCSDRTIRQYEISIDDENSAVELTLEHKYQDVINKLQWNCILFSNNTAEYLVASTHGSSAHELYIWETTSGTLVRVLEGAE-EELIDINWDFYSMSIV--SNGFESGNVYVWSVVIPPKWSALAPDFEEVEENV 362          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Yeast
Match: CDC40 (Pre-mRNA splicing factor; important for catalytic step II of pre-mRNA splicing and plays a role in cell cycle progression, particularly at the G1/S phase transition; required for DNA synthesis during mitosis and meiosis; has WD repeats; thermosensitivity of the cdc40 null mutant is functionally complemented by a chimeric construct containing the N-terminal 156 amino acids of yeast Cdc40p fused to the C-terminal two thirds (297 amino acids) of human CDC40 [Source:SGD;Acc:S000002772])

HSP 1 Score: 69.707 bits (169), Expect = 2.904e-13
Identity = 72/324 (22.22%), Postives = 133/324 (41.05%), Query Frame = 1
Query:   49 QNYPEAPDGHLERIKKDEVSKESSCATYAITLQF-NRCGNLIAIGCNDGRIEIWD-YCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVIL--NTVSYQRSILQFEDDNDLGIVA-SFDRRGTYIYTGNSKGKVTIYNSQ-NLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTK 1002
            +NYP  P+G                      L+F  + G+LI  G ND  I+IWD Y     ++    H  P+ ++ ++ D +  LS+S D  + IWD  TG       L      V+  P +  + +V  L ++ ++   + VS  + ++Q  D +   I+A  +   G+   + +    V I+ +Q N+ + +    ++TA  S+  +        F     D  I  ++ +   +       P    +   +  +     FSGDG YIC+G  K   ++ W+ ++  L+  +     + +  V WHP     V  S +  K
Sbjct:  156 RNYPGHPEG-------------------TTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVG-LSNSKILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQ---ISDTAQHSMPFLNVHPSQNYFCAQSMDNRIYSFSLKPKYKR-----HPKKIFKGHSSAGYGISLAFSGDGRYICSGDSKSR-LFTWDWNTSRLLNNIKIPGNKPITQVDWHPQETSKVICSGAAGK 450          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Yeast
Match: TIF34 (eIF3i subunit of the eukaryotic translation initiation factor 3 (eIF3); subunit of the core complex of eIF3; essential for translation; stimulates rate of ribosomal scanning during translation reinitiation; eIF3 is also involved in programmed stop codon readthrough [Source:SGD;Acc:S000004754])

HSP 1 Score: 55.4546 bits (132), Expect = 7.305e-9
Identity = 45/207 (21.74%), Postives = 85/207 (41.06%), Query Frame = 1
Query:  142 LQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHA---PVILNTVSYQRSILQFE---------------DDNDLGIVASFDRRGTYIYTGNSKGKVTIYN-SQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCAD 705
            +++N+ G+L+     D    +W       +  +  H   + S+     ++  ++ S D  I +WD+  G  + T++ P PV +V+F P  C    +  L +    P  +N    +R     E               +  D   VA +  +G YI  G+  GK++ Y+ S N + V +    +    SI  ++FS     F+ +  D
Sbjct:   16 VKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSP--CGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSI---DLHEKSISDMQFSPDLTYFITSSRD 217          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Yeast
Match: SWD3 (Essential subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3 on lysine 4 and is required in transcriptional silencing near telomeres; WD40 beta propeller superfamily member and ortholog of mammalian WDR5 [Source:SGD;Acc:S000000379])

HSP 1 Score: 53.9138 bits (128), Expect = 2.401e-8
Identity = 41/114 (35.96%), Postives = 51/114 (44.74%), Query Frame = 1
Query:   64 APDGHLERIKKDEVSKESSCATYA------------ITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWS-RDSRKLLSASTDNHISIWDIITGDALETF 366
            +PDG       D+ S E    +Y             I+L FNR GNL+     D  I+IWD     ++K ISAH   V SV     DS  L S S D  I I+D  TG  L+T 
Sbjct:   64 SPDGQCIATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTL 177          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Yeast
Match: LST8 (Protein required for the transport of Gap1p; required for the transport of amino acid permease Gap1p from the Golgi to the cell surface; component of the TOR signaling pathway; associates with both Tor1p and Tor2p; contains a WD-repeat [Source:SGD;Acc:S000004951])

HSP 1 Score: 53.5286 bits (127), Expect = 2.505e-8
Identity = 59/245 (24.08%), Postives = 103/245 (42.04%), Query Frame = 1
Query:  229 IKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCP----LRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIY------NSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNH---WRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQ 924
            +     H   V SVS+ +D+R ++++S D  I +WD+ +      ++   PV +V  HP    +++ C     +R   +  N  ++Q   L  EDD  L  + S    G+ +   N+KG   ++      ++ +L+ V  FR  +T    I  I  S   +      AD   RV++  D             +L   + G+    W  C FS D  Y+   S   H + LW+ S+  +V+   G 
Sbjct:   68 VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQ-GELISCDRDGNIRIWDLGENQCTHQ---LTPEDDTSLQSL-SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTY---ITRILLSSDVKHLATCSADHTARVWSIDD-----------DFKLETTLDGHQRWVW-DCAFSADSAYLVTAS-SDHYVRLWDLSTREIVRQYGGH 291          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Nematostella
Match: EDO43442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYD1])

HSP 1 Score: 406.371 bits (1043), Expect = 1.460e-138
Identity = 223/427 (52.22%), Postives = 303/427 (70.96%), Query Frame = 1
Query:   34 LEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFR--CTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGD---TDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDT-EKDKNAEDIEVDIETIEPISALLSSDEEN-EPVDLIFLLSTTPEIEQPED 1293
            LE+F Q+YPE  DG L+ +            + A+T  FNR G+L+A+GCNDGR+ +WD+ TR + K ISAHVHPV S  WSR+ RKLLS S D ++S+WDI+TG+  + +R   P+ KVQFHPR+   ILVCP +  PV+++ +  +  +L    +++  IVASFDRRG YIYTGN+KGKV + +++  +V+  FR     +AN++IK+IEF+RRG  FLINC DR+IRV++ Q V    D    +P+P  +L+D+V    W+KCCFSGDGEYICAGS + H++Y+WE+  G LVKILHG KGE LLDVVWHP+RP+I S+S+ V    VSIWAQ  V+NWSAFAPDFKELDENVEYEERESEFD+EDEDK+ +   + +  E+ EVD+ +I+ I AL SSDE+N + +D +  L   PE++ PE+
Sbjct:    1 LESFGQSYPEEYDGSLDSV------------SVALTAAFNRRGSLLAVGCNDGRVVLWDFLTRGIAKIISAHVHPVTSCHWSRNGRKLLSGSNDWNVSVWDILTGECDQKYRFQSPISKVQFHPRNNKVILVCPTKQGPVVVD-LDGKHYVLPTGGESEHNIVASFDRRGDYIYTGNAKGKVLVIDAKTREVITFFRIQTGTSANTAIKAIEFARRGSAFLINCQDRIIRVFDNQIVLACKDQEGAEPEPIQKLQDLVNRTLWKKCCFSGDGEYICAGSARTHALYIWEKGVGNLVKILHGTKGELLLDVVWHPIRPIICSISSGV----VSIWAQNHVENWSAFAPDFKELDENVEYEERESEFDVEDEDKEPELPSESEVGEEEEVDVTSIDRIHALCSSDEDNDQDLDTLSYLPVAPEVDDPEE 410          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 80.1073 bits (196), Expect = 2.185e-16
Identity = 74/301 (24.58%), Postives = 131/301 (43.52%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSG----DGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVS--LSNSVTKEQVSIW 1020
            +++F+  G  +A    D  I+IW     +  K I+ H   +  V+WS DSR L+SAS D  + IWD  TG  L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G  I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D  ++++           D      L+      + + C F+      G++I +GS + H +Y+W   S  +V+ L G   + +L    HP   +I S  L N  T   + IW
Sbjct:   70 SVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW-----------DYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGS-EDHKVYIWNLQSKEVVQKLDGHS-DVVLCCACHPTENIIASGALENDKT---IKIW 350          

HSP 2 Score: 62.3882 bits (150), Expect = 1.242e-10
Identity = 50/170 (29.41%), Postives = 80/170 (47.06%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVR 615
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    + A+F    G +I +G+   KV I+N Q+ +VV+
Sbjct:  149 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQ 315          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 61.6178 bits (148), Expect = 3.161e-10
Identity = 62/251 (24.70%), Postives = 108/251 (43.03%), Query Frame = 1
Query:  136 ITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF-RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQ-RSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLW 882
            + L FN    +IA G  D   ++WD  T   I  +S H   + S +++    +LL+ S D+ +S+WD  +G  + T       +   QF+  DC+ I+   +     I +  + +    L+  DD  L +  +FD  G  I T ++ G   +YN+     +            I  I F+ +G   L   +D+  R++         D +    LQ+ +  T +    C F+ DG+ I  GS K ++  LW
Sbjct:  181 VCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFN-FDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDV--AFDYTGQLIATASADGTGRVYNALTHHCLSKLE---GHEGEISKITFNAQGTRLLTASSDKTARLW---------DPNTGKCLQVLEGHT-DEIFSCAFNYDGDIIITGS-KDNTCRLW 414          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Nematostella
Match: EDO40932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5U0])

HSP 1 Score: 60.8474 bits (146), Expect = 6.958e-10
Identity = 73/303 (24.09%), Postives = 118/303 (38.94%), Query Frame = 1
Query:   85 RIKKDEVSKESSCATYAIT-LQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRL-PCPVLKVQFHPRD----CTK---ILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHW--RKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHP 960
             IK  E  K +S   Y +T L++N  G  +A GC DG   IWD    +++  +  H  P+ SV W++    LL A  D    IWD  T D  + F     P L V +   +    C+    I VC L             + I  F           +D  GT + + +      +++ +    V   +        I +I +S  G       A  ++   +     R  D +    LQ   +++ +H       FS DG Y+ +GS  +  +++W   +G LV    G  G  + +V W P
Sbjct:  196 NIKDQENHKNNS---YDVTSLEWNSEGTYLATGCYDGCARIWD-PEGQLVTTLREHKGPLFSVKWNKKGNHLLGAGVDKACIIWDANTWDVKQQFAFHQAPTLDVDWQNNNSFASCSTDKLIHVCRL----------GLDKPIKSFRGHMSEVNAIRWDPSGTLLASCSDDMSAKVWSLKEDMCVHDLQ---GHKKEIYTITWSPTGPGSANPSAPLLLASASYDTTVRLWDVERGGCLQ---VLSKHHEPVYTISFSPDGRYLASGSFDKR-VHIWSTQTGNLVHSFQGSGG--IFEVQWSP 475          

HSP 2 Score: 53.1434 bits (126), Expect = 1.696e-7
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  166 LIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVC 432
            L+A    D  + +WD      ++ +S H  PV ++S+S D R L S S D  + IW   TG+ + +F+    + +VQ+ PR   K+  C
Sbjct:  396 LLASASYDTTVRLWDVERGGCLQVLSKHHEPVYTISFSPDGRYLASGSFDKRVHIWSTQTGNLVHSFQGSGGIFEVQWSPRG-DKLAAC 483          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Nematostella
Match: EDO34060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQE2])

HSP 1 Score: 60.8474 bits (146), Expect = 8.017e-10
Identity = 59/226 (26.11%), Postives = 95/226 (42.04%), Query Frame = 1
Query:  244 AHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFE---DDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQV-----VRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSG 897
             H   V  +SWS++   LLS+S D  + +W I   + L  F+    V  + FHPRD    L   L    + L  +  ++  L  E     ++L   A+F  +G +   G   G+   Y ++ L+      VR+ R   +    I  IE     E  LI   D  IR+Y+ +D +           + +     +   K  FS DG+Y+  GS + H +Y+W    G
Sbjct:  272 GHTGDVLDLSWSKNYF-LLSSSMDKTVRLWHISRNECLCCFQHIDFVTAIVFHPRDDRYFLSGSL-DGKIRLWNIPDKKVALWNEVEGTGSNLITAANFCLQGRFAVIGTYDGRCIFYETERLKYHTQWQVRSGRNKRSRGRKISGIEPMPGEEKVLITSNDSRIRLYDLKDNSL--------YCKYKGCSNSSSQIKASFSHDGQYLICGS-EDHFVYIWRTQHG 486          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Medaka
Match: rbbp5 (RB binding protein 5, histone lysine methyltransferase complex subunit [Source:NCBI gene;Acc:101164873])

HSP 1 Score: 492.271 bits (1266), Expect = 1.321e-169
Identity = 267/519 (51.45%), Postives = 352/519 (67.82%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDF-VEVVT---------RKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD++TGD  + FR P P+LK+Q HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VA+FDRRG YIYTGN+KGK+ + ++   ++V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W++CCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ T++PI A  SSDEE E    +  L   PE+E PE+       D  V+  T         +K+ Q  +E  P  KK +   I+L    +DEVHPL+  +   K      +KK ++ R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLTGDCDQRFRFPSPILKLQCHPRDMDKVLVCPMKSAPVLLTLSDSKHVVLPVDDDSDLNVVAAFDRRGEYIYTGNAKGKILVLSTDTQELVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKRCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTTVDPIVAFCSSDEEMEDCKALLYLPIAPEVEDPEENPFGPPPDASVQAATPEDPLAGSDKKQRQLSSEGGPTKKKARTTVIELQGVPSDEVHPLLGVKGDGK------SKKKTAGRPKGSKGKDK 497          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Medaka
Match: rbbp5 (RB binding protein 5, histone lysine methyltransferase complex subunit [Source:NCBI gene;Acc:101164873])

HSP 1 Score: 491.886 bits (1265), Expect = 1.872e-169
Identity = 267/519 (51.45%), Postives = 352/519 (67.82%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRC-TNTAN-SSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNG-DTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKN-AEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDF-VEVVT---------RKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMK 1533
            MNLELLE+F QNYPE  DG L+            C + A+T  FNR G L+A+GCNDGRI IWD+ TR + K ISAH+HPVCS+ WSRD  KL+SASTDN +S WD++TGD  + FR P P+LK+Q HPRD  K+LVCP++ APV+L     +  +L  +DD+DL +VA+FDRRG YIYTGN+KGK+ + ++   ++V +FR  T T+N ++IKSIEF+R+G CFLIN ADR+IRVY+ +++   G D +P+P  +L+D+V    W++CCFSGDGEYI AGS +QH++Y+WE+S G LVKILHG +GE LLDV WHP+RP+I S+S+ V    VSIWAQ QV+NWSAFAPDFKELDENVEYEERESEFDIEDEDK    +   + AED EVD+ T++PI A  SSDEE E    +  L   PE+E PE+       D  V+  T         +K+ Q  +E  P  KK +   I+L    +DEVHPL+  +   K      +KK ++ R +  + K K
Sbjct:    1 MNLELLESFGQNYPEEADGTLD------------CISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLTGDCDQRFRFPSPILKLQCHPRDMDKVLVCPMKSAPVLLTLSDSKHVVLPVDDDSDLNVVAAFDRRGEYIYTGNAKGKILVLSTDTQELVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKRCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGV----VSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTTVDPIVAFCSSDEEMEDCKALLYLPIAPEVEDPEENPFGPPPDASVQAATPEDPLAGSDKKQRQLSSEGGPTKKKARTTVIELQGVPSDEVHPLLGVKGDGK------SKKKTAGRPKGSKGKDK 497          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 74.7146 bits (182), Expect = 3.521e-14
Identity = 65/288 (22.57%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSG----DGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            +++F+  G  +A    D  I+IW     +  K IS H   +  V+WS DS  L+SAS D  + IWD+ +G  L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D  ++++           D      L+      + + C F+      G++I +GS + + +Y+W   +  +V+ L G   + ++    HP   +I S +
Sbjct:   50 SVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW-----------DYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS-EDNMVYIWNLQTKEIVQKLQGHT-DVVISTACHPTENIIASAA 320          

HSP 2 Score: 62.003 bits (149), Expect = 4.901e-10
Identity = 49/173 (28.32%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF--EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P    K ++       + L   S  + +  +    +    I A+F    G +I +G+    V I+N Q  ++V+  +
Sbjct:  129 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 70.0922 bits (170), Expect = 9.922e-13
Identity = 67/289 (23.18%), Postives = 124/289 (42.91%), Query Frame = 1
Query:  139 TLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCP-VLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGD-----GEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLS 987
            +++F+  G  +A    D  I+IW     +  K IS H   +  V+WS DS  L+SAS D  + IWD+ +G  L+T +     V    F+P+  + ++V       V +  V   + +      +D      F+R G+ I + +  G   I+++ + Q ++T    +  N  +  ++FS  G+  L    D     +    V            Q     TG+   K C   +     G++I +GS + + +Y+W   +  +V+ L G   + ++    HP   +I S +
Sbjct:   49 SVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQ--SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNSSLTFVFFYVNS----------QCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS-EDNMVYIWNLQTKEIVQKLQGHT-DVVISTACHPTENIIASAA 321          

HSP 2 Score: 62.7734 bits (151), Expect = 2.673e-10
Identity = 50/174 (28.74%), Postives = 78/174 (44.83%), Query Frame = 1
Query:  124 ATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETF---RLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQF---EDDNDLGIVASFD-RRGTYIYTGNSKGKVTIYNSQNLQVVRTFR 624
            + Y     FN   NLI  G  D  + IWD  T + +K + AH  PV +V ++RD   ++S+S D    IWD  +G  L+T      P PV  V+F P     IL   L ++ +           L+      +    I A+F    G +I +G+    V I+N Q  ++V+  +
Sbjct:  128 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNG-KYILAATLDNSSLTFVFFYVNSQCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 299          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 67.0106 bits (162), Expect = 1.274e-11
Identity = 60/289 (20.76%), Postives = 126/289 (43.60%), Query Frame = 1
Query:  145 QFNRCGNLIAIGCNDGRIEIWD-YCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGN------HWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSN 990
            +F+  G  +A    D  I +W+ +        +  H   V  + ++ D   L SASTD  + IWD  TG+ ++  +     +   +  R   +++        + L  +  + +I  F++   + +  +F+     I +G     + +++ +  +++      +  + S+  +  S  G   L N  D  +R+++ +           P  +   I  GN      +  +C +S DG  I AGS  +  +Y+W+ +S  ++  L G  G ++ +VV+HP  PV++S S+
Sbjct:   63 KFHPNGATLASSGFDRLIFLWNVFGECENYATLKGHSGAVMELHYNTDGSLLFSASTDKTVGIWDSETGERIKRLKGHTSFVNTCYPARRGPQLVCTGSDDGTIKLWDIRKKAAIHTFQNTYQV-LAVTFNDTSDQILSGGIDNDIKVWDLRQNKLIYNM---HGHSDSVTGLSLSSEGSYLLSNSMDNTVRIWDVRPFA--------PKERCVKIFQGNVHNFEKNLLRCSWSTDGSKIAAGSADRF-VYIWDTTSRRILYKLPGHAG-SVNEVVFHPEEPVVLSGSS 337          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Planmine SMEST
Match: SMESG000077004.1 (SMESG000077004.1)

HSP 1 Score: 1012.68 bits (2617), Expect = 0.000e+0
Identity = 505/506 (99.80%), Postives = 505/506 (99.80%), Query Frame = 1
Query:   19 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVXXXXXXXXXXXXXXXKQIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRDRHKMKK 1536
            MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDIEDEDKQIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLG LGVNKKFSSSRGQRDRHKMKK
Sbjct:    1 MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFKELDENVEYEERESEFDIEDEDKQIDTEKDKNAEDIEVDIETIEPISALLSSDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMSPKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGHLGVNKKFSSSRGQRDRHKMKK 506          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Planmine SMEST
Match: SMESG000045329.1 (SMESG000045329.1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.287e-14
Identity = 64/292 (21.92%), Postives = 134/292 (45.89%), Query Frame = 1
Query:  145 QFNRCGNLIAIGCNDGRIEIWD-YCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPV---LKVQFHPRD--CTKILVCPLR----HAPVILNTVSYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDPSLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILHGQKGETLLDVVWHPLRPVIVSLSN 990
            +F   G+ +A   +D  I +W+ Y   + +  +S H   +  + +S DS  + +ASTD  + IWD   G+ ++ F+    +   +    H R+  C+    C +R          +T+  + S+L            ++   G YI++G  +  +  ++ + +++++TF        SI S+  S  G   L N  D  +RV++ +   R           L +     +  +C +S DG+ +  GS  + ++Y+W+  +G ++  L G  G ++ +  +HP  P+++S+S+
Sbjct:   67 KFAPEGSFLASAGHDREIILWNTYGDIKDLAVLSGHNGAILDLQFSSDSDWIYTASTDKTVMIWDTRVGERVKKFKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDKRVKNTTHTIDAKHSVLD----------VAYSPFGDYIFSGGIENVINQWDVREMKIIQTFA---GHTDSITSVAVSNDGNFLLSNSVDNTLRVWDTRPFVRGERCTKLMVGHLHNF--EKNLLRCAWSVDGKRVTCGSADK-NVYVWDMYTGQIMYKLPGHVG-SVNETAFHPHEPILLSVSS 341          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Planmine SMEST
Match: SMESG000005136.1 (SMESG000005136.1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.140e-9
Identity = 49/201 (24.38%), Postives = 82/201 (40.80%), Query Frame = 1
Query:  133 AITLQFNRCGNLIAIGCNDGRIEI-W----------DYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQFEDDNDLGIV-ASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINC 699
             I   F++  + +A+G   G I + W          D         IS H   V  +SWS++ + L+SAS+D  +  W   T D + TF  P P+  V   P     +LVC      + +  + +   I QF  D    +    F     YI +G     V +++ ++  +VR+F         + S+ FS  G+  +  C
Sbjct:  265 GICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCIATFSAPGPIWSVDLSPLS-ENLLVCGTNKESINVYALDHPNPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSF---TGHKGIVSSLRFSLDGKYLISGC 461          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Planmine SMEST
Match: SMESG000005039.1 (SMESG000005039.1)

HSP 1 Score: 55.8398 bits (133), Expect = 5.407e-8
Identity = 50/215 (23.26%), Postives = 90/215 (41.86%), Query Frame = 1
Query:  136 ITLQFNRCGNLIAIGCNDGRIEIWDYCTRR-MIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTVSYQRSILQ-----FEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRTFRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDP 762
            ++L F+R   ++A G  DG+I+++   T + + K+  AHV  V SV +S+D   +LS S D  + I  + +G  L+ F+     +    +  D   I+         + +  + + +I +        +  +  V    R        N    V I N Q  Q+VR+F       S   +   S +GE F     D+++  +N Q   +   T P
Sbjct:  268 LSLGFSRDSEMLAAGSQDGKIKVFRIQTGQCLKKFEKAHVKGVTSVQFSKDGTNILSGSFDKSVRIHGMKSGKLLKEFKGHTSFVNDVIYAPDNQHIISASSDGTLRLWSLKTGEGTIWRAYSGLVGQEAPIHTVMPVPRNTDQFIISNKTNTVAIINIQG-QIVRSFSAPKRDGSDFVATIISPKGEWFYCVGEDKLLYCFNLQAENKLERTIP 481          
BLAST of Retinoblastoma-binding protein 5 homolog vs. Planmine SMEST
Match: SMESG000035997.1 (SMESG000035997.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.238e-7
Identity = 28/76 (36.84%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  142 LQFNRCGNLIAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDNHISIWDIITGDALETFR 369
            L F+  G L+A    D +I++WD+     +K +S H H V  VS+      LLSAS D  I +W++ TG  ++TF 
Sbjct:  157 LAFDPSGKLLASCSADMQIKLWDFVEFTCVKTLSGHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFE 232          
The following BLAST results are available for this feature:
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBBP52.663e-17152.03RB binding protein 5, histone lysine methyltransfe... [more]
RBBP54.701e-17152.32RB binding protein 5, histone lysine methyltransfe... [more]
WDR59.475e-1422.84WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12... [more]
SNRNP401.066e-1221.80small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
WDR442.790e-1122.65WD repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp-57.338e-8436.03Retinoblastoma-binding protein homolog 5 [Source:... [more]
wdr-5.11.451e-1323.78WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.11.451e-1323.78WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.21.040e-1032.02WD repeat-containing protein wdr-5.2 [Source:UniP... [more]
F55F8.31.413e-822.01Periodic tryptophan protein 2 homolog [Source:Uni... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbbp55.874e-17251.48gene:FBgn0036973 transcript:FBtr0078242[more]
wds3.470e-1423.53gene:FBgn0040066 transcript:FBtr0308566[more]
wds3.470e-1423.53gene:FBgn0040066 transcript:FBtr0070438[more]
Smu16.591e-1222.56gene:FBgn0038666 transcript:FBtr0083721[more]
Smu16.591e-1222.56gene:FBgn0038666 transcript:FBtr0304690[more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp51.340e-16952.41retinoblastoma binding protein 5 [Source:ZFIN;Acc:... [more]
wdr53.357e-1422.57WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
wdr448.416e-1223.53WD repeat domain 44 [Source:NCBI gene;Acc:569045][more]
ahi11.409e-1123.33Abelson helper integration site 1 [Source:ZFIN;Acc... [more]
ahi11.423e-1123.33Abelson helper integration site 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alg23.407e-16853.04ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xe... [more]
alg21.731e-16452.45ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xe... [more]
alg22.246e-16452.45ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xe... [more]
alg22.637e-16452.45ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xe... [more]
alg24.613e-16452.45ALG2, alpha-1,3/1,6-mannosyltransferase [Source:Xe... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbbp55.305e-17152.03retinoblastoma binding protein 5, histone lysine m... [more]
Rbbp55.367e-17152.03retinoblastoma binding protein 5, histone lysine m... [more]
Rbbp51.173e-10550.13retinoblastoma binding protein 5, histone lysine m... [more]
Rbbp51.609e-10549.74retinoblastoma binding protein 5, histone lysine m... [more]
Rbbp54.989e-6260.81retinoblastoma binding protein 5, histone lysine m... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VPH8|RBBP5_DROME5.888e-17151.48Retinoblastoma-binding protein 5 homolog OS=Drosop... [more]
sp|Q15291|RBBP5_HUMAN1.279e-17052.03Retinoblastoma-binding protein 5 OS=Homo sapiens O... [more]
sp|Q8BX09|RBBP5_MOUSE3.754e-17052.03Retinoblastoma-binding protein 5 OS=Mus musculus O... [more]
sp|Q09309|RBBP5_CAEEL9.334e-8336.03Retinoblastoma-binding protein homolog 5 OS=Caenor... [more]
sp|Q54MH6|RBBE_DICDI8.759e-6734.55Retinoblastoma-binding-like protein E OS=Dictyoste... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X9DCF10.000e+099.60RBBP5 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A0X3PLV10.000e+062.48Retinoblastoma-binding protein 5 homolog OS=Schist... [more]
A0A3Q0KNK70.000e+062.79Putative retinoblastoma binding protein OS=Schisto... [more]
A0A5K4EQJ90.000e+064.31Putative retinoblastoma binding protein OS=Schisto... [more]
A0A068YGU40.000e+063.88Wd40 repeat OS=Echinococcus multilocularis OX=6211... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp53.479e-16850.96retinoblastoma binding protein 5 [Source:ZFIN;Acc:... [more]
rbbp55.459e-15851.45retinoblastoma binding protein 5 [Source:ZFIN;Acc:... [more]
rbbp51.750e-15751.45retinoblastoma binding protein 5 [Source:ZFIN;Acc:... [more]
wdr52.391e-1422.57WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007963.24.215e-1422.57WD repeat-containing protein 5-like [Source:NCBI g... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp52.449e-15651.22retinoblastoma binding protein 5 [Source:ZFIN;Acc:... [more]
snrnp401.713e-1421.11small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
thoc32.140e-830.30THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14][more]
ENSPMAT00000003168.13.699e-832.22pep scaffold:Pmarinus_7.0:GL476396:632759:655100:1... [more]
wdr361.822e-624.42WD repeat domain 36 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SWD11.356e-3930.84Subunit of the COMPASS (Set1C) complex; COMPASS me... [more]
CDC402.904e-1322.22Pre-mRNA splicing factor; important for catalytic ... [more]
TIF347.305e-921.74eIF3i subunit of the eukaryotic translation initia... [more]
SWD32.401e-835.96Essential subunit of the COMPASS (Set1C) complex; ... [more]
LST82.505e-824.08Protein required for the transport of Gap1p; requi... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO434421.460e-13852.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332972.185e-1624.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348653.161e-1024.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409326.958e-1024.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340608.017e-1026.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp51.321e-16951.45RB binding protein 5, histone lysine methyltransfe... [more]
rbbp51.872e-16951.45RB binding protein 5, histone lysine methyltransfe... [more]
wdr53.521e-1422.57WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
wdr59.922e-1323.18WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
snrnp401.274e-1120.76small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of Retinoblastoma-binding protein 5 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077004.10.000e+099.80SMESG000077004.1[more]
SMESG000045329.12.287e-1421.92SMESG000045329.1[more]
SMESG000005136.11.140e-924.38SMESG000005136.1[more]
SMESG000005039.15.407e-823.26SMESG000005039.1[more]
SMESG000035997.11.238e-736.84SMESG000035997.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029979 ID=SMED30029979|Name=Retinoblastoma-binding protein 5 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1603bp
TCATCATCTTAAATTAATATGAATTTAGAATTATTGGAAGCCTTTCATCA
AAATTACCCTGAGGCACCTGATGGTCATTTAGAAAGAATTAAGAAAGATG
AAGTTTCGAAAGAAAGTTCTTGCGCCACCTATGCAATTACTTTGCAATTT
AATAGATGTGGTAATTTAATAGCTATCGGTTGTAATGATGGAAGAATAGA
AATATGGGATTATTGTACTCGCAGGATGATAAAATATATTTCTGCGCATG
TTCACCCTGTTTGTTCAGTCAGTTGGAGTAGAGATAGTAGAAAGTTGCTA
AGTGCTTCCACAGATAATCATATATCTATTTGGGATATTATTACTGGCGA
CGCTCTAGAAACTTTTCGATTACCCTGTCCAGTTTTAAAAGTGCAATTCC
ATCCTCGTGATTGCACTAAGATATTAGTTTGTCCTTTACGCCATGCTCCA
GTAATACTTAATACAGTTTCATATCAAAGATCGATTTTACAATTTGAAGA
TGACAACGACCTCGGAATTGTAGCATCTTTTGATCGTCGAGGTACATATA
TATACACTGGAAATTCAAAAGGGAAAGTCACAATTTATAACAGCCAAAAT
TTGCAAGTTGTCCGAACCTTTCGCTGCACAAATACCGCTAATTCATCCAT
TAAATCAATAGAATTTTCTCGTCGTGGGGAGTGTTTCTTGATTAATTGTG
CTGACAGAGTTATTAGAGTGTACAATTGTCAGGATGTTACTAGAAACGGT
GACACCGATCCTGACCCGAGCCTTCAATTGCGTGACATTGTTACCGGTAA
TCATTGGCGCAAATGTTGCTTTTCCGGTGATGGGGAATATATCTGTGCCG
GATCAATGAAGCAGCATTCAATTTATTTATGGGAACGATCAAGCGGAACA
CTGGTAAAAATCCTTCACGGACAGAAAGGGGAAACCCTGTTGGATGTTGT
ATGGCACCCACTAAGGCCTGTCATCGTGTCGTTGTCGAATTCCGTCACCA
AGGAACAGGTATCGATTTGGGCCCAAACACAAGTGCAAAATTGGTCGGCT
TTTGCACCGGACTTCAAAGAGCTCGATGAAAATGTCGAGTATGAAGAGCG
AGAATCTGAATTCGATATTGAAGATGAGGACAAACAAATCGATACGGAAA
AAGACAAAAATGCTGAAGACATTGAAGTAGATATCGAAACAATTGAACCG
ATTTCAGCGTTATTAAGCAGTGATGAAGAAAATGAACCTGTTGATCTGAT
TTTCCTTTTATCTACCACTCCAGAAATCGAGCAACCAGAAGATCAAAAGG
ACAATCGAAATATAGATTTTGTCGAAGTAGTTACAAGAAAGCGATTGCAA
TCTGAAACGGAAATGTCGCCTAAAACTAAGAAAAGAAAGATTTGTGAAAT
CGACCTTCCAAATGCATCAGCTGATGAAGTTCATCCTTTGGTAAGTTCAC
GCAAGCAAAATAAATTAGGTCAATTAGGAGTGAACAAAAAATTTAGCTCA
TCTCGAGGACAAAGGGATCGACATAAAATGAAAAAATAATTTATATAAAT
AAATGCGCGCGCGCGTGTGTGTGTATAGAATTATATAATAAATTTGACTT
GAC
back to top

protein sequence of SMED30029979-orf-1

>SMED30029979-orf-1 ID=SMED30029979-orf-1|Name=SMED30029979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MNLELLEAFHQNYPEAPDGHLERIKKDEVSKESSCATYAITLQFNRCGNL
IAIGCNDGRIEIWDYCTRRMIKYISAHVHPVCSVSWSRDSRKLLSASTDN
HISIWDIITGDALETFRLPCPVLKVQFHPRDCTKILVCPLRHAPVILNTV
SYQRSILQFEDDNDLGIVASFDRRGTYIYTGNSKGKVTIYNSQNLQVVRT
FRCTNTANSSIKSIEFSRRGECFLINCADRVIRVYNCQDVTRNGDTDPDP
SLQLRDIVTGNHWRKCCFSGDGEYICAGSMKQHSIYLWERSSGTLVKILH
GQKGETLLDVVWHPLRPVIVSLSNSVTKEQVSIWAQTQVQNWSAFAPDFK
ELDENVEYEERESEFDIEDEDKQIDTEKDKNAEDIEVDIETIEPISALLS
SDEENEPVDLIFLLSTTPEIEQPEDQKDNRNIDFVEVVTRKRLQSETEMS
PKTKKRKICEIDLPNASADEVHPLVSSRKQNKLGQLGVNKKFSSSRGQRD
RHKMKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037850RBBP5/Swd1
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0018024histone-lysine N-methyltransferase activity
GO:0035064methylated histone binding
GO:0044212transcription regulatory region DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0035097histone methyltransferase complex
GO:0044666MLL3/4 complex
GO:0048188Set1C/COMPASS complex
GO:0071339MLL1 complex
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006974cellular response to DNA damage stimulus
GO:0016569covalent chromatin modification
GO:0043627response to estrogen
GO:0051568histone H3-K4 methylation
GO:1904837beta-catenin-TCF complex assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 31..64
e-value: 1.1
score: 16.8
coord: 251..289
e-value: 17.0
score: 9.3
coord: 67..106
e-value: 5.7E-8
score: 42.5
coord: 194..236
e-value: 0.69
score: 18.0
coord: 152..191
e-value: 200.0
score: 2.4
coord: 292..335
e-value: 110.0
score: 4.0
IPR001680WD40 repeatPFAMPF00400WD40coord: 261..288
e-value: 0.12
score: 13.3
coord: 41..64
e-value: 0.12
score: 13.3
coord: 74..106
e-value: 2.9E-5
score: 24.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 74..115
score: 15.154
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 25..334
e-value: 5.3E-47
score: 162.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 466..506
IPR037850Retinoblastoma-binding protein 5/Swd1PANTHERPTHR44040FAMILY NOT NAMEDcoord: 5..460
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 93..107
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 32..115
score: 19.064
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 40..324