Ribonucleoside-diphosphate reductase

Overview
NameRibonucleoside-diphosphate reductase
Smed IDSMED30029973
Length (bp)2604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribonucleoside-diphosphate reductase (SMED30029973) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribonucleoside-diphosphate reductase (SMED30029973) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribonucleoside-diphosphate reductase (SMED30029973) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribonucleoside-diphosphate reductase (SMED30029973) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029973

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029973SMESG000029273.1 SmedASXL_012448SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029973SMESG000029273.1 SmedASXL_012448SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30029973SMESG000029273.1 dd_Smed_v4_1651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029973SMESG000029273.1 dd_Smed_v4_1651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029973SMESG000029273.1 dd_Smed_v4_1651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029973SMESG000029273.1 dd_Smed_v4_1651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029973SMESG000029273.1 dd_Smed_v4_1651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029973SMESG000029273.1 Contig48541newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029973SMESG000029273.1 Contig48541uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029973SMESG000029273.1 dd_Smed_v6_1651_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30029973SMESG000029273.1 SMED30029973smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30029973SMESG000029273.1 dd_Smed_v6_1651_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30029973SMESG000029273.1 dd_Smed_v4_1651_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029973SMESG000029273.1 SmWIOct06_017678GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029973SMESG000029273.1 SMED_04845_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029973SMESG000029273.1 SMED_04845_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Human
Match: RRM1 (ribonucleotide reductase catalytic subunit M1 [Source:HGNC Symbol;Acc:HGNC:10451])

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 496/757 (65.52%), Postives = 609/757 (80.45%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +HV+KR+G +E + FDKIT+R+ KLC     + +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N I+ + G+ S ++A    +IV+ N + LN+AI Y+RDF  +YFGF+TLERSYLL+I  KV ERPQHM MR +VGIHK+DI+ AIETYNL+SE+WF HASPTLFNAG    QLSSCFLL+MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH DI EFL+L+KN G E ++ARDLF ALWIPDLFMKRV+++ +W+LM P++C GL E WGE+F+KLY  YE++G   K +KA+ LW  I++SQ ETGTPYMLYKD+CN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V  S  T+DF +L  VT VV  NLNKIIDIN+YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES EA  LNK+IFETIY+GAL+ SC+LAK+ G YETY+GSPVSKG+LQ DMWNV  +D  DW  L+  IAKYG+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW ++MKN IIA  GSIQ+I  +PD++K+L+KTVWEI Q  ++K+AA+R  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    1 MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVT-SEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 756          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Human
Match: RRM1 (ribonucleotide reductase catalytic subunit M1 [Source:HGNC Symbol;Acc:HGNC:10451])

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 365/535 (68.22%), Postives = 441/535 (82.43%), Query Frame = 1
Query:  763 MKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH DI EFL+L+KN G E ++ARDLF ALWIPDLFMKRV+++ +W+LM P++C GL E WGE+F+KLY  YE++G   K +KA+ LW  I++SQ ETGTPYMLYKD+CN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V  S  T+DF +L  VT VV  NLNKIIDIN+YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES EA  LNK+IFETIY+GAL+ SC+LAK+ G YETY+GSPVSKG+LQ DMWNV  +D  DW  L+  IAKYG+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW ++MKN IIA  GSIQ+I  +PD++K+L+KTVWEI Q  ++K+AA+R  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    1 MKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVT-SEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 534          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Human
Match: RRM1 (ribonucleotide reductase catalytic subunit M1 [Source:HGNC Symbol;Acc:HGNC:10451])

HSP 1 Score: 175.637 bits (444), Expect = 1.019e-50
Identity = 81/105 (77.14%), Postives = 90/105 (85.71%), Query Frame = 1
Query:  661 TYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKR 975
            TYNL+SE+WF HASPTLFNAG    QLSSCFLL+MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKR
Sbjct:    2 TYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKR 106          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Human
Match: RRM1 (ribonucleotide reductase catalytic subunit M1 [Source:HGNC Symbol;Acc:HGNC:10451])

HSP 1 Score: 114.39 bits (285), Expect = 6.894e-30
Identity = 54/70 (77.14%), Postives = 60/70 (85.71%), Query Frame = 1
Query:  763 MKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNK 972
            MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNK
Sbjct:    1 MKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNK 70          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Celegans
Match: rnr-1 (Ribonucleoside-diphosphate reductase large subunit [Source:UniProtKB/Swiss-Prot;Acc:Q03604])

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 494/804 (61.44%), Postives = 605/804 (75.25%), Query Frame = 1
Query:  100 HVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKGCTSCQG 2511
            +VVKR+G KE++HFDKIT+R+ KL      + +D   V+ KVI+GLY GVTT ELDNLAAE  AS+ T+H EY  LA RI VSN+ K+T   FSEV+  L      +TG+ + +I+D+ + I+ KNA+ LN+AI Y+RD+   YFGF+TLERSYLL+I +++VERPQ M MR ++GIH DDI  AIETYNLMSE++  HASPTLFN+G    Q+SSCFLLTM +DSI GI+ TLK+CALISK AGGIGLNVH IRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH+DI EF+ LRKN G E ++ARDLF ALWIPDLFMKRV+ D  W+LM P +C GL +CWGE+F+ LY  YE +G   KT+KAR LW+ I+ +QIETG PY+ YKDA N KSN Q+LGTIKCSNLCTEI+EYS+PDEIAVCNLASI+L ++V P  K FDF +L  VT V+T NLNKIID+N+YP+ EAR SN+RHRPIG+GVQGLAD F L+RYPF S EA  LNKRIFETIY+ AL+ SCELA+  G Y TY+GSPVSKG LQ DMW V  +D  DW  LR  IAK+G+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSG+F +VN ++++DL+   LW+D+MKN +IAN GSIQNI G+P ++KEL++TVWEI Q  II++AADR  +IDQSQS+N H+A P Y  +TS+HF  WKKGLKTGMYYLRT+PA + +QFTVDK                 N L           E    V    D+GC  C G
Sbjct:    8 YVVKRDGRKEDVHFDKITSRIQKLSYGLNMDFVDPVAVAIKVISGLYKGVTTVELDNLAAETAASMTTQHPEYALLAARIAVSNLHKKTNKVFSEVMKTLHEFHHPHTGKHAPMISDETWAIIEKNADKLNSAIVYDRDYSYTYFGFKTLERSYLLKINKEIVERPQQMLMRVSIGIHGDDITSAIETYNLMSERYMTHASPTLFNSGTCRPQMSSCFLLTMSEDSILGIYDTLKQCALISKSAGGIGLNVHKIRATGSVIAGTNGTSNGLIPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHADIFEFVSLRKNTGPEEERARDLFLALWIPDLFMKRVEKDQEWSLMCPCECPGLDDCWGEEFEALYAKYEAEGRVRKTVKARKLWEHIVSNQIETGLPYITYKDAANRKSNQQNLGTIKCSNLCTEIIEYSAPDEIAVCNLASIALNRYVTPEKK-FDFVKLAEVTKVITRNLNKIIDVNYYPVEEARNSNMRHRPIGLGVQGLADCFMLMRYPFTSAEARDLNKRIFETIYYAALEASCELAELNGPYSTYEGSPVSKGQLQFDMWGVTPTDQCDWATLRKKIAKHGIRNSLLMAPMPTASTAQILGNNESIEPYTSNIYSRRVLSGDFQIVNPHMLKDLVERGLWTDEMKNRLIANNGSIQNIDGIPSDIKELYRTVWEISQKDIIEMAADRGAYIDQSQSLNIHMAKPSYAGITSMHFYGWKKGLKTGMYYLRTKPAVNAVQFTVDK-----------------NALKTNQ-----QAETPATVAESQDEGCLMCSG 788          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Celegans
Match: rnr-1 (Ribonucleoside-diphosphate reductase large subunit [Source:UniProtKB/Swiss-Prot;Acc:Q03604])

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 494/804 (61.44%), Postives = 605/804 (75.25%), Query Frame = 1
Query:  100 HVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKGCTSCQG 2511
            +VVKR+G KE++HFDKIT+R+ KL      + +D   V+ KVI+GLY GVTT ELDNLAAE  AS+ T+H EY  LA RI VSN+ K+T   FSEV+  L      +TG+ + +I+D+ + I+ KNA+ LN+AI Y+RD+   YFGF+TLERSYLL+I +++VERPQ M MR ++GIH DDI  AIETYNLMSE++  HASPTLFN+G    Q+SSCFLLTM +DSI GI+ TLK+CALISK AGGIGLNVH IRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH+DI EF+ LRKN G E ++ARDLF ALWIPDLFMKRV+ D  W+LM P +C GL +CWGE+F+ LY  YE +G   KT+KAR LW+ I+ +QIETG PY+ YKDA N KSN Q+LGTIKCSNLCTEI+EYS+PDEIAVCNLASI+L ++V P  K FDF +L  VT V+T NLNKIID+N+YP+ EAR SN+RHRPIG+GVQGLAD F L+RYPF S EA  LNKRIFETIY+ AL+ SCELA+  G Y TY+GSPVSKG LQ DMW V  +D  DW  LR  IAK+G+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSG+F +VN ++++DL+   LW+D+MKN +IAN GSIQNI G+P ++KEL++TVWEI Q  II++AADR  +IDQSQS+N H+A P Y  +TS+HF  WKKGLKTGMYYLRT+PA + +QFTVDK                 N L           E    V    D+GC  C G
Sbjct:    8 YVVKRDGRKEDVHFDKITSRIQKLSYGLNMDFVDPVAVAIKVISGLYKGVTTVELDNLAAETAASMTTQHPEYALLAARIAVSNLHKKTNKVFSEVMKTLHEFHHPHTGKHAPMISDETWAIIEKNADKLNSAIVYDRDYSYTYFGFKTLERSYLLKINKEIVERPQQMLMRVSIGIHGDDITSAIETYNLMSERYMTHASPTLFNSGTCRPQMSSCFLLTMSEDSILGIYDTLKQCALISKSAGGIGLNVHKIRATGSVIAGTNGTSNGLIPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHADIFEFVSLRKNTGPEEERARDLFLALWIPDLFMKRVEKDQEWSLMCPCECPGLDDCWGEEFEALYAKYEAEGRVRKTVKARKLWEHIVSNQIETGLPYITYKDAANRKSNQQNLGTIKCSNLCTEIIEYSAPDEIAVCNLASIALNRYVTPEKK-FDFVKLAEVTKVITRNLNKIIDVNYYPVEEARNSNMRHRPIGLGVQGLADCFMLMRYPFTSAEARDLNKRIFETIYYAALEASCELAELNGPYSTYEGSPVSKGQLQFDMWGVTPTDQCDWATLRKKIAKHGIRNSLLMAPMPTASTAQILGNNESIEPYTSNIYSRRVLSGDFQIVNPHMLKDLVERGLWTDEMKNRLIANNGSIQNIDGIPSDIKELYRTVWEISQKDIIEMAADRGAYIDQSQSLNIHMAKPSYAGITSMHFYGWKKGLKTGMYYLRTKPAVNAVQFTVDK-----------------NALKTNQ-----QAETPATVAESQDEGCLMCSG 788          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Fly
Match: RnrL (gene:FBgn0011703 transcript:FBtr0080059)

HSP 1 Score: 1060.06 bits (2740), Expect = 0.000e+0
Identity = 501/804 (62.31%), Postives = 631/804 (78.48%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDK-GCTSC 2505
            L+V+KR+G +EE+HFDKIT+R+ KLC     + +D   ++ +VINGLY GVTT ELDNLAAEI A L   H +Y  LA RI VSN+ KETK  FS+V  DL+N ++  T +K  L+++  Y +V KNA  LN++I Y+RDF  +YFGF+TLERSYLL+   K+ ERPQHM MR A+GIH +DI+ A+ETYNL+SE++F HASPTLF A     QLSSCFLLTM  DSI+GIF ++++CA+ISK AGGIGLNVHCIRA G+ I GTNG SNGL PML+VFN  ARYVDQGG KRPGAFAIY+EPWHSD+ EFLEL+KN G E  +ARDLF ALWIPDLFMKRV+++G+W+LM PHKC GLH+ WG++F+KLYE YE++G  N+T+KA+ LW  I+++Q+ETG PYML+KDACN KSN Q++GTIKCSNLCTEIVEYS+PDEIAVCNLASI+L  FV P  KT+DF +L  VT +VT NLNKIIDIN+YPLPEAR SNLRHRP+GIG+QG AD   L+R+P+ES+EA  LN++IFETIY+GAL+ SCELA+  G YETY+GSPVSKG+LQ DMW+   ++  DW +L+  I  +GVRNSLLVAPMPTAST+QI+GNNE FE +++NIY RRVLSGEF VVN +L+ DL  L+LW DDMKN II++RGSIQNI+ +P ++++L+KTVWEI     IK+AADR  FIDQSQS N HVA P+Y  LTS+HF +WK GLKTGMYYLRT+PAA+ IQFTV+K + +  + G+N          E+D  +K++    +MVCS ++K  C SC
Sbjct:   12 LYVIKRDGRQEEVHFDKITSRIQKLCYNLNMDFVDPVTITLQVINGLYCGVTTQELDNLAAEIAAGLTCNHPDYAILAARIAVSNLHKETKKAFSDVFEDLYNHVNKETNQKVPLVSEFHYNVVKKNATRLNSSIIYDRDFGYNYFGFKTLERSYLLKRNGKIAERPQHMLMRVAIGIHGEDIDAAVETYNLLSERYFTHASPTLFAAATNRPQLSSCFLLTMTADSIEGIFKSVEQCAMISKSAGGIGLNVHCIRAKGTSICGTNGTSNGLVPMLRVFNNVARYVDQGGGKRPGAFAIYLEPWHSDVFEFLELKKNTGKEENRARDLFYALWIPDLFMKRVEANGDWSLMCPHKCPGLHDVWGDEFEKLYEKYEQEGRANRTVKAQSLWFAIIEAQVETGNPYMLFKDACNRKSNQQNVGTIKCSNLCTEIVEYSAPDEIAVCNLASIALNMFVTP-EKTYDFKKLKEVTKIVTKNLNKIIDINYYPLPEARKSNLRHRPVGIGIQGFADALILMRFPYESEEAGLLNQQIFETIYYGALEASCELAQTEGPYETYEGSPVSKGILQYDMWDKVPTNLWDWQKLKESIRMHGVRNSLLVAPMPTASTAQIMGNNESFEPYTTNIYTRRVLSGEFQVVNHHLLRDLTELDLWDDDMKNQIISSRGSIQNIETIPPKVRDLYKTVWEISVKSTIKMAADRGAFIDQSQSFNIHVAEPNYGKLTSIHFYSWKAGLKTGMYYLRTKPAANAIQFTVNKKQGAVSMNGQNGTAEGSPQKYEEDRERKMA----DMVCSLENKDACMSC 810          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Zebrafish
Match: rrm1 (ribonucleotide reductase M1 polypeptide [Source:NCBI gene;Acc:30740])

HSP 1 Score: 1046.96 bits (2706), Expect = 0.000e+0
Identity = 491/757 (64.86%), Postives = 601/757 (79.39%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +HV+KR+G +E + FDKIT+R+ KLC     + +D  +++ KVI GLY GVTT ELD LAAEI A+L TKH +Y  LA RI VSN+ KETK  FSEV+ DL+N ++    R S +I+ +  +IV+ N + LN+AI Y+RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR +VGIHK+DI  AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFA+Y+EPWH DI +FLEL+KN G E ++ARDLF ALWIPDLFMKRV+++G+W+LM P+ C GL ECWGE+F+KLY  YE++G   + +KA+ LW  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLASI+L  +V  S +TFDF +L  VT V+  NLNKIIDIN+YP+ EA  SN RHRPIGIGVQGLAD F L+R+PFES EA  LN +IFETIY+ AL+ SCELA ++G Y+TY G PVSKG+LQ DMW    +D  DW  L+  IAK+GVRNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIA  GSIQ I  +PD++KEL+KTVWEI Q  I+K+AADR  +IDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRT+PAA+PIQFT++K K
Sbjct:    1 MHVIKRDGRQERVMFDKITSRIQKLCYGLNSDFVDPTQITMKVIQGLYSGVTTVELDTLAAEIAATLTTKHPDYAILAARIAVSNLHKETKKVFSEVMEDLYNYVNPLNSRHSPMISKETLDIVLANKDRLNSAIIYDRDFSYNFFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIAAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLAMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAMYLEPWHFDIFDFLELKKNTGKEEQRARDLFYALWIPDLFMKRVETNGDWSLMCPNDCPGLDECWGEEFEKLYAKYEQEGRAKRVVKAQQLWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSADEVAVCNLASIALNMYVT-SERTFDFQKLASVTKVIVKNLNKIIDINYYPVKEAENSNKRHRPIGIGVQGLADAFILMRFPFESAEAQLLNTQIFETIYYAALESSCELAAEYGPYQTYAGCPVSKGILQYDMWEKTPTDLWDWAALKEKIAKHGVRNSLLLAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIAQNGSIQTIPAIPDDLKELYKTVWEISQKTILKMAADRGAYIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTKPAANPIQFTLNKEK 756          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Xenopus
Match: rrm1 (ribonucleotide reductase M1 [Source:NCBI gene;Acc:100145720])

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 488/752 (64.89%), Postives = 594/752 (78.99%), Query Frame = 1
Query:  115 NGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAE-TLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +G +E + FDKIT+R+ KLC     E +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N ++   G+ S +      E  + +    LN++I Y+RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR +VGIHK DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH D+ EFL+L+KN G E ++ARDLF A+WIPDLFMKRV+++ +W+LM PH+C GL E WG+KF++LYE YE +G   K +KA+ LW  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V P  ++FDF +L  VT V+  NLNKII+IN YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES+EA  LNK+IFETIY+ AL+ SCELAK+ G Y+TY+GSPVSKG+LQ DMWNV  +   DW  L+  IAKYGVRNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIAN GSIQN+  +P ++KEL+KTVWEI Q  +I +AADR  FIDQSQS+N HVA P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    1 DGRQERVMFDKITSRIQKLCYGLNLEFVDPAQITMKVIQGLYNGVTTIELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKIFSDVMEDLYNYVNPLNGKHSPM------EYFLSSLRYRLNSSIIYDRDFSYNFFGFKTLERSYLLKIDGKVAERPQHMLMRVSVGIHKTDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLCMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHYDVFEFLDLKKNTGKEEQRARDLFYAMWIPDLFMKRVENNLDWSLMCPHECPGLEEVWGDKFEELYERYEREGRARKVVKAQQLWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSDDEVAVCNLASLALNMYVTP-ERSFDFKKLADVTKVIVRNLNKIIEINFYPVPEAEYSNKRHRPIGIGVQGLADAFILMRYPFESEEAQLLNKQIFETIYYAALESSCELAKELGPYDTYEGSPVSKGILQYDMWNVTPTGLWDWAALKEKIAKYGVRNSLLLAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLMKDLTERGLWNEEMKNQIIANNGSIQNVPDIPADLKELYKTVWEISQKTVITMAADRGAFIDQSQSLNIHVAEPNYGKLTSMHFFGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 745          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Xenopus
Match: rrm1 (ribonucleotide reductase M1 [Source:NCBI gene;Acc:100145720])

HSP 1 Score: 985.712 bits (2547), Expect = 0.000e+0
Identity = 487/751 (64.85%), Postives = 591/751 (78.70%), Query Frame = 1
Query:  115 NGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +G +E + FDKIT+R+ KLC     E +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N ++   G+ S +               LN++I Y+RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR +VGIHK DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH D+ EFL+L+KN G E ++ARDLF A+WIPDLFMKRV+++ +W+LM PH+C GL E WG+KF++LYE YE +G   K +KA+ LW  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V P  ++FDF +L  VT V+  NLNKII+IN YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES+EA  LNK+IFETIY+ AL+ SCELAK+ G Y+TY+GSPVSKG+LQ DMWNV  +   DW  L+  IAKYGVRNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIAN GSIQN+  +P ++KEL+KTVWEI Q  +I +AADR  FIDQSQS+N HVA P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:   10 DGRQERVMFDKITSRIQKLCYGLNLEFVDPAQITMKVIQGLYNGVTTIELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKIFSDVMEDLYNYVNPLNGKHSPM--------------RLNSSIIYDRDFSYNFFGFKTLERSYLLKIDGKVAERPQHMLMRVSVGIHKTDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLCMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHYDVFEFLDLKKNTGKEEQRARDLFYAMWIPDLFMKRVENNLDWSLMCPHECPGLEEVWGDKFEELYERYEREGRARKVVKAQQLWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSDDEVAVCNLASLALNMYVTP-ERSFDFKKLADVTKVIVRNLNKIIEINFYPVPEAEYSNKRHRPIGIGVQGLADAFILMRYPFESEEAQLLNKQIFETIYYAALESSCELAKELGPYDTYEGSPVSKGILQYDMWNVTPTGLWDWAALKEKIAKYGVRNSLLLAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLMKDLTERGLWNEEMKNQIIANNGSIQNVPDIPADLKELYKTVWEISQKTVITMAADRGAFIDQSQSLNIHVAEPNYGKLTSMHFFGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 745          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Xenopus
Match: rrm1 (ribonucleotide reductase M1 [Source:NCBI gene;Acc:100145720])

HSP 1 Score: 981.86 bits (2537), Expect = 0.000e+0
Identity = 485/743 (65.28%), Postives = 586/743 (78.87%), Query Frame = 1
Query:  139 FDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            FDKIT+R+ KLC     E +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N ++   G+ S +               LN++I Y+RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR +VGIHK DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH D+ EFL+L+KN G E ++ARDLF A+WIPDLFMKRV+++ +W+LM PH+C GL E WG+KF++LYE YE +G   K +KA+ LW  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V P  ++FDF +L  VT V+  NLNKII+IN YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES+EA  LNK+IFETIY+ AL+ SCELAK+ G Y+TY+GSPVSKG+LQ DMWNV  +   DW  L+  IAKYGVRNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIAN GSIQN+  +P ++KEL+KTVWEI Q  +I +AADR  FIDQSQS+N HVA P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    2 FDKITSRIQKLCYGLNLEFVDPAQITMKVIQGLYNGVTTIELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKIFSDVMEDLYNYVNPLNGKHSPM--------------RLNSSIIYDRDFSYNFFGFKTLERSYLLKIDGKVAERPQHMLMRVSVGIHKTDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLCMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHYDVFEFLDLKKNTGKEEQRARDLFYAMWIPDLFMKRVENNLDWSLMCPHECPGLEEVWGDKFEELYERYEREGRARKVVKAQQLWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSDDEVAVCNLASLALNMYVTP-ERSFDFKKLADVTKVIVRNLNKIIEINFYPVPEAEYSNKRHRPIGIGVQGLADAFILMRYPFESEEAQLLNKQIFETIYYAALESSCELAKELGPYDTYEGSPVSKGILQYDMWNVTPTGLWDWAALKEKIAKYGVRNSLLLAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLMKDLTERGLWNEEMKNQIIANNGSIQNVPDIPADLKELYKTVWEISQKTVITMAADRGAFIDQSQSLNIHVAEPNYGKLTSMHFFGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 729          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Xenopus
Match: rrm1 (ribonucleotide reductase M1 [Source:NCBI gene;Acc:100145720])

HSP 1 Score: 967.222 bits (2499), Expect = 0.000e+0
Identity = 471/731 (64.43%), Postives = 581/731 (79.48%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKK 2289
            +HV+KR+G +E + FDKIT+R+ KLC     E +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N ++   G+ S +++ +  ++V+ N + LN++I Y+RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR +VGIHK DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH D+ EFL+L+KN G E ++ARDLF A+WIPDLFMKRV+++ +W+LM PH+C GL E WG+KF++LYE YE +G   K +KA+ LW  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V P  ++FDF +L  VT V+  NLNKII+IN YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES+EA  LNK+IFETIY+ AL+ SCELAK+ G Y+TY+GSPVSKG+LQ DMWNV  +   DW  L+  IAKYGVRNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIAN GSIQN+  +P ++KEL+KTVWEI Q  +I +AADR  FIDQSQS+N HVA P+Y  LTS+HF  WK+
Sbjct:    1 MHVIKRDGRQERVMFDKITSRIQKLCYGLNLEFVDPAQITMKVIQGLYNGVTTIELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKIFSDVMEDLYNYVNPLNGKHSPMVSKETLDLVLANKDRLNSSIIYDRDFSYNFFGFKTLERSYLLKIDGKVAERPQHMLMRVSVGIHKTDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLCMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHYDVFEFLDLKKNTGKEEQRARDLFYAMWIPDLFMKRVENNLDWSLMCPHECPGLEEVWGDKFEELYERYEREGRARKVVKAQQLWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSDDEVAVCNLASLALNMYVTP-ERSFDFKKLADVTKVIVRNLNKIIEINFYPVPEAEYSNKRHRPIGIGVQGLADAFILMRYPFESEEAQLLNKQIFETIYYAALESSCELAKELGPYDTYEGSPVSKGILQYDMWNVTPTGLWDWAALKEKIAKYGVRNSLLLAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLMKDLTERGLWNEEMKNQIIANNGSIQNVPDIPADLKELYKTVWEISQKTVITMAADRGAFIDQSQSLNIHVAEPNYGKLTSMHFFGWKQ 730          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Xenopus
Match: rrm1 (ribonucleotide reductase M1 [Source:NCBI gene;Acc:100145720])

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 475/743 (63.93%), Postives = 579/743 (77.93%), Query Frame = 1
Query:  139 FDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            FDKIT+R+ KLC     E +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N ++   G+ S +               LN++I Y+RDF  ++FGF+ + +S L  +  +   RPQHM MR +VGIHK DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH D+ EFL+L+KN G E ++ARDLF A+WIPDLFMKRV+++ +W+LM PH+C GL E WG+KF++LYE YE +G   K +KA+ LW  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V P  ++FDF +L  VT V+  NLNKII+IN YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES+EA  LNK+IFETIY+ AL+ SCELAK+ G Y+TY+GSPVSKG+LQ DMWNV  +   DW  L+  IAKYGVRNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIAN GSIQN+  +P ++KEL+KTVWEI Q  +I +AADR  FIDQSQS+N HVA P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    2 FDKITSRIQKLCYGLNLEFVDPAQITMKVIQGLYNGVTTIELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKIFSDVMEDLYNYVNPLNGKHSPM--------------RLNSSIIYDRDFSYNFFGFK-VNKSKLKFLTPRW--RPQHMLMRVSVGIHKTDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLCMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHYDVFEFLDLKKNTGKEEQRARDLFYAMWIPDLFMKRVENNLDWSLMCPHECPGLEEVWGDKFEELYERYEREGRARKVVKAQQLWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSDDEVAVCNLASLALNMYVTP-ERSFDFKKLADVTKVIVRNLNKIIEINFYPVPEAEYSNKRHRPIGIGVQGLADAFILMRYPFESEEAQLLNKQIFETIYYAALESSCELAKELGPYDTYEGSPVSKGILQYDMWNVTPTGLWDWAALKEKIAKYGVRNSLLLAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLMKDLTERGLWNEEMKNQIIANNGSIQNVPDIPADLKELYKTVWEISQKTVITMAADRGAFIDQSQSLNIHVAEPNYGKLTSMHFFGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 726          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Mouse
Match: Rrm1 (ribonucleotide reductase M1 [Source:MGI Symbol;Acc:MGI:98180])

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 500/757 (66.05%), Postives = 613/757 (80.98%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +HV+KR+G +E + FDKIT+R+ KLC     + +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N I+ + GR S ++A    +IVM N + LN+AI Y+RDF  +YFGF+TLERSYLL+I  KV ERPQHM MR +VGIHK+DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL+MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH DI EFL+L+KN G E ++ARDLF ALWIPDLFMKRV+++ +W+LM P++C GL E WGE+F+KLYE YE++G   K +KA+ LW  I++SQ ETGTPYMLYKD+CN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V P   T+DF++L  VT V+  NLNKIIDIN+YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES EA  LNK+IFETIY+GAL+ SCELAK++G YETY+GSPVSKG+LQ DMWNV  +D  DW  L+  IAKYG+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIA  GSIQ+I  +PD++K+L+KTVWEI Q  ++K+AA+R  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    1 MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGRHSPMVASSTLDIVMANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTP-EHTYDFEKLAEVTKVIVRNLNKIIDINYYPIPEAHLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGALEASCELAKEYGPYETYEGSPVSKGILQYDMWNVAPTDLWDWKPLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 756          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Mouse
Match: Rrm1 (ribonucleotide reductase M1 [Source:MGI Symbol;Acc:MGI:98180])

HSP 1 Score: 65.0846 bits (157), Expect = 9.310e-13
Identity = 30/50 (60.00%), Postives = 39/50 (78.00%), Query Frame = 1
Query: 1951 EAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQ 2100
            E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIA  GSIQ
Sbjct:    3 EPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIACNGSIQ 52          
BLAST of Ribonucleoside-diphosphate reductase vs. UniProt/SwissProt
Match: sp|P48591|RIR1_DROME (Ribonucleoside-diphosphate reductase large subunit OS=Drosophila melanogaster OX=7227 GN=RnrL PE=1 SV=2)

HSP 1 Score: 1060.06 bits (2740), Expect = 0.000e+0
Identity = 501/804 (62.31%), Postives = 631/804 (78.48%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDK-GCTSC 2505
            L+V+KR+G +EE+HFDKIT+R+ KLC     + +D   ++ +VINGLY GVTT ELDNLAAEI A L   H +Y  LA RI VSN+ KETK  FS+V  DL+N ++  T +K  L+++  Y +V KNA  LN++I Y+RDF  +YFGF+TLERSYLL+   K+ ERPQHM MR A+GIH +DI+ A+ETYNL+SE++F HASPTLF A     QLSSCFLLTM  DSI+GIF ++++CA+ISK AGGIGLNVHCIRA G+ I GTNG SNGL PML+VFN  ARYVDQGG KRPGAFAIY+EPWHSD+ EFLEL+KN G E  +ARDLF ALWIPDLFMKRV+++G+W+LM PHKC GLH+ WG++F+KLYE YE++G  N+T+KA+ LW  I+++Q+ETG PYML+KDACN KSN Q++GTIKCSNLCTEIVEYS+PDEIAVCNLASI+L  FV P  KT+DF +L  VT +VT NLNKIIDIN+YPLPEAR SNLRHRP+GIG+QG AD   L+R+P+ES+EA  LN++IFETIY+GAL+ SCELA+  G YETY+GSPVSKG+LQ DMW+   ++  DW +L+  I  +GVRNSLLVAPMPTAST+QI+GNNE FE +++NIY RRVLSGEF VVN +L+ DL  L+LW DDMKN II++RGSIQNI+ +P ++++L+KTVWEI     IK+AADR  FIDQSQS N HVA P+Y  LTS+HF +WK GLKTGMYYLRT+PAA+ IQFTV+K + +  + G+N          E+D  +K++    +MVCS ++K  C SC
Sbjct:   12 LYVIKRDGRQEEVHFDKITSRIQKLCYNLNMDFVDPVTITLQVINGLYCGVTTQELDNLAAEIAAGLTCNHPDYAILAARIAVSNLHKETKKAFSDVFEDLYNHVNKETNQKVPLVSEFHYNVVKKNATRLNSSIIYDRDFGYNYFGFKTLERSYLLKRNGKIAERPQHMLMRVAIGIHGEDIDAAVETYNLLSERYFTHASPTLFAAATNRPQLSSCFLLTMTADSIEGIFKSVEQCAMISKSAGGIGLNVHCIRAKGTSICGTNGTSNGLVPMLRVFNNVARYVDQGGGKRPGAFAIYLEPWHSDVFEFLELKKNTGKEENRARDLFYALWIPDLFMKRVEANGDWSLMCPHKCPGLHDVWGDEFEKLYEKYEQEGRANRTVKAQSLWFAIIEAQVETGNPYMLFKDACNRKSNQQNVGTIKCSNLCTEIVEYSAPDEIAVCNLASIALNMFVTP-EKTYDFKKLKEVTKIVTKNLNKIIDINYYPLPEARKSNLRHRPVGIGIQGFADALILMRFPYESEEAGLLNQQIFETIYYGALEASCELAQTEGPYETYEGSPVSKGILQYDMWDKVPTNLWDWQKLKESIRMHGVRNSLLVAPMPTASTAQIMGNNESFEPYTTNIYTRRVLSGEFQVVNHHLLRDLTELDLWDDDMKNQIISSRGSIQNIETIPPKVRDLYKTVWEISVKSTIKMAADRGAFIDQSQSFNIHVAEPNYGKLTSIHFYSWKAGLKTGMYYLRTKPAANAIQFTVNKKQGAVSMNGQNGTAEGSPQKYEEDRERKMA----DMVCSLENKDACMSC 810          
BLAST of Ribonucleoside-diphosphate reductase vs. UniProt/SwissProt
Match: sp|P07742|RIR1_MOUSE (Ribonucleoside-diphosphate reductase large subunit OS=Mus musculus OX=10090 GN=Rrm1 PE=1 SV=2)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 500/757 (66.05%), Postives = 613/757 (80.98%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +HV+KR+G +E + FDKIT+R+ KLC     + +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N I+ + GR S ++A    +IVM N + LN+AI Y+RDF  +YFGF+TLERSYLL+I  KV ERPQHM MR +VGIHK+DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL+MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH DI EFL+L+KN G E ++ARDLF ALWIPDLFMKRV+++ +W+LM P++C GL E WGE+F+KLYE YE++G   K +KA+ LW  I++SQ ETGTPYMLYKD+CN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V P   T+DF++L  VT V+  NLNKIIDIN+YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES EA  LNK+IFETIY+GAL+ SCELAK++G YETY+GSPVSKG+LQ DMWNV  +D  DW  L+  IAKYG+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW+++MKN IIA  GSIQ+I  +PD++K+L+KTVWEI Q  ++K+AA+R  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    1 MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGRHSPMVASSTLDIVMANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTP-EHTYDFEKLAEVTKVIVRNLNKIIDINYYPIPEAHLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGALEASCELAKEYGPYETYEGSPVSKGILQYDMWNVAPTDLWDWKPLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 756          
BLAST of Ribonucleoside-diphosphate reductase vs. UniProt/SwissProt
Match: sp|P23921|RIR1_HUMAN (Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1)

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 496/757 (65.52%), Postives = 609/757 (80.45%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +HV+KR+G +E + FDKIT+R+ KLC     + +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N I+ + G+ S ++A    +IV+ N + LN+AI Y+RDF  +YFGF+TLERSYLL+I  KV ERPQHM MR +VGIHK+DI+ AIETYNL+SE+WF HASPTLFNAG    QLSSCFLL+MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH DI EFL+L+KN G E ++ARDLF ALWIPDLFMKRV+++ +W+LM P++C GL E WGE+F+KLY  YE++G   K +KA+ LW  I++SQ ETGTPYMLYKD+CN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLAS++L  +V  S  T+DF +L  VT VV  NLNKIIDIN+YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES EA  LNK+IFETIY+GAL+ SC+LAK+ G YETY+GSPVSKG+LQ DMWNV  +D  DW  L+  IAKYG+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW ++MKN IIA  GSIQ+I  +PD++K+L+KTVWEI Q  ++K+AA+R  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    1 MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVT-SEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 756          
BLAST of Ribonucleoside-diphosphate reductase vs. UniProt/SwissProt
Match: sp|Q5R919|RIR1_PONAB (Ribonucleoside-diphosphate reductase large subunit OS=Pongo abelii OX=9601 GN=RRM1 PE=2 SV=1)

HSP 1 Score: 1028.08 bits (2657), Expect = 0.000e+0
Identity = 494/757 (65.26%), Postives = 608/757 (80.32%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +HV+KR+G +E + FDKIT+R+ KLC     + +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KE K  FS+V+ DL+N I+ + G+ S ++A    +IV+ N + LN+AI Y+RDF  +YFGF+TLERSYLL+I  KV ERPQHM MR +VGIHK+DI+ AIETYNL+SE+WF HASPTLFNAG    QLSSCFLL+MKDDSI+GI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFAIY+EPWH DI EFL+L+KN G E ++ARDLF ALWIPDLFMKRV+++ +W+LM P++C GL E WGE+F+KLY  YE++G   K +KA+ LW  I++SQ ETGTPYMLYKD+CN KSN Q+LGTIKCS+LCTEIVEY+S DE+AVCNLAS++L  +V  S  T+DF +L  VT VV  NLNKIIDIN+YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES EA  LNK+IFETIY+GAL+ SC+LAK+ G YETY+GSPVSKG+LQ DMWNV  +D  DW  L+  IAKYG+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LW ++MKN IIA  GSIQ+I  +PD++K+L+KTVWEI Q  ++K+AA+R  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRTRPAA+PIQFT++K K
Sbjct:    1 MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKEAKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSSLCTEIVEYTSKDEVAVCNLASLALNMYVT-SEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEK 756          
BLAST of Ribonucleoside-diphosphate reductase vs. UniProt/SwissProt
Match: sp|Q9UW15|RIR1_NEUCR (Ribonucleoside-diphosphate reductase large chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=rnr-1 PE=1 SV=2)

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 477/755 (63.18%), Postives = 594/755 (78.68%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDK 2361
            ++V KR+G +E + FDKIT R+ +LC      ++D   +++KVI+G+Y GVTTA+LD+LAAE  A +   H +Y  LA RI VSN+ K+TK ++S VI +L+N ++  TG+ S +IA D+YE VM++ +  ++AI Y+RDF   YFGF+TLERSYLL++  ++ ERPQHM MR AVGI  DD+E  IETYNLMS K F HASPTLFNAG    QLSSCFL+ MK+DSI+GI+ TLK CA+ISK AGGIGLN+H IRATGS I GTNG SNG+ PML+VFN  ARYVDQGGNKRPGAFAIY+EPWH+D+ EFL+LRKNHG E  +ARDLF ALWIPDLFMKRV+ +G WTLM PH+C GL + +G++F+ LYE YE++G G KT+KA+ LW  IL++Q ETG P+MLYKDACN KSN ++LGTI+ SNLCTEI+EYS+PDE+AVCNLAS++L  F+D  + ++DF +L  VT VV  NLNKIIDINHYP+ EA  SN+RHRPIG+GVQGLAD F  LR PF+SD A+KLN +IFETIY  AL  SC+LAK+ G Y TY+GSPVS+G+LQ DMWNV  ++  DW  L+ DI KYGVRNSLL+APMPTASTSQILGNNECFE ++SNIY RRVL+GEF VVN +L+ DL+ + LWSD MKN IIA  GSIQNIQ +P+++K L+KTVWEI Q  I+K+AADR  FIDQSQS+N H+  P    +TS+HF  WK GLKTGMYYLRT+ AA PIQFTVD+
Sbjct:    1 MYVKKRDGRQERVQFDKITARVSRLCYGLDMNHVDPVAITQKVISGVYGGVTTAQLDDLAAETAAYMTVTHPDYAILAARIAVSNLHKQTKKQWSLVISELYNYVNPRTGKHSPMIAKDVYECVMRHKDEFDSAIVYDRDFNYQYFGFKTLERSYLLKLDGQIAERPQHMIMRVAVGIWGDDVERVIETYNLMSLKTFTHASPTLFNAGTPQPQLSSCFLVDMKEDSIEGIYDTLKTCAMISKMAGGIGLNIHRIRATGSYIAGTNGTSNGIVPMLRVFNNTARYVDQGGNKRPGAFAIYLEPWHADVFEFLDLRKNHGKEEVRARDLFLALWIPDLFMKRVEQNGQWTLMCPHECPGLADVYGDEFEALYEKYEKEGKGRKTVKAQKLWYAILEAQTETGNPFMLYKDACNRKSNQKNLGTIRSSNLCTEIIEYSAPDEVAVCNLASLALSAFIDYENASYDFKKLHEVTQVVVRNLNKIIDINHYPVKEAHNSNMRHRPIGVGVQGLADAFLALRMPFDSDAASKLNIQIFETIYHAALTASCQLAKEQGPYATYEGSPVSQGILQYDMWNVTPTNLWDWTALKADIKKYGVRNSLLLAPMPTASTSQILGNNECFEPYTSNIYQRRVLAGEFQVVNPWLLRDLVEMGLWSDAMKNRIIAEGGSIQNIQSIPNDIKALYKTVWEISQRTIVKMAADRGAFIDQSQSLNIHMREPTMGKITSMHFAGWKMGLKTGMYYLRTQAAAQPIQFTVDQ 755          
BLAST of Ribonucleoside-diphosphate reductase vs. TrEMBL
Match: A0A504YQ00 (Ribonucleoside-diphosphate reductase OS=Fasciola gigantica OX=46835 GN=FGIG_02556 PE=3 SV=1)

HSP 1 Score: 1087.4 bits (2811), Expect = 0.000e+0
Identity = 511/831 (61.49%), Postives = 643/831 (77.38%), Query Frame = 1
Query:   67 LVLKFNMSKFLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDY-----LDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMG--ENVKKLYENVLD-------EKDILKKLSIEG-ENMVCS-RDDKGCTSCQG 2511
            L+  F+    ++V+KR+GS E +H +KI  R+  LC       ID+  V+++V+ GLYPGVTT ELDNLAAEICA++ TKH +Y+ LA R+ +SN+ K+TKSKFSEV+ DL   +   TGR S L+AD++ EI+ KNA+ L++AIDY RD+  +YFGFRTLERSYLLR+  +V ERPQHM MR +VGIH +DIEGAIETY+LMS+KWF HASPTLFNAG    QLSSCFLLTMK DSI+GI+ TLK+CA+ISK AGG+GLNVHCIR+ G+ I GTNG SNG+ PML+VFN  ARYVDQGGNKRPGAFA+Y+EPWH D+ +F++LRKN G E  +ARDLF ALWIPDLFM+RV+ + +WT MDPH+C GL +CWGE+F+ LY  YE +G G +T++A+ +W  I+ +QIETG P+MLYKDACN KSN Q+LGTIKCSNLCTEIVEYSSPDEIAVCNLASIS+  FVD   +TFDFD+L  VT V T NLNK+ID+N YP+ EA+ SN+RHRPIG+GVQGLAD F  LRYPF+S EA  LN+RIFETIYF AL  SC+LA++ G YE+Y+G PVSKG+LQPDMW V   +      LDW  LR  I K+G+RNSLL+APMPTAST+QILGN E  E  +SN+Y RRVLSGEF ++N YL+ DLI+  LWS+D+K+AI+AN+GSIQ+IQG+P++MK L+KTVWEI Q  +I +AADR PFIDQSQS+N ++A P Y  +TS+HF +WKKGLKTGMYYLRTRPAADPIQFT+D+T    L+     NV      V+D       E  I++++     E++ CS  + +GC SC+G
Sbjct:    7 LLRAFSGIDKIYVIKRDGSTEGVHVEKIMKRIRALCYGLNESFIDVESVTRRVVTGLYPGVTTVELDNLAAEICATMTTKHYDYETLAARLAISNLHKKTKSKFSEVMEDLHQYVHPRTGRHSPLVADEVIEIIRKNADRLDSAIDYQRDYNYNYFGFRTLERSYLLRLRNEVYERPQHMLMRVSVGIHMNDIEGAIETYDLMSQKWFTHASPTLFNAGTPKPQLSSCFLLTMKSDSIEGIYDTLKQCAVISKNAGGVGLNVHCIRSLGTYIAGTNGESNGIIPMLRVFNNTARYVDQGGNKRPGAFAVYLEPWHPDVQQFVDLRKNTGAEEIRARDLFLALWIPDLFMRRVEDNADWTFMDPHECPGLEDCWGEEFEALYTKYENEGRGRRTVRAQEVWYSIIQAQIETGNPFMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYSSPDEIAVCNLASISVGHFVDVEKRTFDFDKLQYVTRVATRNLNKVIDVNFYPVIEAKRSNMRHRPIGLGVQGLADAFFRLRYPFDSPEAKLLNRRIFETIYFSALDASCQLAEELGPYESYEGCPVSKGILQPDMWGVDTEELSKISGLDWTGLRARIKKFGLRNSLLIAPMPTASTAQILGNTEATEPQTSNVYSRRVLSGEFQIINPYLLRDLIKAELWSEDLKSAIVANQGSIQHIQGIPEDMKPLYKTVWEISQKTLIDMAADRGPFIDQSQSLNLYMAQPSYGRITSMHFYSWKKGLKTGMYYLRTRPAADPIQFTIDRTSVRALMERGVTNVDASTGRVIDPAVEAEEEARIMEEIKRRNTESITCSLTNPEGCLSCEG 837          
BLAST of Ribonucleoside-diphosphate reductase vs. TrEMBL
Match: A0A4E0R952 (Ribonucleoside-diphosphate reductase OS=Fasciola hepatica OX=6192 GN=D915_005630 PE=3 SV=1)

HSP 1 Score: 1087.02 bits (2810), Expect = 0.000e+0
Identity = 512/831 (61.61%), Postives = 641/831 (77.14%), Query Frame = 1
Query:   67 LVLKFNMSKFLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDY-----LDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMG--ENVKKLYENVLD-------EKDILKKLSIEG-ENMVCS-RDDKGCTSCQG 2511
            L+  F+    ++V+KR+GS E +H +KI  R+  LC       ID+  V+++V+ GLYPGVTT ELDNLAAEICA++ TKH +Y+ LA R+ +SN+ K+TKSKFSEV+ DL   +   TGR S L+AD++ EI+ KNA+ L++AIDY RD+  +YFGFRTLERSYLLR+  +V ERPQHM MR +VGIH +DIEGAIETY+LMS+KWF HASPTLFNAG    QLSSCFLLTMK DSI+GI+ TLK+CA+ISK AGG+GLNVHCIR+ G+ I GTNG SNG+ PML+VFN  ARYVDQGGNKRPGAFA+Y+EPWH D+ +F++LRKN G E  +ARDLF ALWIPDLFM+RV+ + +WT MDPH+C GL +CWGE+F+ LY  YE +G G +T++A+ +W  I+ +QIETG P+MLYKDACN KSN Q+LGTIKCSNLCTEIVEYSSPDEIAVCNLASISL  FVD   +TFDFD+L  VT V T NLNK+ID+N YP+ EA+ SN+RHRPIG+GVQGLAD F  LRYPF+S EA  LN+RIFETIYF AL  SC+LA++ G YE+Y+G PVSKG+LQPDMW V   +      LDW  LR  I K+G+RNSLL+APMPTAST+QILGN E  E  +SN+Y RRVLSGEF ++N YL+ DLI+  LWS+D+K+AI+AN+GSIQ+IQG+P +MK L+KTVWEI Q  +I +AADR PFIDQSQS+N ++A P Y  +TS+HF  WKKGLKTGMYYLRTRPAADPIQFT+D+T    L+     NV      V+D       E  I++++     E++ CS  + +GC SC+G
Sbjct:    7 LLRAFSGIDKIYVIKRDGSTEGVHVEKIMKRIRALCYGLNESFIDVESVTRRVVTGLYPGVTTVELDNLAAEICATMTTKHYDYETLAARLAISNLHKKTKSKFSEVMEDLHQYVHPRTGRHSPLVADEVIEIIRKNADRLDSAIDYQRDYNYNYFGFRTLERSYLLRLRNEVYERPQHMLMRVSVGIHMNDIEGAIETYDLMSQKWFTHASPTLFNAGTPKPQLSSCFLLTMKSDSIEGIYDTLKQCAVISKNAGGVGLNVHCIRSLGTYIAGTNGESNGIIPMLRVFNNTARYVDQGGNKRPGAFAVYLEPWHPDVQQFVDLRKNTGAEEIRARDLFLALWIPDLFMRRVEDNADWTFMDPHECPGLEDCWGEEFEALYTKYENEGRGRRTVRAQEVWYSIIQAQIETGNPFMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLGHFVDVEKRTFDFDKLQYVTRVATRNLNKVIDVNFYPVIEAKRSNMRHRPIGLGVQGLADAFFRLRYPFDSPEAKLLNRRIFETIYFSALDASCQLAEELGPYESYEGCPVSKGILQPDMWGVDTEELSKVSGLDWTGLRARIKKFGLRNSLLIAPMPTASTAQILGNTEATEPQTSNVYSRRVLSGEFQIINPYLLRDLIKAELWSEDLKSAIVANQGSIQHIQGIPQDMKPLYKTVWEISQKTLIDMAADRGPFIDQSQSLNLYMAQPSYGRITSMHFYGWKKGLKTGMYYLRTRPAADPIQFTIDRTSVRALMERGVTNVDASTGRVIDPAVEAEEEARIMEEIKRRNTESITCSLTNPEGCLSCEG 837          
BLAST of Ribonucleoside-diphosphate reductase vs. TrEMBL
Match: A0A4Z2DY85 (Ribonucleoside-diphosphate reductase OS=Schistosoma japonicum OX=6182 GN=EWB00_010921 PE=3 SV=1)

HSP 1 Score: 1084.71 bits (2804), Expect = 0.000e+0
Identity = 522/815 (64.05%), Postives = 631/815 (77.42%), Query Frame = 1
Query:  115 NGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDY-----LDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKT-------KASKLIMGENVKKLYENVLDEKDILKKLSIEGEN---MVCSRDD-KGCTSCQG 2511
            +G  E IH +KIT R+  LC       ID+  V+K+V++GLYPGVTT ELDNLAAE CAS++TKH EY  LA R+ VSN+ KETKS+FS+V+ DL+  I+  T + S L+++D+   V +NAE L+NAIDY RD+  +YFGF+TLERSYLL+I  KV ERPQHM MR +VGIH  DIE AIETYNLMSEKWF HASPTLFN+G    QLSSCFL+TMKDDSI+GI+ TLKECA+ISK AGGIG+NVH IR+ G+ I GTNG SNGL PML+VFN  ARYVDQGGNKRPGAFAIY+EPWH D+ +F+E+RKN G E  +ARDLF ALWIPDLFM+RV+S+  WTLMDPH+C GL E WGEKF+ LYE YE +G G +T+KA+ LW  I++ QIETG P+MLYKD+CN KSNHQHLGTI+CSNLCTEIVEYSSPDE AVCNLASISL KFVD  + TFDF +L  VT VVT NLNK+ID++ YP+ EAR SN+RHRPIGIGVQGLAD F LLRYPF+S EAA LNKRIFET+YF AL  SC+LA   GTYE+Y GSPVSKG+LQPDMW V   +      LDW  LR  I KYG+RNSLL+APMPTASTSQILGNNE  E F+SN++ RRVLSGEF VVN YL++DL +L LWS+++K AI+ N+GSIQ+I G+P+ +K L+KTVWEI Q  II +AA RAPFIDQSQS+N H+A P+Y  +TS+HF  WKKGLKTGMYYLRTRPAADPI+F+VDKT         +K    +N   + + V   +++     I+  N   + CS ++ +GC SCQG
Sbjct:   17 DGRSEAIHCEKITKRIRALCYGLNESYIDVDAVTKRVVSGLYPGVTTVELDNLAAETCASMITKHHEYAILAARLAVSNLHKETKSRFSDVVEDLYGYINPRTKKHSPLVSEDLRNFVRENAERLDNAIDYQRDYTYNYFGFKTLERSYLLKINGKVHERPQHMLMRVSVGIHTSDIESAIETYNLMSEKWFTHASPTLFNSGTPKPQLSSCFLITMKDDSIEGIYDTLKECAIISKNAGGIGVNVHNIRSLGTYIAGTNGESNGLVPMLRVFNSTARYVDQGGNKRPGAFAIYLEPWHPDVFQFIEMRKNTGAEEIRARDLFFALWIPDLFMRRVESNDKWTLMDPHECPGLPELWGEKFEALYEKYEREGRGRQTVKAQELWYAIIECQIETGNPFMLYKDSCNRKSNHQHLGTIRCSNLCTEIVEYSSPDETAVCNLASISLGKFVDRENLTFDFTKLQEVTKVVTRNLNKVIDVSFYPVEEARKSNMRHRPIGIGVQGLADTFCLLRYPFDSPEAADLNKRIFETMYFAALDASCQLAVDQGTYESYDGSPVSKGILQPDMWGVDTEELSKVSGLDWSGLRTRIKKYGLRNSLLLAPMPTASTSQILGNNESTEPFTSNVFSRRVLSGEFQVVNPYLLDDLTKLGLWSEELKTAIVLNQGSIQHIDGIPETLKPLYKTVWEISQRKIIDMAAGRAPFIDQSQSLNLHLAQPNYGKITSMHFYTWKKGLKTGMYYLRTRPAADPIKFSVDKTILRVLTDSTTKANTPQNSDSIDQTVEAIEELRIIEEIQKRNADAIACSLNNPEGCLSCQG 831          
BLAST of Ribonucleoside-diphosphate reductase vs. TrEMBL
Match: G4VIG3 (Ribonucleoside-diphosphate reductase OS=Schistosoma mansoni OX=6183 GN=Smp_009030 PE=3 SV=1)

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 521/831 (62.70%), Postives = 640/831 (77.02%), Query Frame = 1
Query:   67 LVLKFNMSKFLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDY-----LDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKT-------KASKLIMGENVKKLYENVLDEKDILKKLSIEGENM---VCSRDD-KGCTSCQG 2511
            L+ +F+    ++VVKR+G  E IH +KIT R+  +C       ID+  V+K+V++GLYPGVTT ELDNLAAE CAS++TKH EY  LA R+ VSN+ KETKS+FS+V+ DL+  I+  T + S L++  + + V +NA  LN+AIDY RD+  +YFGF+TLERSYLL+I  KV ERPQHM MR ++GIH  DI+ AIETYNLMSEKWF HASPTLFNAG    QLSSCFL+TMKDDSI+GI+ TLKECA+ISK AGGIGLNVH IR+ G+ I GTNG SNG+ PML+VFN  ARYVDQGGNKRPGAFA+Y+EPWH D+ +F+E+RKN G E  +ARDLF ALWIPDLFM+RV+S+  WTLMDPH+C GL E WGE FD LYE YE +G G +T+KA+ LW  I++ QIETG P+MLYKD+CN KSNHQHLGTI+CSNLCTEIVEYSSPDE AVCNLASISL KFV+  + TFDF +L  VT VVT NLNK+ID+  YP+ EAR SN+RHRPIGIGVQGLAD F LLRYPF+S EAA LNKRIFET+YF +L  SC+LA   GTYE+Y+GSPVSKG+LQPDMW V   +      LDW  LR  I KYG+RNSLL+APMPTASTSQILGNNE  E F+SN++ RRVLSGEF +VN YL++DL +L LWS+++K AI+ N+GSIQ+I G+P E+K L+KTVWEI Q  II +AA RAPFIDQSQS+N H+A P+Y  +TS+HF AW+KGLKTGMYYLRTRPAADPI+F+VDKT         +K    +N   + + V   +++     I+  N+    CS ++ +GC SCQG
Sbjct:    7 LLREFSGIDKIYVVKRDGRNEAIHCEKITKRIRAMCYGLNESYIDVEAVTKRVVSGLYPGVTTVELDNLAAETCASMITKHHEYAILAARLAVSNLHKETKSRFSDVVEDLYCYINPRTKKHSPLVSKSLRDFVRENAGRLNDAIDYQRDYTYNYFGFKTLERSYLLKINGKVHERPQHMLMRVSIGIHTSDIDSAIETYNLMSEKWFTHASPTLFNAGTPKPQLSSCFLITMKDDSIEGIYDTLKECAVISKNAGGIGLNVHNIRSLGTYIAGTNGESNGIVPMLRVFNSTARYVDQGGNKRPGAFAMYLEPWHPDVFQFIEMRKNTGAEEIRARDLFFALWIPDLFMRRVESNDKWTLMDPHECPGLPEVWGEDFDTLYEKYEREGRGRQTVKAQELWYAIIECQIETGNPFMLYKDSCNRKSNHQHLGTIRCSNLCTEIVEYSSPDETAVCNLASISLGKFVNRDNLTFDFAKLQEVTKVVTRNLNKVIDVTFYPVEEARRSNMRHRPIGIGVQGLADAFCLLRYPFDSPEAADLNKRIFETMYFASLDASCQLAVDQGTYESYQGSPVSKGILQPDMWGVDTEELSKVSGLDWSGLRARINKYGLRNSLLLAPMPTASTSQILGNNESTEPFTSNVFSRRVLSGEFQIVNPYLLDDLTKLELWSEELKTAIVLNQGSIQHIDGIPKELKPLYKTVWEISQKKIIDMAAGRAPFIDQSQSLNLHLAQPNYGKITSMHFYAWRKGLKTGMYYLRTRPAADPIKFSVDKTILRVLTDSTTKTNEPQNNDSIDQTVEAIEELRIIEEIQKRNLDSIACSLNNPEGCLSCQG 837          
BLAST of Ribonucleoside-diphosphate reductase vs. TrEMBL
Match: W8C3W0 (Ribonucleoside-diphosphate reductase OS=Ceratitis capitata OX=7213 GN=RIR1 PE=2 SV=1)

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 520/807 (64.44%), Postives = 632/807 (78.31%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGEN---MVCSRDDK-GCTSC 2505
            L+V+KR+G KE+IHFDKIT+R+ KLC     E +D   ++ KVINGLY GVTT ELDNLAAEI ASL T+H +Y  LA RI +SN+ KETK  FS+VI  L+N +S  TG  + +I+D  Y +V K+A+ LN+AI Y+RDF  +YFGF+TLERSYLL++  K+VERPQHM MR A+GIH +DI+ AI+TYNL+SE++F HASPTLF A  K  QLSSCFLLTM DDSIDGIF++  +CALISK AGGIGLNVHCIRA G+ I GTNG SNGL PML+VFN  ARYVDQGG KRPGAFAIY+EPWH+DI EFL+L+KN G E  +ARDLF ALWIPDLFMKRV+++ +W+LM PHKC GLHE WGE+F+KLY  YE++G  NK +KA+ LW  I++SQ+ETGTPYMLYKDACN KSN Q++GTIKCSNLCTEIVEYS+PDE+AVCNLASI+L  FV P  K +DF  L  VT  VT NLNKIIDINHYPLPEA+ SN RHRPIGIGVQGLAD   L+RYP+ES++A  LN++IFETIY+GAL+ SCELA+KFG YETY+GSPVSKG+LQ DMW+ K ++  +W +L+  I K+GVRNSLL+APMPTAST+QI+GNNE FE ++SNIY RRVLSGEF VVN +L+ DL  L LW DDMKN II +RGSIQNI+ +P  ++EL+KTVWEI     IK+AADR  FIDQSQS N HVA P+Y  LTS+HF  WK GLKTGMYYLRT+PAA+ IQFTVDK++          K+L +      +I  K  +E +N   MVCS ++K  C SC
Sbjct:    6 LYVIKRDGRKEDIHFDKITSRVQKLCYGLNMEFVDPVAITLKVINGLYCGVTTQELDNLAAEIAASLTTQHADYATLAARIAISNLHKETKKVFSDVISALYNHVSDETGLPTPIISDFHYNVVKKHADRLNSAIIYDRDFGYNYFGFKTLERSYLLKLNGKIVERPQHMLMRVAIGIHGEDIDAAIDTYNLLSERYFTHASPTLFAAATKQPQLSSCFLLTMVDDSIDGIFTSAHQCALISKSAGGIGLNVHCIRAKGTSIAGTNGTSNGLVPMLRVFNNVARYVDQGGGKRPGAFAIYLEPWHADIFEFLDLKKNTGKEEHRARDLFYALWIPDLFMKRVEANEDWSLMCPHKCPGLHEVWGEEFEKLYTKYEQEGRANKKVKAQSLWFSIIESQVETGTPYMLYKDACNRKSNQQNIGTIKCSNLCTEIVEYSAPDEVAVCNLASIALNMFVTPDKK-YDFKRLKEVTKTVTRNLNKIIDINHYPLPEAKKSNFRHRPIGIGVQGLADALILMRYPYESEQAFLLNQQIFETIYYGALEASCELAEKFGPYETYEGSPVSKGILQYDMWDKKPTELWNWTELKEKIKKHGVRNSLLLAPMPTASTAQIMGNNESFEPYTSNIYTRRVLSGEFQVVNHHLLRDLTELGLWDDDMKNQIITSRGSIQNIESIPQNIRELYKTVWEISVKTSIKMAADRGAFIDQSQSFNIHVAEPNYGKLTSIHFYGWKAGLKTGMYYLRTKPAANAIQFTVDKSR----------KELND------EIKAKPPVENQNLADMVCSLENKDACMSC 795          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Cavefish
Match: rrm1 (ribonucleotide reductase catalytic subunit M1 [Source:NCBI gene;Acc:103038586])

HSP 1 Score: 1024.23 bits (2647), Expect = 0.000e+0
Identity = 499/804 (62.06%), Postives = 619/804 (76.99%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKG-CTSC 2505
            ++V+KR+G +E + FDKIT+R+ KLC     + +D  +++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FSEV+ DL+N ++   GR S +I+ D  +I++ N + LN+AI ++RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR AVGIHK+DI  AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL M+DDSIDGI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFA+Y+EPWH DI +FLEL+KN G E ++ARDLF ALWIPDLFMKRV+++  W+LM P+ C GL ECWGE+F+KLY  YE++G   + +KA+ +W  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLASI+L  +V P  +TFDF +L  VT V+  NLNKIIDIN+YP+ EA  SN RHRPIGIGVQGLAD F L+R+PFES EA  LN +IFETIY+ AL+ SCELA + G YETY GSPVSKG+LQ DMW    +D  DW +L+  IAK G+RNSLL+APMPTAST+QILGNNE  E ++SN Y RRVLSGEF +VN +L++DL    LWS+DMKN +IA+ GSIQ I  +PD++KEL+KTVWEI Q V++K+AADR  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRT+PAA PIQFT++K         E +K+      +E++I ++ +     MVCS +++  C  C
Sbjct:    1 MYVLKRDGRQERVMFDKITSRIQKLCYGLNSDFVDPTQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSEVMEDLYNYVNPLNGRHSPMISKDTLDIILANKDRLNSAIIFDRDFSYNFFGFKTLERSYLLKIDGKVAERPQHMLMRVAVGIHKEDIAAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLAMRDDSIDGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAMYLEPWHFDIFDFLELKKNTGKEEQRARDLFYALWIPDLFMKRVETNAEWSLMCPNDCPGLDECWGEEFEKLYTRYEQEGKAKRVVKAQQVWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASIALNMYVTP-DRTFDFQKLASVTKVIVRNLNKIIDINYYPVIEAERSNKRHRPIGIGVQGLADAFILMRFPFESAEAQLLNTQIFETIYYAALESSCELAAEHGPYETYAGSPVSKGILQYDMWEKTPTDLWDWKELKEKIAKNGIRNSLLLAPMPTASTAQILGNNESIEPYTSNFYTRRVLSGEFQIVNPHLLKDLTERGLWSEDMKNQLIAHNGSIQGIPTIPDDLKELYKTVWEISQKVVLKMAADRGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTKPAAKPIQFTLNK---------EKLKEPQTTKSNEEEIKERNTAA---MVCSLENRDECLMC 791          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Cavefish
Match: rrm1 (ribonucleotide reductase catalytic subunit M1 [Source:NCBI gene;Acc:103038586])

HSP 1 Score: 1015.37 bits (2624), Expect = 0.000e+0
Identity = 496/798 (62.16%), Postives = 613/798 (76.82%), Query Frame = 1
Query:  115 NGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKG-CTSC 2505
            +G +E + FDKIT+R+ KLC     + +D  +++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FSEV+ DL+N ++   GR S +I+ D  +I++ N + LN+AI ++RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR AVGIHK+DI  AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL M+DDSIDGI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFA+Y+EPWH DI +FLEL+KN G E ++ARDLF ALWIPDLFMKRV+++  W+LM P+ C GL ECWGE+F+KLY  YE++G   + +KA+ +W  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLASI+L  +V P  +TFDF +L  VT V+  NLNKIIDIN+YP+ EA  SN RHRPIGIGVQGLAD F L+R+PFES EA  LN +IFETIY+ AL+ SCELA + G YETY GSPVSKG+LQ DMW    +D  DW +L+  IAK G+RNSLL+APMPTAST+QILGNNE  E ++SN Y RRVLSGEF +VN +L++DL    LWS+DMKN +IA+ GSIQ I  +PD++KEL+KTVWEI Q V++K+AADR  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRT+PAA PIQFT++K         E +K+      +E++I ++ +     MVCS +++  C  C
Sbjct:    5 DGRQERVMFDKITSRIQKLCYGLNSDFVDPTQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSEVMEDLYNYVNPLNGRHSPMISKDTLDIILANKDRLNSAIIFDRDFSYNFFGFKTLERSYLLKIDGKVAERPQHMLMRVAVGIHKEDIAAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLAMRDDSIDGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAMYLEPWHFDIFDFLELKKNTGKEEQRARDLFYALWIPDLFMKRVETNAEWSLMCPNDCPGLDECWGEEFEKLYTRYEQEGKAKRVVKAQQVWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASIALNMYVTP-DRTFDFQKLASVTKVIVRNLNKIIDINYYPVIEAERSNKRHRPIGIGVQGLADAFILMRFPFESAEAQLLNTQIFETIYYAALESSCELAAEHGPYETYAGSPVSKGILQYDMWEKTPTDLWDWKELKEKIAKNGIRNSLLLAPMPTASTAQILGNNESIEPYTSNFYTRRVLSGEFQIVNPHLLKDLTERGLWSEDMKNQLIAHNGSIQGIPTIPDDLKELYKTVWEISQKVVLKMAADRGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTKPAAKPIQFTLNK---------EKLKEPQTTKSNEEEIKERNTAA---MVCSLENRDECLMC 789          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Cavefish
Match: rrm1 (ribonucleotide reductase catalytic subunit M1 [Source:NCBI gene;Acc:103038586])

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 463/790 (58.61%), Postives = 569/790 (72.03%), Query Frame = 1
Query:  139 FDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKG-CTSC 2505
            FDKIT+R+ KLC     + +D  +++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FSEV+ DL+N ++   GR S +I+ D  +I++ N + LN+AI ++RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR AVGIHK+DI  AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL M+DDSIDGI+ TLK+CALISK AGGIG+ V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFA+Y+EPWH DI +FLEL+KN G E ++ARDLF ALWIPDLFMKRV+++  W+LM P+ C GL ECWGE+F+KLY  YE++G   + +KA+ +W  I++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE                                                   A  SN RHRPIGIGVQGLAD F L+R+PFES EA  LN +IFETIY+ AL+ SCELA + G YETY GSPVSKG+LQ DMW    +D  DW +L+  IAK G+RNSLL+APMPTAST+QILGNNE  E ++SN Y RRVLSGEF +VN +L++DL    LWS+DMKN +IA+ GSIQ I  +PD++KEL+KTVWEI Q V++K+AADR  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRT+PAA PIQFT++K         E +K+      +E++I ++ +     MVCS +++  C  C
Sbjct:    2 FDKITSRIQKLCYGLNSDFVDPTQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSEVMEDLYNYVNPLNGRHSPMISKDTLDIILANKDRLNSAIIFDRDFSYNFFGFKTLERSYLLKIDGKVAERPQHMLMRVAVGIHKEDIAAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLAMRDDSIDGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAMYLEPWHFDIFDFLELKKNTGKEEQRARDLFYALWIPDLFMKRVETNAEWSLMCPNDCPGLDECWGEEFEKLYTRYEQEGKAKRVVKAQQVWYAIIESQTETGTPYMLYKDACNRKSNQQNLGTIKCSNLCTEIVEYTSKDE---------------------------------------------------AERSNKRHRPIGIGVQGLADAFILMRFPFESAEAQLLNTQIFETIYYAALESSCELAAEHGPYETYAGSPVSKGILQYDMWEKTPTDLWDWKELKEKIAKNGIRNSLLLAPMPTASTAQILGNNESIEPYTSNFYTRRVLSGEFQIVNPHLLKDLTERGLWSEDMKNQLIAHNGSIQGIPTIPDDLKELYKTVWEISQKVVLKMAADRGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTKPAAKPIQFTLNK---------EKLKEPQTTKSNEEEIKERNTAA---MVCSLENRDECLMC 728          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Yeast
Match: RNR3 (Minor isoform of large subunit of ribonucleotide-diphosphate reductase; the RNR complex catalyzes rate-limiting step in dNTP synthesis, regulated by DNA replication and DNA damage checkpoint pathways via localization of small subunits; RNR3 has a paralog, RNR1, that arose from the whole genome duplication [Source:SGD;Acc:S000001328])

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 462/764 (60.47%), Postives = 586/764 (76.70%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFV----DPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASK 2376
            ++V+KR+G KE + FDKIT+R+ +L        ID  KV++++I+G+Y GVTT ELDNLAAE CA + T H +Y  LA RI +SN+ K+T  +FS+VI DL + I+  TG+ + +I+D+IY IVM+N +TLN+AI Y+RDF   YFGF+TLERSYLLR+  +V ERPQH+ MR A+GIH  DIE  ++TYNLMS ++F HASPTLFNAG  + Q+SSCFL+ MKDDSI+GI+ TLKECA+ISK AGG+GL+++ IR+TGS I GTNG SNGL PM++VFN  ARYVDQGGNKRPGAFA+++EPWH+DI +F+++RK HG E  +ARDLF ALWIPDLFMKRVQ DG WTL  P    GL + WG++F++LY  YE +G G KTIKA+ LW  IL +Q ETGTP+M+YKDACN K+N Q+LGTIK SNLC EIVEYSSPDE AVCNLASI+LP FV    D  + +++F+ L  +  V+T+NLN++ID N+YP+PEAR SN++HRPI +GVQGLAD + +LR PFES+EA  LNK+IFETIY   L+ SCELA+K G Y T++GSP SKG+LQ DMWN K     DW  LR DI K+G+RNSL +APMPTASTSQILG NECFE  +SN+Y RRVLSGEF VVN YL+ DL+ L +W D MK  +I   GSIQ +  +P E+KEL+KTVWEI Q  II +AADRA +IDQS S+N  + AP    +TS+HF  WKKGLKTGMYYLRT+ A+  IQFT+D+  A +
Sbjct:    1 MYVIKRDGRKEPVQFDKITSRITRLSYGLDPNRIDAVKVTQRIISGVYSGVTTVELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSKVIEDLHDWINPATGKHAPMISDEIYNIVMENKDTLNSAIVYDRDFQYTYFGFKTLERSYLLRLNGEVAERPQHLVMRVALGIHGSDIESVLKTYNLMSLRYFTHASPTLFNAGTPHPQMSSCFLIAMKDDSIEGIYDTLKECAMISKTAGGVGLHINNIRSTGSYIAGTNGTSNGLIPMIRVFNNTARYVDQGGNKRPGAFALFLEPWHADIFDFVDIRKTHGKEEIRARDLFPALWIPDLFMKRVQEDGPWTLFSPSAAPGLDDVWGDEFEELYTRYEREGRG-KTIKAQKLWYAILQAQTETGTPFMVYKDACNRKTNQQNLGTIKSSNLCCEIVEYSSPDETAVCNLASIALPAFVEVSEDGKTASYNFERLHEIAKVITHNLNRVIDRNYYPVPEARNSNMKHRPIALGVQGLADTYMMLRLPFESEEAQTLNKQIFETIYHATLEASCELAQKEGKYSTFEGSPASKGILQFDMWNAKPFGMWDWETLRKDIVKHGLRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVLSGEFQVVNPYLLRDLVDLGIWDDSMKQYLITQNGSIQGLPNVPQELKELYKTVWEISQKTIINMAADRAIYIDQSHSLNLFLQAPSMGKITSMHFYGWKKGLKTGMYYLRTQAASAAIQFTIDQEVADQ 763          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Yeast
Match: RNR1 (Major isoform of large subunit of ribonucleotide-diphosphate reductase; the RNR complex catalyzes rate-limiting step in dNTP synthesis, regulated by DNA replication and DNA damage checkpoint pathways via localization of small subunits; relative distribution to the nucleus increases upon DNA replication stress; RNR1 has a paralog, RNR3, that arose from the whole genome duplication [Source:SGD;Acc:S000000872])

HSP 1 Score: 983.015 bits (2540), Expect = 0.000e+0
Identity = 463/774 (59.82%), Postives = 592/774 (76.49%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPS----SKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKL 2406
            ++V KR+G KE + FDKIT R+ +LC     ++ID  KV++++I+G+Y GVTT ELDNLAAE CA + T H +Y  LA RI +SN+ K+T  +FS+V+ DL+  ++  TG+ + +I+DD+Y IVM+N + LN+AI Y+RDF   YFGF+TLERSYLLRI  +V ERPQH+ MR A+GIH  DIE A+ETYNLMS K+F HASPTLFNAG    Q+SSCFL+ MK+DSI+GI+ TLKECALISK AGGIGL++H IR+TGS I GTNG SNGL PM++VFN  ARYVDQGGNKRPGAFA+Y+EPWH+DI +F+++RKNHG E  +ARDLF ALWIPDLFMKRV+ +G WTL  P    GL +C+G++F+ LY  YE++G G KTIKA+ LW  IL++Q ETGTP+++YKDACN KSN ++LG IK SNLC EIVEYS+PDE AVCNLAS++LP F++ S    + T++F +L  +  VVT NLN++ID N+YP+ EAR SN+RHRPI +GVQGLAD F LLR PF+S+EA  LN +IFETIY  +++ SCELA+K G YET++GSP S+G+LQ DMW+ K     DW  LR DI K+GVRNSL +APMPTASTSQILG NECFE  +SN+Y RRVLSGEF VVN YL+ DL+ L +W + MK  +I   GSIQ +  +P E+K+L+KTVWEI Q  II +AADR+ +IDQS S+N  + AP    LTS+HF  WKKGLKTGMYYLRT+ A+  IQFT+D+  A +    ENV  +
Sbjct:    1 MYVYKRDGRKEPVQFDKITARISRLCYGLDPKHIDAVKVTQRIISGVYEGVTTIELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSKVVEDLYRYVNAATGKPAPMISDDVYNIVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQVAERPQHLIMRVALGIHGRDIEAALETYNLMSLKYFTHASPTLFNAGTPKPQMSSCFLVAMKEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMIRVFNNTARYVDQGGNKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFPALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEALYTRYEKEGRG-KTIKAQKLWYSILEAQTETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVEYSAPDETAVCNLASVALPAFIETSEDGKTSTYNFKKLHEIAKVVTRNLNRVIDRNYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQIFETIYHASMEASCELAQKDGPYETFQGSPASQGILQFDMWDQKPYGMWDWDTLRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVLSGEFQVVNPYLLRDLVDLGIWDEGMKQYLITQNGSIQGLPNVPQELKDLYKTVWEISQKTIINMAADRSVYIDQSHSLNLFLRAPTMGKLTSMHFYGWKKGLKTGMYYLRTQAASAAIQFTIDQKIADQAT--ENVADI 771          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Nematostella
Match: EDO49794 (Ribonucleoside-diphosphate reductase [Source:UniProtKB/TrEMBL;Acc:A7RFW8])

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 498/808 (61.63%), Postives = 617/808 (76.36%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKF--VDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDK-GCTSCQG 2511
            L+V+KRNG  E ++ DKIT+R+ KLC   + E +    ++ KVI+G+Y GV T ELD LAAE  AS+ TKH +Y  LA RI VSN+ KETK  FSEV+ +L+N ++    + S LI+ +  +I+ K+A+ LN+AI Y+RD+  +YFGF+TL RSYLL+I  KV ERPQHM MR +VGIH +DI+ AIETYNLMSEKWF HASPTLFNAG    Q+SSCFLLTM DDSI+GI+ TL+ CALISK AGGIG+NVHCIRA GS I GTNG SNGL PML+V++  ARYVDQGGNKRPGAFAIY+EPWH+DILEFL+L+KN G E ++ARDLF ALWIPDLFMKRV++DG W+LM P++C GL +C+GEKF+KLYE YE +G   + IKA+ LW  IL+SQ ETGTPYMLYKDACN+KSN ++LGTIKCSNLCTEIVEYS+PDE+AVCNLASI+L +F  VD S   F+F +L  VT VVT NLNKIID+N+YP+PEAR SN RHRPIGIGVQGLAD F L+RYPFES +A +LNK IFETIY+GA+  SC+LA   G YETY+GSP S+G+LQ D+WNV  S+  DW  L+  + ++G+RNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL  + LW+D MKN +IAN GSIQ+I+ +P ++K L+KTVWEI Q V+I +AADR  FIDQSQS N  +A P +  LTS+HF  WKKGLKTGMYYLR+RPA + IQFTVD+T  +K    ++     E         K    E     C RD+  GC  C G
Sbjct:   11 LYVLKRNGDSERVYLDKITSRISKLCYGLKNEFVKPINITMKVISGIYQGVKTTELDTLAAETAASMTTKHPDYAILAARIEVSNLHKETKKVFSEVMEELYNYVNPKNNKHSPLISKETLDIIQKHADRLNSAIIYDRDYQYNYFGFKTLMRSYLLKINGKVAERPQHMLMRVSVGIHGEDIDAAIETYNLMSEKWFTHASPTLFNAGTNRPQMSSCFLLTMSDDSIEGIYGTLRTCALISKNAGGIGVNVHCIRAAGSYIAGTNGHSNGLVPMLRVYDSTARYVDQGGNKRPGAFAIYLEPWHADILEFLDLKKNTGKEEQRARDLFYALWIPDLFMKRVEADGMWSLMCPNQCPGLQDCYGEKFEKLYEKYESQGKYMRQIKAQKLWFAILESQTETGTPYMLYKDACNSKSNQKNLGTIKCSNLCTEIVEYSAPDEVAVCNLASIALNRFVNVDKSPPEFNFQKLFEVTQVVTKNLNKIIDVNYYPVPEARKSNFRHRPIGIGVQGLADAFILMRYPFESQKAQELNKLIFETIYYGAVTASCDLAATNGPYETYEGSPASQGLLQYDLWNVTPSNLWDWEALKKKVKEHGLRNSLLIAPMPTASTAQILGNNESIEPYTSNIYSRRVLSGEFQIVNHHLLKDLTEMGLWNDGMKNQLIANNGSIQDIKEIPADLKALYKTVWEIKQRVLIDMAADRGAFIDQSQSFNVFIAQPTFSKLTSMHFYGWKKGLKTGMYYLRSRPAVNAIQFTVDQTALAKKKASDSSPTSNEE--------KPKKDEDAAAACRRDNPDGCLMCSG 810          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Nematostella
Match: EDO25736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVM3])

HSP 1 Score: 196.438 bits (498), Expect = 1.266e-56
Identity = 109/296 (36.82%), Postives = 169/296 (57.09%), Query Frame = 1
Query: 1372 SNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPD------------MWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSM 2223
            SNLCTEI   ++  EIAVCNL S++L   ++  +   +  +L +        L+ ++DIN YP+ +A+ SNL HRP+G+G+ G  D   +LR P+ S EA +   +  E I + A   S +LAK+ GTY +YK S   +G+L  D              +V  S  LDW +LR  I ++G+RNS  +A  PTA+ + I+G +   E    NI+++  LSGEF V+N +LI DL    LW + M + I    GS+Q I  +PD +K+L+ T +E+    +++ A+ R  +IDQ+QS+
Sbjct:    1 SNLCTEITLNTNEREIAVCNLGSVNLVNHIE--NNEINVAKLEKTIKTAMRMLDNVVDINFYPVEKAKNSNLAHRPVGLGMMGFQDCLHMLRIPYASKEAVEFADKSMELISYYAFSASSKLAKEKGTYSSYKDSLWDQGILPLDSLKLLAKSRGAQYLDVDESKKLDWDELRSHIKEHGMRNSNCLAIAPTATIANIVGISASIEPTYQNIFVKSNLSGEFTVINDFLINDLKNEGLWDEVMLSDIKYFDGSLQQIDRIPDSLKQLYATAFEMDPKWLVEAASRRQKWIDQAQSL 294          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Medaka
Match: ENSORLT00000008450.2 (ribonucleoside-diphosphate reductase large subunit [Source:NCBI gene;Acc:101156995])

HSP 1 Score: 1026.54 bits (2653), Expect = 0.000e+0
Identity = 497/807 (61.59%), Postives = 621/807 (76.95%), Query Frame = 1
Query:   94 FLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCS---RDDKGCTSC 2505
             ++V+KR+G +E + FDKIT+R+ KLC     E +D A+++ KVI GLY GVTT ELD LAAEI A+L TK+ +Y  LA RI VSN+ KETK  FSEV+ DL++ ++      S +I+ +  +IV++N + LN+AI ++RDF  ++FGF+TLERSYLL+I  KV ERPQHM MR AVGIH  +I+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSI+GI+ TLK+CALISK AGGIG+ V CIR+TGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFA+Y+EPWH D+ +FLEL+KN G E ++ARDLF ALWIPDLFMKRV+S+ +W+LM P++C GL ECWG +F++LY  YE +G   + +KA+ LW  +++SQ ETGTPYMLYKDACN KSN Q+LGTIKCSNLCTEIVEY+S DE+AVCNLASI+L  +V P  +TFDF +L  VT V+  NLNKIIDIN+YP+PEA  SN RHRPIGIGVQGLAD F L+RYPFES EA  LN +IFETIY+ AL+ SCELA + G YETY G PVS+GVLQ DMW    +D  DW  L+  IAK+GVRNSLL+APMPTAST+QILGNNE  E ++SNIY RRVLSGEF +VN +L++DL    LWS++MKN +I N GSIQ+I  +P+++K+L+KTVWEI Q  ++K+AADR  FIDQSQS+N H+A P+Y  LTS+HF  WK+GLKTGMYYLRT+PAA+PIQFT++K    KL  G++ K      + E+D  ++ +     MVCS   RDD  C  C
Sbjct:    1 MMYVIKRDGRQERVMFDKITSRIQKLCYGLNSEFVDPAQITMKVIQGLYSGVTTVELDTLAAEIAATLTTKYPDYAILAARIAVSNLHKETKKVFSEVMEDLYSYVNPLNKCHSPMISKETLDIVLENKDRLNSAIIFDRDFSYNFFGFKTLERSYLLKINGKVAERPQHMLMRVAVGIHGRNIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLAMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRSTGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAMYLEPWHFDVFDFLELKKNTGKEEQRARDLFYALWIPDLFMKRVESNQDWSLMCPNECPGLDECWGVEFEELYTKYEREGRVKRVVKAQQLWHAVIESQTETGTPYMLYKDACNKKSNQQNLGTIKCSNLCTEIVEYTSHDEVAVCNLASIALNMYVTP-ERTFDFKKLASVTKVIVKNLNKIIDINYYPVPEAEKSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNIQIFETIYYAALEASCELAAELGPYETYDGCPVSRGVLQYDMWEKTPTDLWDWKLLKEKIAKHGVRNSLLLAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWSEEMKNKLIGNNGSIQDIAEIPNDLKQLYKTVWEISQKTVLKMAADRGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTKPAANPIQFTLNK---EKLKEGQSSK------MPEQDAKERNTAA---MVCSLENRDD--CLMC 792          
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Medaka
Match: rrm1 (ribonucleoside-diphosphate reductase large subunit [Source:NCBI gene;Acc:101156188])

HSP 1 Score: 1025.77 bits (2651), Expect = 0.000e+0
Identity = 489/757 (64.60%), Postives = 600/757 (79.26%), Query Frame = 1
Query:   97 LHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTK 2367
            +HV+KR+G +E + FDKIT+R+ KLC     + +D A+++ KVI GLY GVTT ELD LAAE  A+L TKH +Y  LA RI VSN+ KETK  FS+V+ DL+N ++    R S +I+ +  EIV++N + LN+AI Y+RDF  ++FGF+TLERSYLL+I  K  ERPQHM MR AVGIHK DI+ AIETYNL+SEKWF HASPTLFNAG    QLSSCFLL MKDDSIDGI+ TLK+CAL+SK AGGIGL V CIRATGS I GTNG SNGL PML+V+N  ARYVDQGGNKRPGAFA+Y+EPWH+D+ EFL+L+KN G E ++ARDLF ALWIPDLFMKRV+++ +W+LM P +C GL ECWGE+F++LY  YE++G   + +KA+ +W  I++SQ ETGTPYMLYKDACN KSN Q+LGTIK SNLCTEIVEY+S DE+AVCNLASI+L  +V P  KTFDF +L  VT V+  NLNKIIDIN+YP+ EA  SN RHRPIGIGVQGLAD F L+RY FES EA  LN +IFETIY+ AL+ SCELA  +GTYETY GSPVSKG+LQ DMW    +D  DW  L+  IA +GVRNSLL+APMPTAST+QILGNNE  EA++SNIY RRVLSGEF +VN +L++DL    LW++DMKN +IA  GSIQ I+G+P ++K+L+KTVWEI Q  ++K+AADR  +IDQSQS+N H+A P+Y  LTS+HF  WK GLKTGMYYLRT+PAA+PIQFT++K K
Sbjct:    1 MHVIKRDGRREAVSFDKITSRIQKLCYGLNSDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYVNPLNKRHSPMISKETLEIVLENKDRLNSAIIYDRDFSYNFFGFKTLERSYLLKINGKAAERPQHMLMRVAVGIHKTDIDEAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLAMKDDSIDGIYDTLKQCALVSKSAGGIGLAVSCIRATGSYIAGTNGTSNGLVPMLRVYNNTARYVDQGGNKRPGAFAVYLEPWHADVFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVENNQDWSLMCPSECPGLEECWGEEFEQLYIRYEKEGRAKRVVKAQQVWYAIIESQTETGTPYMLYKDACNGKSNQQNLGTIKSSNLCTEIVEYTSKDEVAVCNLASIALNMYVTP-EKTFDFKKLASVTKVIVKNLNKIIDINYYPVAEAERSNRRHRPIGIGVQGLADAFILMRYAFESPEAQLLNIQIFETIYYAALEASCELAAHYGTYETYAGSPVSKGILQYDMWGKTPTDLWDWEALKAKIALHGVRNSLLLAPMPTASTAQILGNNESIEAYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEDMKNQLIAQNGSIQEIEGIPADLKQLYKTVWEISQKTVLKMAADRGAYIDQSQSLNIHIAEPNYGKLTSMHFYGWKLGLKTGMYYLRTKPAANPIQFTLNKEK 756          
BLAST of Ribonucleoside-diphosphate reductase vs. Planmine SMEST
Match: SMESG000029273.1 (SMESG000029273.1)

HSP 1 Score: 1687.55 bits (4369), Expect = 0.000e+0
Identity = 809/809 (100.00%), Postives = 809/809 (100.00%), Query Frame = 1
Query:   85 MSKFLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKGCTSCQG 2511
            MSKFLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKGCTSCQG
Sbjct:    1 MSKFLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVINGLYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSEVIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYFGFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEKWFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAGGIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGAFAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDGNWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDSQIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNLASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSNLRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCELAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRNSLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDLIRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLAADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAADPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRDDKGCTSCQG 809          
The following BLAST results are available for this feature:
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RRM10.000e+065.52ribonucleotide reductase catalytic subunit M1 [Sou... [more]
RRM10.000e+068.22ribonucleotide reductase catalytic subunit M1 [Sou... [more]
RRM11.019e-5077.14ribonucleotide reductase catalytic subunit M1 [Sou... [more]
RRM16.894e-3077.14ribonucleotide reductase catalytic subunit M1 [Sou... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnr-10.000e+061.44Ribonucleoside-diphosphate reductase large subunit... [more]
rnr-10.000e+061.44Ribonucleoside-diphosphate reductase large subunit... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RnrL0.000e+062.31gene:FBgn0011703 transcript:FBtr0080059[more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrm10.000e+064.86ribonucleotide reductase M1 polypeptide [Source:NC... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrm10.000e+064.89ribonucleotide reductase M1 [Source:NCBI gene;Acc:... [more]
rrm10.000e+064.85ribonucleotide reductase M1 [Source:NCBI gene;Acc:... [more]
rrm10.000e+065.28ribonucleotide reductase M1 [Source:NCBI gene;Acc:... [more]
rrm10.000e+064.43ribonucleotide reductase M1 [Source:NCBI gene;Acc:... [more]
rrm10.000e+063.93ribonucleotide reductase M1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rrm10.000e+066.05ribonucleotide reductase M1 [Source:MGI Symbol;Acc... [more]
Rrm19.310e-1360.00ribonucleotide reductase M1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48591|RIR1_DROME0.000e+062.31Ribonucleoside-diphosphate reductase large subunit... [more]
sp|P07742|RIR1_MOUSE0.000e+066.05Ribonucleoside-diphosphate reductase large subunit... [more]
sp|P23921|RIR1_HUMAN0.000e+065.52Ribonucleoside-diphosphate reductase large subunit... [more]
sp|Q5R919|RIR1_PONAB0.000e+065.26Ribonucleoside-diphosphate reductase large subunit... [more]
sp|Q9UW15|RIR1_NEUCR0.000e+063.18Ribonucleoside-diphosphate reductase large chain O... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YQ000.000e+061.49Ribonucleoside-diphosphate reductase OS=Fasciola g... [more]
A0A4E0R9520.000e+061.61Ribonucleoside-diphosphate reductase OS=Fasciola h... [more]
A0A4Z2DY850.000e+064.05Ribonucleoside-diphosphate reductase OS=Schistosom... [more]
G4VIG30.000e+062.70Ribonucleoside-diphosphate reductase OS=Schistosom... [more]
W8C3W00.000e+064.44Ribonucleoside-diphosphate reductase OS=Ceratitis ... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rrm10.000e+062.06ribonucleotide reductase catalytic subunit M1 [Sou... [more]
rrm10.000e+062.16ribonucleotide reductase catalytic subunit M1 [Sou... [more]
rrm10.000e+058.61ribonucleotide reductase catalytic subunit M1 [Sou... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RNR30.000e+060.47Minor isoform of large subunit of ribonucleotide-d... [more]
RNR10.000e+059.82Major isoform of large subunit of ribonucleotide-d... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO497940.000e+061.63Ribonucleoside-diphosphate reductase [Source:UniP... [more]
EDO257361.266e-5636.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000008450.20.000e+061.59ribonucleoside-diphosphate reductase large subunit... [more]
rrm10.000e+064.60ribonucleoside-diphosphate reductase large subunit... [more]
back to top
BLAST of Ribonucleoside-diphosphate reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029273.10.000e+0100.00SMESG000029273.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029973 ID=SMED30029973|Name=Ribonucleoside-diphosphate reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=2604bp
CGCAACATATATTAATTGTTTCAAATATATATCCTTGTTTCTTTTAATTA
TACAAATATTATAATATTAGTTTTAAAATTCAACATGTCTAAGTTCTTAC
ATGTTGTTAAACGAAATGGGTCGAAAGAAGAAATCCATTTTGATAAAATA
ACAAATCGTTTACTGAAGCTTTGCGATCCAGCTCAAAGGGAAAATATTGA
TTTAGCAAAAGTCTCTAAGAAGGTTATTAATGGACTGTATCCAGGCGTTA
CAACAGCAGAGTTAGATAATCTAGCTGCTGAAATTTGTGCGAGTTTGGTA
ACAAAACATATTGAATATCAACGATTAGCTGGTAGAATTGTTGTATCTAA
TATGCAAAAGGAAACGAAATCAAAATTCTCTGAAGTTATTTATGACTTGT
TTAACGAAATAAGCACTAATACGGGCCGTAAATCCACACTTATCGCTGAT
GACATTTATGAAATCGTTATGAAAAATGCAGAAACGCTTAACAATGCTAT
TGATTATAACAGAGACTTTTATATTGATTATTTTGGATTTAGAACTTTGG
AAAGGTCTTATCTTCTAAGAATTGGCGAGAAAGTTGTAGAACGACCACAG
CATATGTTTATGAGAGCAGCGGTGGGTATACACAAGGATGATATTGAAGG
CGCGATCGAAACTTATAATTTAATGTCAGAGAAATGGTTTATACACGCTT
CTCCAACATTATTCAATGCTGGGTTAAAGTATGGTCAACTCTCTAGTTGT
TTCCTATTAACAATGAAAGATGACAGTATTGATGGAATATTTAGTACTCT
TAAAGAATGTGCTCTTATTTCTAAATATGCTGGTGGTATCGGTTTAAATG
TTCATTGTATTAGAGCGACTGGATCACCAATCAATGGAACAAATGGTGTA
TCGAATGGATTAACTCCAATGCTCCAGGTATTTAATTATGCAGCTCGTTA
CGTCGACCAAGGTGGAAATAAGCGACCCGGTGCATTCGCCATTTATATTG
AGCCATGGCATTCTGACATATTGGAATTTTTGGAATTGCGTAAAAACCAC
GGAGATGAATCGAAAAAAGCTAGAGATTTATTTTGCGCTTTGTGGATTCC
AGATTTATTCATGAAACGAGTTCAAAGTGATGGGAATTGGACATTGATGG
ACCCTCATAAATGTGCTGGACTTCATGAATGCTGGGGAGAAAAGTTTGAC
AAACTCTATGAATTATATGAAGAAAAGGGGATGGGAAATAAAACGATTAA
AGCTAGAATTTTGTGGAAAGAAATCCTCGATTCACAAATCGAAACCGGAA
CTCCTTATATGCTATACAAGGACGCCTGCAATGCCAAGTCAAATCATCAG
CATTTAGGAACGATCAAATGCAGCAATTTGTGCACAGAAATTGTAGAATA
TAGTTCTCCTGATGAAATAGCTGTTTGCAATTTGGCTTCGATCTCTCTTC
CAAAATTTGTTGATCCTTCATCGAAAACATTCGACTTTGATGAACTTATT
CGAGTTACTGGGGTTGTTACAAATAATCTTAACAAGATTATTGATATAAA
TCATTATCCATTACCGGAAGCTAGAACATCCAATTTAAGACACAGGCCAA
TTGGGATTGGAGTTCAAGGTCTGGCCGATGTTTTTGCATTGTTGCGCTAT
CCATTTGAAAGTGATGAGGCTGCAAAATTGAATAAGCGAATTTTTGAGAC
TATTTATTTTGGTGCTCTTAAAAAGTCGTGTGAATTAGCGAAAAAGTTTG
GAACTTATGAAACATATAAAGGCTCTCCGGTTAGTAAAGGAGTTCTCCAG
CCTGATATGTGGAATGTCAAATGTAGTGACTATCTTGATTGGCCACAATT
AAGGCTAGATATTGCAAAATATGGAGTTCGTAATAGCTTATTAGTTGCTC
CTATGCCAACAGCGAGTACTTCTCAGATTCTCGGAAACAATGAATGTTTT
GAGGCGTTCTCAAGCAATATCTATTTAAGACGAGTTTTAAGCGGGGAATT
TGTTGTTGTAAATCGATATTTAATTGAAGATCTGATTCGGTTGAATCTGT
GGTCAGATGATATGAAGAATGCCATTATTGCCAATCGTGGTTCCATACAA
AATATCCAAGGTCTTCCCGATGAAATGAAAGAGTTATTTAAAACTGTTTG
GGAAATTCATCAATCGGTTATCATAAAATTGGCTGCCGACAGAGCTCCGT
TTATTGATCAAAGTCAAAGTATGAATTTCCATGTTGCTGCACCAGATTAT
CAATTATTGACTTCATTGCATTTCAATGCTTGGAAAAAGGGATTAAAAAC
TGGAATGTATTACCTGCGAACGCGACCAGCAGCAGATCCGATACAATTTA
CAGTGGATAAAACTAAAGCTTCTAAATTAATAATGGGTGAAAATGTAAAA
AAGCTCTATGAAAACGTATTGGACGAAAAGGACATCCTTAAGAAACTGTC
AATCGAAGGCGAGAATATGGTTTGCTCCCGGGATGACAAAGGGTGCACTT
CATGTCAAGGATAGGAGGTTTTCTGCATTTAACTGACATTTTGATGTATT
AATATAATATTGATGTTATATTTTATAATAGATTATTTTGTTTTTGAAAA
AAAA
back to top

protein sequence of SMED30029973-orf-1

>SMED30029973-orf-1 ID=SMED30029973-orf-1|Name=SMED30029973-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=810bp
MSKFLHVVKRNGSKEEIHFDKITNRLLKLCDPAQRENIDLAKVSKKVING
LYPGVTTAELDNLAAEICASLVTKHIEYQRLAGRIVVSNMQKETKSKFSE
VIYDLFNEISTNTGRKSTLIADDIYEIVMKNAETLNNAIDYNRDFYIDYF
GFRTLERSYLLRIGEKVVERPQHMFMRAAVGIHKDDIEGAIETYNLMSEK
WFIHASPTLFNAGLKYGQLSSCFLLTMKDDSIDGIFSTLKECALISKYAG
GIGLNVHCIRATGSPINGTNGVSNGLTPMLQVFNYAARYVDQGGNKRPGA
FAIYIEPWHSDILEFLELRKNHGDESKKARDLFCALWIPDLFMKRVQSDG
NWTLMDPHKCAGLHECWGEKFDKLYELYEEKGMGNKTIKARILWKEILDS
QIETGTPYMLYKDACNAKSNHQHLGTIKCSNLCTEIVEYSSPDEIAVCNL
ASISLPKFVDPSSKTFDFDELIRVTGVVTNNLNKIIDINHYPLPEARTSN
LRHRPIGIGVQGLADVFALLRYPFESDEAAKLNKRIFETIYFGALKKSCE
LAKKFGTYETYKGSPVSKGVLQPDMWNVKCSDYLDWPQLRLDIAKYGVRN
SLLVAPMPTASTSQILGNNECFEAFSSNIYLRRVLSGEFVVVNRYLIEDL
IRLNLWSDDMKNAIIANRGSIQNIQGLPDEMKELFKTVWEIHQSVIIKLA
ADRAPFIDQSQSMNFHVAAPDYQLLTSLHFNAWKKGLKTGMYYLRTRPAA
DPIQFTVDKTKASKLIMGENVKKLYENVLDEKDILKKLSIEGENMVCSRD
DKGCTSCQG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0004748ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
GO:0016491oxidoreductase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013346NrdE_NrdA
IPR039718Rrm1
IPR000788RNR_lg_C
IPR013509RNR_lsu_N
IPR005144ATP-cone_dom
IPR008926RNR_R1-su_N
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000788Ribonucleotide reductase large subunit, C-terminalPRINTSPR01183RIBORDTASEM1coord: 427..438
score: 67.2
coord: 504..526
score: 52.17
coord: 597..624
score: 54.31
coord: 297..316
score: 55.71
coord: 532..555
score: 43.98
coord: 466..489
score: 35.19
IPR000788Ribonucleotide reductase large subunit, C-terminalPFAMPF02867Ribonuc_red_lgCcoord: 220..743
e-value: 3.3E-184
score: 613.3
IPR000788Ribonucleotide reductase large subunit, C-terminalPROSITEPS00089RIBORED_LARGEcoord: 586..608
IPR013346Ribonucleotide reductase, class I , alpha subunitTIGRFAMTIGR02506TIGR02506coord: 149..747
e-value: 2.9E-212
score: 704.4
NoneNo IPR availableGENE3DG3DSA:3.20.70.20coord: 79..753
e-value: 7.2E-294
score: 978.4
NoneNo IPR availablePANTHERPTHR11573:SF6RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE SUBUNITcoord: 6..808
NoneNo IPR availableCDDcd01679RNR_Icoord: 171..746
e-value: 0.0
score: 695.444
NoneNo IPR availableSUPERFAMILYSSF51998PFL-like glycyl radical enzymescoord: 219..756
IPR013509Ribonucleotide reductase large subunit, N-terminalPFAMPF00317Ribonuc_red_lgNcoord: 148..217
e-value: 1.3E-22
score: 79.6
IPR005144ATP-cone domainPFAMPF03477ATP-conecoord: 6..93
e-value: 2.8E-12
score: 47.0
IPR005144ATP-cone domainPROSITEPS51161ATP_CONEcoord: 5..96
score: 16.702
IPR039718Ribonucleoside-diphosphate reductase large subunitPANTHERPTHR11573RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAINcoord: 6..808
IPR008926Ribonucleotide reductase R1 subunit, N-terminalSUPERFAMILYSSF48168R1 subunit of ribonucleotide reductase, N-terminal domaincoord: 10..218