Signal recognition particle 54 kDa protein

Overview
NameSignal recognition particle 54 kDa protein
Smed IDSMED30029971
Length (bp)1738
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Signal recognition particle 54 kDa protein (SMED30029971) t-SNE clustered cells

Violin plots show distribution of expression levels for Signal recognition particle 54 kDa protein (SMED30029971) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Signal recognition particle 54 kDa protein (SMED30029971) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Signal recognition particle 54 kDa protein (SMED30029971) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029971

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30029971h1SMcG0007215 Contig49940newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029971h1SMcG0007215 Contig49940uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30029971h1SMcG0007215 dd_Smed_v4_3614_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029971h1SMcG0007215 dd_Smed_v4_2045_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029971h1SMcG0007215 dd_Smed_v4_2045_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Human
Match: SRP54 (signal recognition particle 54 [Source:HGNC Symbol;Acc:HGNC:11301])

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Human
Match: SRP54 (signal recognition particle 54 [Source:HGNC Symbol;Acc:HGNC:11301])

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Human
Match: SRP54 (signal recognition particle 54 [Source:HGNC Symbol;Acc:HGNC:11301])

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 338/442 (76.47%), Postives = 394/442 (89.14%), Query Frame = 3
Query:  222 KNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            ++AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    8 RSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 449          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Human
Match: SRP54 (signal recognition particle 54 [Source:HGNC Symbol;Acc:HGNC:11301])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 335/434 (77.19%), Postives = 387/434 (89.17%), Query Frame = 3
Query:  246 IAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            +A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 434          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Human
Match: SRP54 (signal recognition particle 54 [Source:HGNC Symbol;Acc:HGNC:11301])

HSP 1 Score: 82.4185 bits (202), Expect = 6.966e-19
Identity = 44/74 (59.46%), Postives = 63/74 (85.14%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRL 275
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKM 74          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Celegans
Match: F21D5.7 (Signal recognition particle 54 kDa protein [Source:UniProtKB/TrEMBL;Acc:G5EE80])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 340/498 (68.27%), Postives = 415/498 (83.33%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLF--KDGDMT-KNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKI 1538
            MVLA+LGRKI NA  +L ++T+I++ +LD ++K +CTALIE+DV+I+L+ QL+ NVK AINF+EI  G NKRR IQ+ VF+EL+++++PG   +TP KG+ N+ MFVGLQGSGKTTT TKMA+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSY+E DPV IA EGVE+F  + FEIIIVDTSGRHKQE SLFEEMLQV+N + PDN+V+VMDASIGQACE+QARAF + VDVASVIITKLD HAKGGGALSAVA T+SP+IFI TGEHI+D E FK + FVQKLLGMGDI GL+D VN++ ++DN+EL  +LKQG FTL DMYEQFQNIMK+GPFSQI+  IPGFG +FM+KGNEQES  +LK+MM +MDSMS KELDHP  ++LF+++P R  RVARGSGS  +EV +LL  Y KFS VVKK+G IKGLF  K+GD+  KN+NP KM+QLNQ M +MMDPR+LQQMGG  GL N+++Q     AGK+
Sbjct:    1 MVLADLGRKIRNAIGKLGQSTVINEGELDLMLKEVCTALIESDVHIRLVKQLKDNVKKAINFEEIVGGANKRRYIQKTVFNELLKLVDPGVTPFTPTKGRRNVFMFVGLQGSGKTTTCTKMAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYSEIDPVKIAAEGVEKFTQEGFEIIIVDTSGRHKQEASLFEEMLQVSNAVTPDNVVFVMDASIGQACEAQARAFSQTVDVASVIITKLDSHAKGGGALSAVAVTKSPVIFIGTGEHIDDFEIFKPKSFVQKLLGMGDIAGLVDMVNDIGIQDNKELVGRLKQGQFTLRDMYEQFQNIMKMGPFSQIMGMIPGFGSEFMTKGNEQESVNRLKRMMTVMDSMSDKELDHPKASELFTKEPNRVARVARGSGSHQQEVRDLLAQYKKFSDVVKKIGSIKGLFNGKNGDINPKNMNPAKMAQLNQQMAKMMDPRVLQQMGGMGGLQNMMQQM--ARAGKM 496          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Celegans
Match: F38A1.8 (pep chromosome:WBcel235:IV:1232872:1239852:-1 gene:WBGene00009521.1 transcript:F38A1.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F38A1.8)

HSP 1 Score: 96.2857 bits (238), Expect = 1.064e-20
Identity = 69/273 (25.27%), Postives = 127/273 (46.52%), Query Frame = 3
Query:  195 LISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNAT------KARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD-----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            ++S+L   V N  NF  +A      + ++ AV   LV++L P  +             G+P +++F G+ G GK+T + K+  +  +   +  +   DTFRAGA +QL+ +A       K  +  +      DP  +A   +++    +F++++VDT+GR +  + L  E+ ++    +PD +++V +A +G     Q   F E +            +  +++TK D    K G A+S    T  PI+F+  G+   D+    V   V  LL
Sbjct:  360 VVSKLEGKVVN--NFSRVA------QEVKTAVRESLVQLLTPKHRVDILRDVIEAKRDGRPYVIVFCGVNGVGKSTNLAKITFWLTENKHRVLIAAGDTFRAGAVEQLRTHARYLNDLHKNSVLLHEQGYGKDPAGLAAAAIKKAAEQDFDVVLVDTAGRMQDNEPLMRELAKLIRVNEPDLVLFVGEALVGNEAVDQLVKFNEALANHASPGQKPRLIDGIVLTKFDTIDDKVGAAVSMTYITGQPIVFVGCGQTYSDLRNLNVGAVVHSLL 624          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Fly
Match: Srp54k (gene:FBgn0010747 transcript:FBtr0077169)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 341/485 (70.31%), Postives = 423/485 (87.22%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLK 1508
            MVLA+LGRKIT A + L+KAT+I+++ L+ ++K IC AL+EADVNI+L+ QLR NV+  I+FDE+A G+NKRR+IQ AVF ELV++++PG K + PIKGK N+VMFVGLQGSGKTTT TK+A++YQK++WK+C++CADTFRAGA+DQ+KQNATKARIPFYGSYTE DPV+IAQ+GV+ FK + FE+IIVDTSGRHKQE+SLFEEML V+N + PDNI++VMDA+IGQACE+QA+AFK+ VD+ SVIITKLDGHAKGGGALSAVAATQSPIIFI TGEHI+D+EPFK +PFV KLLGMGDIEGLIDKVNELKL+ N+EL +K+K G FT+ DMYEQFQNIMK+GPFSQ ++ IPGF QDFM+KG EQES A++K+MM +MDSMS  ELD+ DGAKLFS+QP R  RVA+G+G   +EV EL+  YTKFS VVKKMGG+KGLFK GDMTKNVNP +M++LNQ + +M+DPRMLQQMGG  G+ N+++
Sbjct:    1 MVLADLGRKITTALHSLSKATVINEEALNSMLKEICAALLEADVNIRLVKQLRENVRAVIDFDEMAGGLNKRRMIQSAVFKELVKLVDPGVKPYQPIKGKANVVMFVGLQGSGKTTTCTKLAYHYQKRNWKSCLVCADTFRAGAYDQVKQNATKARIPFYGSYTEIDPVVIAQDGVDMFKREGFEMIIVDTSGRHKQEESLFEEMLAVSNAVSPDNIIFVMDATIGQACEAQAKAFKDKVDIGSVIITKLDGHAKGGGALSAVAATQSPIIFIGTGEHIDDLEPFKTKPFVSKLLGMGDIEGLIDKVNELKLDGNDELLEKIKHGHFTIRDMYEQFQNIMKMGPFSQFMNMIPGFSQDFMTKGGEQESMARVKRMMTMMDSMSDNELDNRDGAKLFSKQPNRCVRVAQGAGVMEREVKELIAHYTKFSAVVKKMGGVKGLFKQGDMTKNVNPTQMAKLNQQIAKMIDPRMLQQMGGVGGIQNMMR 485          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Fly
Match: Gtp-bp (gene:FBgn0010391 transcript:FBtr0073480)

HSP 1 Score: 92.0485 bits (227), Expect = 3.110e-19
Identity = 66/265 (24.91%), Postives = 120/265 (45.28%), Query Frame = 3
Query:  237 FDEIAVGMNKRRLIQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNAT-------------KARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECV-DVAS---------VIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            FD IA        +++A+   LVRIL+P  +         +   G+P  ++F G+ G GK+T + K+  +  +  +   +   DTFRAGA +QL+ +               +  +  Y      D   IA E ++   +   ++++VDT+GR +  + L   + ++     PD +++V +A +G     Q   F + + D +S         +++TK D    K G A+S    T  PI+F+ TG+   D++   V   V  L+
Sbjct:  355 FDSIA------SQVKEALTESLVRILSPKRRIDIIRDALESKRNGRPYTIIFCGVNGVGKSTNLAKICFWLIENDFNVLIAACDTFRAGAVEQLRTHTRHLNALHPAAKHDGRNMVQLYEKGYGKDAAGIAMEAIKFAHDTRVDVVLVDTAGRMQDNEPLMRSLSKLIKVNNPDLVLFVGEALVGNEAVDQLVKFNQSLADYSSNENPHIIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYADLKAINVNAVVNSLM 613          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Zebrafish
Match: srp54 (signal recognition particle 54 [Source:ZFIN;Acc:ZDB-GENE-040426-818])

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 372/498 (74.70%), Postives = 440/498 (88.35%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK AI+ +E+A G+NKRR+IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+Y+Q+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FK++NFEIIIVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNEEL  KLK G FTL DMYEQFQNIMK+GPF QI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG + ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAIDLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFVGLQGSGKTTTCSKLAYYFQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIAAEGVEKFKSENFEIIIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEELIDKLKHGQFTLRDMYEQFQNIMKMGPFGQIMGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDNKDGAKLFSKQPNRIQRVARGSGVATRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Zebrafish
Match: srp54 (signal recognition particle 54 [Source:ZFIN;Acc:ZDB-GENE-040426-818])

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 372/498 (74.70%), Postives = 440/498 (88.35%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK AI+ +E+A G+NKRR+IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+Y+Q+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FK++NFEIIIVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNEEL  KLK G FTL DMYEQFQNIMK+GPF QI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG + ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAIDLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFVGLQGSGKTTTCSKLAYYFQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIAAEGVEKFKSENFEIIIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEELIDKLKHGQFTLRDMYEQFQNIMKMGPFGQIMGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDNKDGAKLFSKQPNRIQRVARGSGVATRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Zebrafish
Match: srpra (SRP receptor subunit alpha [Source:ZFIN;Acc:ZDB-GENE-030219-11])

HSP 1 Score: 90.8929 bits (224), Expect = 1.120e-18
Identity = 66/288 (22.92%), Postives = 126/288 (43.75%), Query Frame = 3
Query:  168 LIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLK-------------QNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            LI  +V  ++ SQL  +V   +    +         ++QA+   LV+IL P  +            + KP ++ F G+ G GK+T + K++++  +  +   +   DTFRAGA +QL+             ++  +  +  +      D   IA E +   +N  F+++++DT+GR +    L   + ++     PD +++V +A +G     Q   F   +           +  +++TK D    K G A+S    T  PI+F+ TG+   D+     +  V  L+
Sbjct:  361 LIAKNVAAEIASQLCDSVAKKLEGKVMGTFTTVASTVKQALQDSLVQILQPKRRVDILRDVLEARSQRKPFVITFCGVNGVGKSTNLAKISYWLIENGFTVLIAACDTFRAGAVEQLRTHQRRLNSLHPPEKHGGQPAVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLIDTAGRMQDNAPLMTALAKLIAVNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSKSDKPRLIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYSDLRSLNARAVVSALM 648          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Xenopus
Match: srp54 (signal recognition particle 54kDa [Source:NCBI gene;Acc:394574])

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 376/498 (75.50%), Postives = 444/498 (89.16%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGKPN++MFVGLQGSGKTTT TK+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPV IA EGVE+FKN+NFEI+IVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFGQDFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+LQ MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCKALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFVGLQGSGKTTTCTKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVNIAYEGVEKFKNENFEIVIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGQDFMSKGNEQESMARLKKLMTIMDSMNDQELDNTDGAKLFSKQPGRVQRVARGSGVSTRDVQELLAQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLQHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Xenopus
Match: srp54 (signal recognition particle 54kDa [Source:NCBI gene;Acc:394574])

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 362/474 (76.37%), Postives = 425/474 (89.66%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQM 1475
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGKPN++MFVGLQGSGKTTT TK+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPV IA EGVE+FKN+NFEI+IVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFGQDFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+LQ M
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCKALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFVGLQGSGKTTTCTKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVNIAYEGVEKFKNENFEIVIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGQDFMSKGNEQESMARLKKLMTIMDSMNDQELDNTDGAKLFSKQPGRVQRVARGSGVSTRDVQELLAQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLQHM 474          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Xenopus
Match: srp54 (signal recognition particle 54kDa [Source:NCBI gene;Acc:394574])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 316/506 (62.45%), Postives = 387/506 (76.48%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL--------GMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGKPN++MFVGLQGSGKTTT TK+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPV IA EGVE+FKN+NFEI+IVDTSGRHKQEDSLFEEMLQV+N +    I+++           QA+      ++  + I                       I++C G+   + EP          L        GMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFGQDFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+LQ MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCKALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFVGLQGSGKTTTCTKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVNIAYEGVEKFKNENFEIVIVDTSGRHKQEDSLFEEMLQVSNAV----IIWL-----------QAK------EIVCLYIC----------------------IYMCIGQL--EAEPSLKPLLNLPSLLILFLSPPGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGQDFMSKGNEQESMARLKKLMTIMDSMNDQELDNTDGAKLFSKQPGRVQRVARGSGVSTRDVQELLAQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLQHMGGMAGLQSMMRQFQQGAAGNMKGM 461          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Xenopus
Match: SRPRA (SRP receptor subunit alpha [Source:NCBI gene;Acc:100271764])

HSP 1 Score: 86.6557 bits (213), Expect = 2.351e-17
Identity = 62/252 (24.60%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  276 IQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATK--ARIP-----------FYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            ++QA+   LV+IL P  +              +P ++ F G+ G GK+T + K++ +  +  +   +   DTFRAGA +QL+ +  +  +R P            Y      D   IA E +   +N  F++++VDT+GR +    L   + ++     PD +++V +A +G     Q   F + +           +  +++TK D    K G A+S    T  PI+F+ TG+   D+     +  V  L+
Sbjct:  295 VKQALQESLVQILQPKRRVDILRDVMEAQHLRRPYVITFCGVNGVGKSTNLAKISFWLIENGFSVLIAACDTFRAGAVEQLRTHTQRLNSRHPPEKHKGRTMVQLYEKGYGKDAAGIAMEAISYARNQAFDVVLVDTAGRMQDNAPLMTALAKLIAVNVPDLVLFVGEALVGNEAVDQLVKFNKALADYSMADKPRLIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYCDLRLLNAKAVVAALM 546          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Xenopus
Match: SRPRA (SRP receptor subunit alpha [Source:NCBI gene;Acc:100271764])

HSP 1 Score: 86.6557 bits (213), Expect = 3.000e-17
Identity = 62/252 (24.60%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  276 IQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATK--ARIP-----------FYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            ++QA+   LV+IL P  +              +P ++ F G+ G GK+T + K++ +  +  +   +   DTFRAGA +QL+ +  +  +R P            Y      D   IA E +   +N  F++++VDT+GR +    L   + ++     PD +++V +A +G     Q   F + +           +  +++TK D    K G A+S    T  PI+F+ TG+   D+     +  V  L+
Sbjct:  368 VKQALQESLVQILQPKRRVDILRDVMEAQHLRRPYVITFCGVNGVGKSTNLAKISFWLIENGFSVLIAACDTFRAGAVEQLRTHTQRLNSRHPPEKHKGRTMVQLYEKGYGKDAAGIAMEAISYARNQAFDVVLVDTAGRMQDNAPLMTALAKLIAVNVPDLVLFVGEALVGNEAVDQLVKFNKALADYSMADKPRLIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYCDLRLLNAKAVVAALM 619          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Mouse
Match: Srp54b (signal recognition particle 54B [Source:MGI Symbol;Acc:MGI:3714357])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 373/498 (74.90%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQV+N I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Mouse
Match: Srp54a (signal recognition particle 54A [Source:MGI Symbol;Acc:MGI:1346087])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 373/498 (74.90%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQV+N I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Mouse
Match: Srp54a (signal recognition particle 54A [Source:MGI Symbol;Acc:MGI:1346087])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 373/498 (74.90%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQV+N I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Mouse
Match: Srp54c (signal recognition particle 54C [Source:MGI Symbol;Acc:MGI:3714359])

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 369/498 (74.10%), Postives = 439/498 (88.15%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQV+N I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DN+ L +K K G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+ P R QRVARGSG S +++ ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNKALIEKWKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKHPGRIQRVARGSGVSTRDIQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Mouse
Match: Srp54c (signal recognition particle 54C [Source:MGI Symbol;Acc:MGI:3714359])

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 369/498 (74.10%), Postives = 439/498 (88.15%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQV+N I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DN+ L +K K G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+ P R QRVARGSG S +++ ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNKALIEKWKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKHPGRIQRVARGSGVSTRDIQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. UniProt/SwissProt
Match: sp|Q5R4R6|SRP54_PONAB (Signal recognition particle 54 kDa protein OS=Pongo abelii OX=9601 GN=SRP54 PE=2 SV=1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. UniProt/SwissProt
Match: sp|Q4R965|SRP54_MACFA (Signal recognition particle 54 kDa protein OS=Macaca fascicularis OX=9541 GN=SRP54 PE=2 SV=1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. UniProt/SwissProt
Match: sp|P61011|SRP54_HUMAN (Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. UniProt/SwissProt
Match: sp|P61010|SRP54_CANLF (Signal recognition particle 54 kDa protein OS=Canis lupus familiaris OX=9615 GN=SRP54 PE=1 SV=1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. UniProt/SwissProt
Match: sp|Q2T9U1|SRP54_BOVIN (Signal recognition particle 54 kDa protein OS=Bos taurus OX=9913 GN=SRP54 PE=2 SV=1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 441/498 (88.55%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNV+ ++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. TrEMBL
Match: A0A1L8FAQ2 (Signal recognition particle 54 kDa protein OS=Xenopus laevis OX=8355 GN=srp54 PE=3 SV=1)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 377/498 (75.70%), Postives = 445/498 (89.36%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGKPN++MFVGLQGSGKTTT TK+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPV IA EGVE+FKN+NFEI+IVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFGQDFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+LQ MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFVGLQGSGKTTTCTKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVNIAYEGVEKFKNENFEIVIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGQDFMSKGNEQESMARLKKLMTIMDSMNDQELDNTDGAKLFSKQPGRVQRVARGSGVSTRDVQELLAQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLQHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. TrEMBL
Match: Q6P862 (Signal recognition particle 54 kDa protein OS=Xenopus tropicalis OX=8364 GN=srp54 PE=2 SV=1)

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 376/498 (75.50%), Postives = 444/498 (89.16%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGKPN++MFVGLQGSGKTTT TK+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPV IA EGVE+FKN+NFEI+IVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFGQDFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+LQ MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCKALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFVGLQGSGKTTTCTKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVNIAYEGVEKFKNENFEIVIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGQDFMSKGNEQESMARLKKLMTIMDSMNDQELDNTDGAKLFSKQPGRVQRVARGSGVSTRDVQELLAQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLQHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. TrEMBL
Match: A0A1W7RDC1 (Signal recognition particle 54 kDa protein OS=Agkistrodon contortrix contortrix OX=8713 GN=SRP54 PE=3 SV=1)

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 377/498 (75.70%), Postives = 443/498 (88.96%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK NI+MFVGLQGSGKTT+ +K+A+YYQKK WKTC+ICADT+RAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D+EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG I GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFVGLQGSGKTTSCSKLAYYYQKKGWKTCLICADTYRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDVEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNIKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. TrEMBL
Match: T1DIN4 (Signal recognition particle 54 kDa protein OS=Crotalus horridus OX=35024 GN=SRP54 PE=2 SV=1)

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 377/498 (75.70%), Postives = 443/498 (88.96%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK NI+MFVGLQGSGKTT+ +K+A+YYQKK WKTC+ICADT+RAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D+EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG I GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFVGLQGSGKTTSCSKLAYYYQKKGWKTCLICADTYRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDVEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNIKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. TrEMBL
Match: A0A0F7Z5Y4 (Signal recognition particle 54 kDa protein OS=Crotalus adamanteus OX=8729 GN=SRP54 PE=2 SV=1)

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 377/498 (75.70%), Postives = 443/498 (88.96%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +CTAL+EADVNIKL+ QLR NVK+AI+ +E+A G+NKR++IQ AVF ELV++++PG KAWTP KGK NI+MFVGLQGSGKTT+ +K+A+YYQKK WKTC+ICADT+RAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGVE+FKN+NFEIIIVDTSGRHKQEDSLFEEMLQVAN I+PDNIVYVMDASIGQACE+QA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D+EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNE L +KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAK+FS+QP R QRVARGSG S ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG I GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNIIMFVGLQGSGKTTSCSKLAYYYQKKGWKTCLICADTYRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDVEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNIKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Cavefish
Match: srp54 (signal recognition particle 54 [Source:NCBI gene;Acc:103042553])

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 374/498 (75.10%), Postives = 440/498 (88.35%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK AI+ +E+A G+NKRR+IQ AVF ELV++++PG KAWTP KGK NI+MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPVIIA EGV++FK++NFEIIIVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACE+QA+AFK+ VDVASVIITKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNEEL  KLK G FTL DMYEQFQNIMK+GPF QI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLFS+QP R QRVARGSG + ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAIDLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNIIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVDKFKSENFEIIIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIITKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEELIDKLKHGQFTLRDMYEQFQNIMKMGPFGQIMGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDNKDGAKLFSKQPNRVQRVARGSGVATRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Cavefish
Match: srpra (SRP receptor subunit alpha [Source:ZFIN;Acc:ZDB-GENE-030219-11])

HSP 1 Score: 93.5893 bits (231), Expect = 1.011e-19
Identity = 69/288 (23.96%), Postives = 127/288 (44.10%), Query Frame = 3
Query:  168 LIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLK-------------QNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVAS----------VIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            LI  +V   + SQL  +V   +    +         ++QA+   LV+IL P  +            + KP ++ F G+ G GK+T + K++++  +  +   +   DTFRAGA +QL+             Q+  +  +  +      D   IA E +   +N +F++++VDT+GR +    L   + ++     PD +++V +A +G     Q   F + +   S          +++TK D    K G A+S    T  PI+F+ TG+   D+     +  V  L+
Sbjct:  295 LIAKNVAADIASQLCDSVAKKLEGKVMGTFTTVASTVKQALQDSLVQILQPKRRVDILRDVLEARAQRKPFVITFCGVNGVGKSTNLAKISYWLIENGFTVLIAACDTFRAGAVEQLRTHQRRLNSLHPPEQHGGRPVVQLFEKGYGKDAAGIAMEAIAFARNQSFDVVLVDTAGRMQDNAPLMTALAKLIAVNAPDLVLFVGEALVGNEAVDQLVKFNQALADHSMSDHPRLLDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYSDLRSLNARAVVNALM 582          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Sea Lamprey
Match: srp54 (signal recognition particle 54 [Source:ZFIN;Acc:ZDB-GENE-040426-818])

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 365/497 (73.44%), Postives = 433/497 (87.12%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPG 1544
            MVLA+LGRKIT A   L+ ATII+++ L+ ++K +C AL+E+DVN+KL+  LR NVK+AI+ +E+A G+NKRR+IQ  VF ELV++++PG KAWTP+KGK NI+MFVGLQGSGKTTT TK+A+YYQ+K WK C++CADTFRAGAFDQLKQNATKARIPFYGSYTE DPV+IA +GV++FK +NFEII+VDTSGRHKQE+SLFEEMLQV+N + PDNIVYVMDASIGQACE+QARAFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLIDKVNELKL+DNEEL  KLK G FTL DMYEQFQNIMK+GPFSQI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD+ DGAKLF++QP R QRVARG+G S +EV ELL  YTKF+Q+VKKMGGIKGLFK GDM KNVN  +M++LNQ M RMMDPR+LQQMGG +GL ++++QFQ GA G   G
Sbjct:    1 MVLADLGRKITAALRSLSNATIINEEVLNSMLKEVCAALLESDVNVKLVKTLRENVKSAIDLEEMATGLNKRRMIQHTVFKELVKLVDPGVKAWTPVKGKHNIIMFVGLQGSGKTTTCTKLAYYYQRKGWKACLVCADTFRAGAFDQLKQNATKARIPFYGSYTEVDPVVIAADGVDKFKRENFEIIVVDTSGRHKQEESLFEEMLQVSNAVNPDNIVYVMDASIGQACEAQARAFKDKVDVASVIVTKLDGHAKGGGALSAVAATRSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEELIDKLKHGQFTLRDMYEQFQNIMKMGPFSQIMGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDNKDGAKLFTKQPGRVQRVARGAGVSTREVQELLTQYTKFAQMVKKMGGIKGLFKGGDMAKNVNSAQMAKLNQQMARMMDPRVLQQMGGMSGLQHIMRQFQQGATGSAKG 497          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Sea Lamprey
Match: srpra (SRP receptor subunit alpha [Source:ZFIN;Acc:ZDB-GENE-030219-11])

HSP 1 Score: 76.6406 bits (187), Expect = 6.074e-15
Identity = 60/254 (23.62%), Postives = 109/254 (42.91%), Query Frame = 3
Query:  276 IQQAVFHELVRILNPGTKAWTPI---------KGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLK-------------QNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            ++QA+   L++IL P  K    I         K +P ++ F G+ G GK+T + K   +  +  +   +   DTFRAGA +QL+              +  +  +  +      D   IA E  +   +   ++++VDT+GR +    L   + ++     PD +++V +A +G     Q   F   +           +  +++TK D    K G A+S    T  PI+F+ TG+   D+    V+  V  L+
Sbjct:  381 VKQALQDSLLKILQP--KRHVDILRDVIEAKKKKQPYVITFCGVNGVGKSTNLAKTCFWLIENEFSVLVAACDTFRAGAVEQLRTHTRHLSALHPPENHGGRPMVQLFERGYGKDAAGIAMEAKQFATSQGVDVVLVDTAGRMQNNTPLMVALAKLIAVNIPDLVLFVGEALVGNEAVDQLVKFNRALADNSHMEKPRLIDGIVLTKFDTIDDKVGAAVSMTYITGQPIVFVGTGQTYCDLRRLDVESVVHALM 632          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Yeast
Match: SRP54 (Signal recognition particle (SRP) subunit (homolog of mammalian SRP54); contains the signal sequence-binding activity of SRP, interacts with the SRP RNA, and mediates binding of SRP to signal receptor; contains GTPase domain [Source:SGD;Acc:S000006292])

HSP 1 Score: 432.565 bits (1111), Expect = 1.139e-146
Identity = 220/430 (51.16%), Postives = 309/430 (71.86%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXM-KVICTALIEADVNIKLISQLRTNVKNAI----NFDEIAVGMNKRRLIQQAVFHELVRILN---PGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELK-LEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELL 1316
            MVLA+LG++I +A N     T  D     D+M K I TAL+E+DVNI L+S+LR N+++ +      ++       ++LIQ+ VF EL +++       KA+ P K K NI+MFVGLQGSGKTT+ TK+A YY K+ +K  ++CADTFRAGAFDQLKQNA +ARIPFYGSYTETDP  +A+EG+ +FK + F+IIIVDTSGRH QE+ LF+EM++++N IKP+  + V+DASIGQA E Q++AFKE  D  ++I+TK+DGHA+GGGA+SAVAAT +PIIFI TGEHI D+E F  + F+ KLLG+GDIE L +++  +   ED +   + +++G FTL D  +Q Q IMK+GP S I   IPG   + M++  E+E+  K+KKM+ ++DSM+++EL+  DG ++F  +PTR  RVA+GSG+S+ EV  +L
Sbjct:    1 MVLADLGKRINSAVNNAISNTQDDFTTSVDVMLKGIVTALLESDVNIALVSKLRNNIRSQLLSENRSEKSTTNAQTKKLIQKTVFDELCKLVTCEGSEEKAFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIRARIPFYGSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNVIKPNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHARGGGAISAVAATNTPIIFIGTGEHIHDLEKFSPKSFISKLLGIGDIESLFEQLQTVSNKEDAKATMENIQKGKFTLLDFKKQMQTIMKMGPLSNIAQMIPGMS-NMMNQVGEEETSQKMKKMVYVLDSMTKEELES-DG-RMFIEEPTRMVRVAKGSGTSVFEVEMIL 427          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Yeast
Match: SRP101 (Signal recognition particle (SRP) receptor alpha subunit; contain GTPase domains; involved in SRP-dependent protein targeting; interacts with the beta subunit, Srp102p [Source:SGD;Acc:S000002700])

HSP 1 Score: 89.7373 bits (221), Expect = 2.874e-19
Identity = 61/227 (26.87%), Postives = 111/227 (48.90%), Query Frame = 3
Query:  345 KGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLK---------QNATKARIP--------------FYGSYTETDPVI-IAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECV----DVASVIITKLDGHAKGGGAL-SAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            K  P +   VG+ G GK+T ++K+A +  + ++K  ++  DTFR+GA +QL+          + +  R                F   Y  +D V  IA++ ++  ++ NF+I+++DT+GR   + +L   +   A+  KPD I+ V +A +G     QA+ F +      ++   II+K D   +  G + + V AT  PI+F+  G+   D+    V+  V  L+
Sbjct:  394 KCDPYVFSIVGVNGVGKSTNLSKLAFWLLQNNFKVLIVACDTFRSGAVEQLRVHVENLAQLMDDSHVRGSKNKRGKTGNDYVELFEAGYGGSDLVTKIAKQAIKYSRDQNFDIVLMDTAGRRHNDPTLMSPLKSFADQAKPDKIIMVGEALVGTDSVQQAKNFNDAFGKGRNLDFFIISKCDTVGEMLGTMVNMVYATGIPILFVGVGQTYTDLRTLSVKWAVNTLM 620          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Nematostella
Match: EDO49574 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP5])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 360/493 (73.02%), Postives = 433/493 (87.83%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAG 1532
            MVLA+LGRKIT A   L+ AT+I+++ L+ ++K +C AL+E+DVN++L+ +LR NVK AI+F+E+A G+NKR++IQ  VF EL ++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVE+FK +NFEIIIVDTSGRHKQE+SLFEEMLQV+N + PDNI++VMDA+IGQACESQ+RAFKE VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D E FK +PF+ KLLGMGDIEGLIDKVNELKLEDNEEL  KLK GVF+L DMYEQFQNIMK+GPF QI+  IPGF  DF+SKGNEQES A+LK++M IMDSM+ +ELD P+GAKLF+RQP RT RVARGSG S++EV ELL  Y KF+Q+VKKMGGIKGLFK GDMT+NVNP +M++LN  M +MMDPR+LQQMGG +GL N+++QFQ G+ G
Sbjct:    1 MVLADLGRKITTALRSLSNATVINEEVLNAMLKEVCAALLESDVNVQLVKRLRENVKAAIDFEEMAAGLNKRKMIQHTVFQELCKLVDPGVKAWTPSKGKKNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEKFKEENFEIIIVDTSGRHKQEESLFEEMLQVSNAVSPDNIIFVMDATIGQACESQSRAFKEKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEQFKTRPFISKLLGMGDIEGLIDKVNELKLEDNEELIDKLKHGVFSLRDMYEQFQNIMKMGPFGQIMGMIPGFSSDFLSKGNEQESMARLKRLMTIMDSMNDQELDSPNGAKLFTRQPGRTTRVARGSGVSVREVQELLSQYQKFAQMVKKMGGIKGLFKGGDMTRNVNPTQMTKLNHQMAKMMDPRVLQQMGGMSGLQNMMRQFQQGSHG 493          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Nematostella
Match: EDO46043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR36])

HSP 1 Score: 95.1301 bits (235), Expect = 1.355e-20
Identity = 67/289 (23.18%), Postives = 131/289 (45.33%), Query Frame = 3
Query:  171 IEADVNIKLISQLRTNVKNAI--NFDEIAVGMNKRRLIQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATK-------------ARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            + AD++ KL   + T ++  +   F  IA        ++ ++   L++IL+P  +            KGKP +V F G+ G GK+T + K+  +  + +++  +   DTFRAGA +QL+ +                  +  Y      D   IA + +   +    ++++VDT+GR +  + L   + ++     PD +++V +A +G     Q + F + +           +  +++TK D    + G A+S    T  PI+F+ TG+  +D++   V+  V  LL
Sbjct:  341 VAADISEKLCDSVATKLEGKVIGTFSGIA------STVKSSLEESLIQILSPKRRVDILRDAMENKRKGKPYVVTFCGVNGVGKSTNLAKVCFWLLENNFRVMIAACDTFRAGAVEQLRTHVRHLNALHPPAHANGPPSVLLYEKGYGKDAASIAMDAINFAREQRVDVVLVDTAGRMQDNEPLMRALSKLIKLNDPDLVLFVGEALVGNEAVDQLKKFNQALADHSSQDRPRLIDGILLTKFDTIDDQVGAAISMTYTTGQPIVFVGTGQTYKDLKSLNVKAVVHALL 623          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Medaka
Match: SRP54 (signal recognition particle 54 [Source:NCBI gene;Acc:101163779])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 372/498 (74.70%), Postives = 438/498 (87.95%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGM 1547
            MVLA+LGRKIT+A   L+ ATII+++ L+ ++K +C AL+EADVNIKL+ QLR NVK AI+ +E+A G+NKRR+IQ AVF ELV++++PG KAWTP KGK N++MFVGLQGSGKTTT +K+A+YYQ+K WKTC+ICADTFRAGAFDQLKQNATKARIPFYGSYTE DPV+IA EGVE+FK +NFEIIIVDTSGRHKQEDSLFEEMLQV+N ++PDNIVYVMDASIGQACESQA+AFK+ VDVASVI+TKLDGHAKGGGALSAVAAT+SPIIFI TGEHI+D EPFK QPF+ KLLGMGDIEGLID+VNELKL+DNEEL  KLK G FTL DMYEQFQNIMK+GPF QI+  IPGFG DFMSKGNEQES A+LKK+M IMDSM+ +ELD  DGAKLFS+QP R QRVARGSG + ++V ELL  YTKF+Q+VKKMGGIKGLFK GDM+KNVNP++M++LNQ M +MMDPR+L  MGG AGL ++++QFQ GAAG + GM
Sbjct:    1 MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCAALLEADVNIKLVKQLRENVKAAIDLEEMASGLNKRRMIQHAVFKELVKLVDPGVKAWTPTKGKNNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVVIASEGVEKFKAENFEIIIVDTSGRHKQEDSLFEEMLQVSNAVQPDNIVYVMDASIGQACESQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATRSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDRVNELKLDDNEELIDKLKHGQFTLRDMYEQFQNIMKMGPFGQIMGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSKDGAKLFSKQPNRIQRVARGSGVATRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVNPSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGM 498          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Medaka
Match: srpra (SRP receptor subunit alpha [Source:NCBI gene;Acc:101163921])

HSP 1 Score: 90.5077 bits (223), Expect = 1.170e-18
Identity = 67/288 (23.26%), Postives = 126/288 (43.75%), Query Frame = 3
Query:  168 LIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKAR-------------IPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            LI  +V  ++ SQL  +V   +    +         ++QA+   LV+IL P  +            + +P ++ F G+ G GK+T + K++++  +  +   +   DTFRAGA +QL+ +  +               +  Y      D   IA E +   +N  F++++VDT+GR +    L   + ++     PD +++V +A +G     Q   F + +           +  +++TK D    K G A+S    T  PI+F+ TG+   D+     +  V  L+
Sbjct:  354 LIAKNVAAEIASQLCDSVAKKLEGKVMGTFTTVASTVKQALQDSLVQILQPKRRVDILRDVMEAQSQRRPFVITFCGVNGVGKSTNLAKISYWLIENGFTVLIAACDTFRAGAVEQLRTHQRRLNALHPPEKHGGQPVVQLYEKGYGKDAAGIAMEAIAYARNQAFDVVLVDTAGRMQDNAPLMTALAKLIAVNMPDLVLFVGEALVGNEAVDQLVKFNQALADHSMSEKPRLIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYNDLRSLNARAVVGALM 641          
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Medaka
Match: srpra (SRP receptor subunit alpha [Source:NCBI gene;Acc:101163921])

HSP 1 Score: 90.1225 bits (222), Expect = 1.382e-18
Identity = 67/288 (23.26%), Postives = 127/288 (44.10%), Query Frame = 3
Query:  168 LIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKA-------WTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLK-------------QNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            LI  +V  ++ SQL  +V   +    +         ++QA+   LV+IL P  +            + +P ++ F G+ G GK+T + K++++  +  +   +   DTFRAGA +QL+             ++  +  +  Y      D   IA E +   +N  F++++VDT+GR +    L   + ++     PD +++V +A +G     Q   F + +           +  +++TK D    K G A+S    T  PI+F+ TG+   D+     +  V  L+
Sbjct:  274 LIAKNVAAEIASQLCDSVAKKLEGKVMGTFTTVASTVKQALQDSLVQILQPKRRVDILRDVMEAQSQRRPFVITFCGVNGVGKSTNLAKISYWLIENGFTVLIAACDTFRAGAVEQLRTHQRRLNALHPPEKHGGQPVVQLYEKGYGKDAAGIAMEAIAYARNQAFDVVLVDTAGRMQDNAPLMTALAKLIAVNMPDLVLFVGEALVGNEAVDQLVKFNQALADHSMSEKPRLIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYNDLRSLNARAVVGALM 561          
BLAST of Signal recognition particle 54 kDa protein vs. Planmine SMEST
Match: SMESG000030377.1 (SMESG000030377.1)

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 501/502 (99.80%), Postives = 502/502 (100.00%), Query Frame = 3
Query:   54 MVLAELGRKITNAFNQLNKATXXXXXXXXXXMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGMGRMG 1559
            MVLAELGRKITNAFNQLNKATIIDKDKLDDLMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTP+KGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGMGRMG
Sbjct:    1 MVLAELGRKITNAFNQLNKATIIDKDKLDDLMKVICTALIEADVNIKLISQLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPVKGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKLDGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDIEGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVSSIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQPTRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNVNPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGMGRMG 502          
BLAST of Signal recognition particle 54 kDa protein vs. Planmine SMEST
Match: SMESG000012673.1 (SMESG000012673.1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.083e-18
Identity = 53/222 (23.87%), Postives = 107/222 (48.20%), Query Frame = 3
Query:  345 KGKPNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQNATKAR----------IPFYGSYTE---TDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDSLFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVD----------VASVIITKLDG-HAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLL 938
            +G+P ++ F G+ G GK+T + K++ +  ++ ++  +   DTFR+GA +QL+ +  K            +P    Y +    D   +A   +   K  +F+++++DTSGR +  + L   + ++ N  +PD +++V +A +G     Q   F + +           +  +++TK D    K G A+S       PI+F+ TG+   D+     +  V+ L+
Sbjct:  431 QGRPYVISFCGVNGVGKSTNLAKISFWLIEQGFRVMIAACDTFRSGAVEQLRVHVQKLNYIHPPEQHHGLPMVQLYEKGYGKDAAAVATYAISLAKEKHFDVVMIDTSGRMQDNEPLMRSLAKLINVNQPDLVLFVGEALVGHEAVDQLVKFNKALQDYSGSDHPRTINGIVLTKFDTIDDKVGAAISMTYILGQPIMFVGTGQTYADLRQLSPEAVVKSLM 652          
The following BLAST results are available for this feature:
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRP540.000e+075.10signal recognition particle 54 [Source:HGNC Symbol... [more]
SRP540.000e+075.10signal recognition particle 54 [Source:HGNC Symbol... [more]
SRP540.000e+076.47signal recognition particle 54 [Source:HGNC Symbol... [more]
SRP540.000e+077.19signal recognition particle 54 [Source:HGNC Symbol... [more]
SRP546.966e-1959.46signal recognition particle 54 [Source:HGNC Symbol... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F21D5.70.000e+068.27Signal recognition particle 54 kDa protein [Sourc... [more]
F38A1.81.064e-2025.27pep chromosome:WBcel235:IV:1232872:1239852:-1 gene... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Srp54k0.000e+070.31gene:FBgn0010747 transcript:FBtr0077169[more]
Gtp-bp3.110e-1924.91gene:FBgn0010391 transcript:FBtr0073480[more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
srp540.000e+074.70signal recognition particle 54 [Source:ZFIN;Acc:ZD... [more]
srp540.000e+074.70signal recognition particle 54 [Source:ZFIN;Acc:ZD... [more]
srpra1.120e-1822.92SRP receptor subunit alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srp540.000e+075.50signal recognition particle 54kDa [Source:NCBI gen... [more]
srp540.000e+076.37signal recognition particle 54kDa [Source:NCBI gen... [more]
srp540.000e+062.45signal recognition particle 54kDa [Source:NCBI gen... [more]
SRPRA2.351e-1724.60SRP receptor subunit alpha [Source:NCBI gene;Acc:1... [more]
SRPRA3.000e-1724.60SRP receptor subunit alpha [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srp54b0.000e+074.90signal recognition particle 54B [Source:MGI Symbol... [more]
Srp54a0.000e+074.90signal recognition particle 54A [Source:MGI Symbol... [more]
Srp54a0.000e+074.90signal recognition particle 54A [Source:MGI Symbol... [more]
Srp54c0.000e+074.10signal recognition particle 54C [Source:MGI Symbol... [more]
Srp54c0.000e+074.10signal recognition particle 54C [Source:MGI Symbol... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R4R6|SRP54_PONAB0.000e+075.10Signal recognition particle 54 kDa protein OS=Pong... [more]
sp|Q4R965|SRP54_MACFA0.000e+075.10Signal recognition particle 54 kDa protein OS=Maca... [more]
sp|P61011|SRP54_HUMAN0.000e+075.10Signal recognition particle 54 kDa protein OS=Homo... [more]
sp|P61010|SRP54_CANLF0.000e+075.10Signal recognition particle 54 kDa protein OS=Cani... [more]
sp|Q2T9U1|SRP54_BOVIN0.000e+075.10Signal recognition particle 54 kDa protein OS=Bos ... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8FAQ20.000e+075.70Signal recognition particle 54 kDa protein OS=Xeno... [more]
Q6P8620.000e+075.50Signal recognition particle 54 kDa protein OS=Xeno... [more]
A0A1W7RDC10.000e+075.70Signal recognition particle 54 kDa protein OS=Agki... [more]
T1DIN40.000e+075.70Signal recognition particle 54 kDa protein OS=Crot... [more]
A0A0F7Z5Y40.000e+075.70Signal recognition particle 54 kDa protein OS=Crot... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srp540.000e+075.10signal recognition particle 54 [Source:NCBI gene;A... [more]
srpra1.011e-1923.96SRP receptor subunit alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srp540.000e+073.44signal recognition particle 54 [Source:ZFIN;Acc:ZD... [more]
srpra6.074e-1523.62SRP receptor subunit alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SRP541.139e-14651.16Signal recognition particle (SRP) subunit (homolog... [more]
SRP1012.874e-1926.87Signal recognition particle (SRP) receptor alpha s... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO495740.000e+073.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460431.355e-2023.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SRP540.000e+074.70signal recognition particle 54 [Source:NCBI gene;A... [more]
srpra1.170e-1823.26SRP receptor subunit alpha [Source:NCBI gene;Acc:1... [more]
srpra1.382e-1823.26SRP receptor subunit alpha [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Signal recognition particle 54 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000030377.10.000e+099.80SMESG000030377.1[more]
SMESG000012673.12.083e-1823.87SMESG000012673.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029971 ID=SMED30029971|Name=Signal recognition particle 54 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1738bp
CAATTGAGATTTGTATATTAAGAATTTAAAAATCAAAATTTAGTTTTAGA
AACATGGTTTTAGCCGAGTTAGGAAGGAAAATAACCAATGCGTTCAATCA
GTTGAATAAAGCAACTATTATCGATAAAGATAAATTAGATGATTTAATGA
AAGTAATATGCACAGCTCTTATAGAAGCTGATGTTAACATAAAATTGATA
TCCCAATTGCGAACAAATGTGAAAAACGCTATTAATTTTGATGAAATAGC
TGTTGGAATGAATAAACGTCGTTTAATTCAACAAGCTGTATTTCATGAAT
TAGTTAGAATTTTAAATCCAGGAACCAAAGCTTGGACTCCAATTAAAGGT
AAACCAAATATTGTCATGTTTGTTGGTTTACAAGGTAGTGGTAAAACCAC
CACTGTAACAAAAATGGCTCATTATTATCAAAAGAAGCATTGGAAAACTT
GTATGATATGCGCCGATACTTTTCGTGCTGGTGCGTTTGATCAATTGAAG
CAGAATGCAACTAAAGCTAGAATTCCATTCTATGGTAGTTACACAGAAAC
CGATCCAGTCATTATTGCTCAAGAAGGTGTTGAACAATTCAAAAATGATA
ATTTCGAAATTATTATCGTCGACACAAGTGGTCGACACAAACAAGAAGAT
TCATTATTCGAAGAAATGTTGCAAGTAGCAAACACTATTAAACCCGATAA
TATAGTTTACGTTATGGATGCATCAATCGGTCAAGCTTGTGAATCACAAG
CCAGAGCTTTCAAAGAATGCGTTGATGTAGCGTCTGTGATAATTACAAAA
TTAGATGGACACGCAAAAGGTGGAGGAGCCCTAAGTGCTGTCGCAGCAAC
CCAGAGTCCAATCATATTCATCTGCACCGGGGAACACATAGAAGATATCG
AACCGTTCAAGGTGCAACCGTTCGTCCAGAAATTGCTAGGAATGGGTGAC
ATCGAAGGTTTGATTGACAAAGTGAACGAGCTCAAGTTGGAAGACAACGA
GGAATTGGCGAAGAAATTGAAACAAGGTGTGTTTACCCTGGGCGATATGT
ATGAACAGTTTCAGAATATCATGAAATTGGGACCGTTCTCGCAGATCGTG
AGCTCGATTCCCGGATTCGGACAGGATTTCATGAGCAAGGGCAATGAGCA
GGAGTCTCAGGCGAAATTAAAGAAAATGATGGTCATAATGGACAGCATGA
GTCAGAAGGAGTTGGATCATCCTGATGGCGCGAAATTGTTCTCCAGGCAA
CCGACACGCACCCAGAGAGTTGCTAGAGGCTCCGGGAGTAGCATCAAAGA
AGTGAATGAGTTGTTGCAGACTTACACGAAATTCTCTCAGGTGGTCAAAA
AAATGGGTGGCATTAAAGGCCTGTTCAAAGATGGGGATATGACAAAGAAT
GTCAATCCTAACAAAATGTCCCAGTTGAACCAATCAATGATGCGTATGAT
GGATCCTCGAATGCTGCAGCAAATGGGCGGCCAGGCAGGCTTGAACAACC
TCTTAAAACAGTTCCAGAACGGCGCAGCAGGCAAAATACCGGGAATGGGC
AGGATGGGGTAACCAATGGCCCACAAGTGCCTCGGCCATCGCGACAATCT
CTAAGTACCACCGCTGCCGTATTGAGGATGTGAATAAATTAATTTTTTTC
TCATGTCTCACTCTCTGTCTCTCTTATCATTGCGTTACTTGCGTTCCTTT
CCACAGGATTCATGATAATAATAATAATAATAATAATA
back to top

protein sequence of SMED30029971-orf-1

>SMED30029971-orf-1 ID=SMED30029971-orf-1|Name=SMED30029971-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=503bp
MVLAELGRKITNAFNQLNKATIIDKDKLDDLMKVICTALIEADVNIKLIS
QLRTNVKNAINFDEIAVGMNKRRLIQQAVFHELVRILNPGTKAWTPIKGK
PNIVMFVGLQGSGKTTTVTKMAHYYQKKHWKTCMICADTFRAGAFDQLKQ
NATKARIPFYGSYTETDPVIIAQEGVEQFKNDNFEIIIVDTSGRHKQEDS
LFEEMLQVANTIKPDNIVYVMDASIGQACESQARAFKECVDVASVIITKL
DGHAKGGGALSAVAATQSPIIFICTGEHIEDIEPFKVQPFVQKLLGMGDI
EGLIDKVNELKLEDNEELAKKLKQGVFTLGDMYEQFQNIMKLGPFSQIVS
SIPGFGQDFMSKGNEQESQAKLKKMMVIMDSMSQKELDHPDGAKLFSRQP
TRTQRVARGSGSSIKEVNELLQTYTKFSQVVKKMGGIKGLFKDGDMTKNV
NPNKMSQLNQSMMRMMDPRMLQQMGGQAGLNNLLKQFQNGAAGKIPGMGR
MG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042101SRP54_N_sf
IPR006325SRP54_euk
IPR036891Signal_recog_part_SRP54_M_sf
IPR022941SRP54
IPR036225SRP/SRP_N
IPR013822Signal_recog_particl_SRP54_hlx
IPR000897SRP54_GTPase_dom
IPR003593AAA+_ATPase
IPR004125Signal_recog_particle_SRP54_M
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:00083127S RNA binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003924GTPase activity
GO:0008144drug binding
GO:0019003GDP binding
GO:0030942endoplasmic reticulum signal peptide binding
Vocabulary: biological process
TermDefinition
GO:0006614SRP-dependent cotranslational protein targeting to membrane
GO:0042493response to drug
GO:0045047protein targeting to ER
Vocabulary: cellular component
TermDefinition
GO:0048500signal recognition particle
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005786signal recognition particle, endoplasmic reticulum targeting
GO:0016607nuclear speck
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000897Signal recognition particle, SRP54 subunit, GTPase domainSMARTSM00962SRP54_3coord: 101..296
e-value: 4.0E-89
score: 312.1
IPR000897Signal recognition particle, SRP54 subunit, GTPase domainPFAMPF00448SRP54coord: 101..296
e-value: 2.8E-76
score: 255.5
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 100..294
e-value: 8.4E-6
score: 35.3
IPR013822Signal recognition particle SRP54, helical bundleSMARTSM00963SRP54_N_2coord: 2..87
e-value: 8.9E-14
score: 61.8
IPR013822Signal recognition particle SRP54, helical bundlePFAMPF02881SRP54_Ncoord: 6..83
e-value: 5.2E-18
score: 65.0
IPR042101Signal recognition particle SRP54, N-terminal domain superfamilyGENE3DG3DSA:1.20.120.140coord: 6..306
e-value: 3.1E-114
score: 382.9
IPR006325Signal recognition particle, SRP54 subunit, eukaryoticTIGRFAMTIGR01425TIGR01425coord: 2..429
e-value: 6.2E-213
score: 705.3
IPR004125Signal recognition particle, SRP54 subunit, M-domainPFAMPF02978SRP_SPBcoord: 327..430
e-value: 5.4E-30
score: 103.9
IPR036891Signal recognition particle, SRP54 subunit, M-domain superfamilyGENE3DG3DSA:1.10.260.30coord: 326..434
e-value: 7.5E-41
score: 141.0
IPR036891Signal recognition particle, SRP54 subunit, M-domain superfamilySUPERFAMILYSSF47446Signal peptide-binding domaincoord: 298..435
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 91..285
e-value: 3.1E-114
score: 382.9
NoneNo IPR availablePANTHERPTHR11564:SF5SIGNAL RECOGNITION PARTICLE 54 KDA PROTEINcoord: 1..498
NoneNo IPR availableCDDcd17875SRP54_Gcoord: 102..294
e-value: 6.70742E-137
score: 391.171
IPR022941Signal recognition particle, SRP54 subunitPANTHERPTHR11564GTPASE CONTAINING FAMILY OF SIGNAL RECOGNITION PARTICLE PROTEINScoord: 1..498
IPR036225SRP/SRP receptor, N-terminalSUPERFAMILYSSF47364Domain of the SRP/SRP receptor G-proteinscoord: 1..92
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 95..298