GNAT family N-acetyltransferase

Overview
NameGNAT family N-acetyltransferase
Smed IDSMED30029942
Length (bp)706
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GNAT family N-acetyltransferase (SMED30029942) t-SNE clustered cells

Violin plots show distribution of expression levels for GNAT family N-acetyltransferase (SMED30029942) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GNAT family N-acetyltransferase (SMED30029942) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GNAT family N-acetyltransferase (SMED30029942) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029942

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029942SMESG000036868.1 SmedASXL_008158SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30029942SMESG000036868.1 dd_Smed_v6_12435_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029942SMESG000036868.1 dd_Smed_v4_12435_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30029942SMESG000036868.1 dd_Smed_v4_12435_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GNAT family N-acetyltransferase vs. Ensembl Human
Match: SAT2 (spermidine/spermine N1-acetyltransferase family member 2 [Source:HGNC Symbol;Acc:HGNC:23160])

HSP 1 Score: 80.8777 bits (198), Expect = 2.157e-18
Identity = 47/160 (29.38%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M +++IR  K  DC  +   I +L + E L    K++ + LR D F D+P ++CL+ E            + GY ++  IY +  G+ IY+EDIYV    R + IGS +++ + E     G S+  L  L  N+   + Y  +G  + T+  G+ ++C  
Sbjct:    1 MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQ 160          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Human
Match: SATL1 (spermidine/spermine N1-acetyl transferase like 1 [Source:HGNC Symbol;Acc:HGNC:27992])

HSP 1 Score: 75.0998 bits (183), Expect = 5.941e-15
Identity = 47/139 (33.81%), Postives = 71/139 (51.08%), Query Frame = 1
Query:   79 HFEMENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR-------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNENFY 474
               M+  +IR  +  DC  +   I +L   E +    +LTA DL RD F D+PLFYCLI E ND+ +       G+ M+   YDS  GK +Y+ED YV    +   IG+ +++ L +    N Y+    + L S E ++
Sbjct:  523 QTSMDYFQIRHAEAGDCPEILRLIKELAACENMLDAMELTAADLLRDGFGDNPLFYCLIAEVNDQQKPSGKLTVGFAMYYFTYDSWTGKVLYLEDFYVTQAYQGLGIGAEMLKRLSQA-SINYYTSRGALDLSSEEGWH 660          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Human
Match: SATL1 (spermidine/spermine N1-acetyl transferase like 1 [Source:HGNC Symbol;Acc:HGNC:27992])

HSP 1 Score: 74.7146 bits (182), Expect = 6.679e-15
Identity = 42/117 (35.90%), Postives = 62/117 (52.99%), Query Frame = 1
Query:   79 HFEMENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR-------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIE 408
               M+  +IR  +  DC  +   I +L   E +    +LTA DL RD F D+PLFYCLI E ND+ +       G+ M+   YDS  GK +Y+ED YV    +   IG+ +++ L +
Sbjct:  336 QTSMDYFQIRHAEAGDCPEILRLIKELAACENMLDAMELTAADLLRDGFGDNPLFYCLIAEVNDQQKPSGKLTVGFAMYYFTYDSWTGKVLYLEDFYVTQAYQGLGIGAEMLKRLSQ 452          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Human
Match: SAT1 (spermidine/spermine N1-acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:10540])

HSP 1 Score: 71.2478 bits (173), Expect = 9.365e-15
Identity = 46/160 (28.75%), Postives = 73/160 (45.62%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M    IR     DC  +   I +L   E +     LT  DL  D F +HP ++CL+ E        E   I G+ M+   YD   GK +Y+ED +V ++ R   IGS +++ L +   +   S M  +    NE   NFY + G ++ +   G+  + +D
Sbjct:    1 MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKID 160          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Human
Match: SATL1 (spermidine/spermine N1-acetyl transferase like 1 [Source:HGNC Symbol;Acc:HGNC:27992])

HSP 1 Score: 73.9442 bits (180), Expect = 1.483e-14
Identity = 42/117 (35.90%), Postives = 62/117 (52.99%), Query Frame = 1
Query:   79 HFEMENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR-------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIE 408
               M+  +IR  +  DC  +   I +L   E +    +LTA DL RD F D+PLFYCLI E ND+ +       G+ M+   YDS  GK +Y+ED YV    +   IG+ +++ L +
Sbjct:  523 QTSMDYFQIRHAEAGDCPEILRLIKELAACENMLDAMELTAADLLRDGFGDNPLFYCLIAEVNDQQKPSGKLTVGFAMYYFTYDSWTGKVLYLEDFYVTQAYQGLGIGAEMLKRLSQ 639          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Celegans
Match: D2023.4 (pep chromosome:WBcel235:V:11825033:11825762:-1 gene:WBGene00008408.1 transcript:D2023.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2023.4)

HSP 1 Score: 56.225 bits (134), Expect = 7.158e-10
Identity = 40/158 (25.32%), Postives = 74/158 (46.84%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIGFTNDTKRLGYEWYCMDISGDNQ 552
            M+N +I  + PD    L + I++L + E + S    TA+ LR+D   ++   +  I    +E  G  +F   Y +  G+ +++ED+Y+    R   +   L + L E  +  G  ++    L  N+N    Y  + + N TK  G+  + MD +  N+
Sbjct:    1 MKNFEIVTVTPDHAEQLISMIHELAEFEKMKSSVVNTAEKLRKDI--ENKAVHGFIAFIGEEPAGMNLFYYAYSTWVGQYLHMEDLYIRPQFRRMGLARTLWKKLAELARDKGIVRLEWAVLDWNKNAIALYDTVDYVNLTKSEGWFTFRMDGAAINK 156          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Celegans
Match: gna-1 (Glucosamine 6-phosphate N-acetyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q17427])

HSP 1 Score: 49.2914 bits (116), Expect = 2.893e-7
Identity = 30/140 (21.43%), Postives = 70/140 (50.00%), Query Frame = 1
Query:   91 ENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIRGYCMFCSIYDSDY----GKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNENFYTKIGFTND 498
            +N K+R L  DD    K +++ L+    +G+  +   +       +  P ++ +++E+++  +       + +  +    G +  +ED+ V+  +R +K+G+ L++ L+  GK  G  K++L  +     FY++ GF +D
Sbjct:   20 DNFKVRPLAKDDFS--KGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDD 157          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Fly
Match: CG4210 (gene:FBgn0038302 transcript:FBtr0083049)

HSP 1 Score: 48.521 bits (114), Expect = 7.646e-7
Identity = 35/160 (21.88%), Postives = 73/160 (45.62%), Query Frame = 1
Query:  121 DDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAF----SDHPLFYCLIVEENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMA--LISLGSNENFYTKIGFTNDTKRLGYEWYCMDISGDNQKCQNLSNNIR 582
            +D   + + I +L D E + +  +LT +DL+RDA      ++   Y L+  + D+  GY +    Y +  G+  ++EDIYV    R +  G  +   +     +    ++   ++       FY  +G  + T + G+ +Y +    + Q+   L+ ++R
Sbjct:   15 EDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWNPARKFYESLGAVDLTDKEGWHYYRV----EEQQLAKLAADLR 170          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Zebrafish
Match: si:dkey-19b23.15 (si:dkey-19b23.15 [Source:ZFIN;Acc:ZDB-GENE-160728-17])

HSP 1 Score: 83.5741 bits (205), Expect = 1.346e-19
Identity = 51/162 (31.48%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   94 NIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIGFTNDTKRLGYEWYCMDISGD 546
            +  IR    +DC  +   I +L + E +  H K+T  DL +D FS +P F+ +I E  + ++        GY ++  +Y S  G+ +Y+ED+YV    R K IG ALM  + + G   G +++    L  N++   FY K G  + T  LGY  +CM   G+
Sbjct:    2 DFTIRAATLEDCKDISRMILELAEFEKVSDHVKITQRDLEQDGFSKNPFFHGIIAEVPEHLKSREGHTKVGYSLYFYMYSSWKGRAVYMEDLYVMPEFRGKGIGKALMAKVSQLGLAAGCTQLNFTVLDWNKSSLDFYLKQGCWDVTSELGY--HCMRCEGE 161          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Zebrafish
Match: SAT2 (si:dkey-19b23.15 [Source:ZFIN;Acc:ZDB-GENE-160728-17])

HSP 1 Score: 83.5741 bits (205), Expect = 1.346e-19
Identity = 51/162 (31.48%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   94 NIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIGFTNDTKRLGYEWYCMDISGD 546
            +  IR    +DC  +   I +L + E +  H K+T  DL +D FS +P F+ +I E  + ++        GY ++  +Y S  G+ +Y+ED+YV    R K IG ALM  + + G   G +++    L  N++   FY K G  + T  LGY  +CM   G+
Sbjct:    2 DFTIRAATLEDCKDISRMILELAEFEKVSDHVKITQRDLEQDGFSKNPFFHGIIAEVPEHLKSREGHTKVGYSLYFYMYSSWKGRAVYMEDLYVMPEFRGKGIGKALMAKVSQLGLAAGCTQLNFTVLDWNKSSLDFYLKQGCWDVTSELGY--HCMRCEGE 161          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Zebrafish
Match: sat2a (spermidine/spermine N1-acetyltransferase family member 2a [Source:ZFIN;Acc:ZDB-GENE-041212-21])

HSP 1 Score: 80.1073 bits (196), Expect = 2.654e-18
Identity = 49/162 (30.25%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   94 NIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIGFTNDTKRLGYEWYCMDISGD 546
            +  IR    +DC  +   I +L + E +  H K+T  DL +D FS +P F+ +I E  + ++        GY ++  +Y++  G+ +Y+ D+YV    R K IG ALM  + + G   G +++    L  N++   FY K G  + T  LGY  +CM   G+
Sbjct:    2 DFTIRAATFEDCKDISRMILELAEFEKVSDHVKITQRDLEQDGFSKNPFFHGIIAEVPEHLKSREGHTKIGYSLYFYMYNTWKGRAVYMVDLYVMAEFRGKGIGKALMTKVSQLGLAAGCTQLNFTVLDWNKSSLDFYLKQGCWDVTSELGY--HCMRCEGE 161          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Zebrafish
Match: sat2a (spermidine/spermine N1-acetyltransferase family member 2a [Source:ZFIN;Acc:ZDB-GENE-041212-21])

HSP 1 Score: 80.1073 bits (196), Expect = 2.654e-18
Identity = 49/162 (30.25%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   94 NIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIGFTNDTKRLGYEWYCMDISGD 546
            +  IR    +DC  +   I +L + E +  H K+T  DL +D FS +P F+ +I E  + ++        GY ++  +Y++  G+ +Y+ D+YV    R K IG ALM  + + G   G +++    L  N++   FY K G  + T  LGY  +CM   G+
Sbjct:    2 DFTIRAATFEDCKDISRMILELAEFEKVSDHVKITQRDLEQDGFSKNPFFHGIIAEVPEHLKSREGHTKIGYSLYFYMYNTWKGRAVYMVDLYVMAEFRGKGIGKALMTKVSQLGLAAGCTQLNFTVLDWNKSSLDFYLKQGCWDVTSELGY--HCMRCEGE 161          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Zebrafish
Match: sat1b (spermidine/spermine N1-acetyltransferase 1b [Source:ZFIN;Acc:ZDB-GENE-041001-39])

HSP 1 Score: 72.4034 bits (176), Expect = 1.957e-15
Identity = 45/160 (28.12%), Postives = 77/160 (48.12%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE--------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M N  +R  +P D   +   I +L   E +     +T  DL  D F +HP ++C++ + + E        + G+ M+   YD   GK +Y+ED YV    R   IGS +++ L +   KN  S M  I   SN+   +FY + G ++ + + G+  + +D
Sbjct:    1 MANFNLRKAEPKDVPDILRLIKELAKYEEMEDQVLITEKDLLEDGFGEHPFYHCVVADVSAEHQKVEGYSVIGFAMYYFTYDPWIGKLLYLEDFYVMKEYRGFGIGSEILKHLSDTAVKNRCSSMHFIVAESNKTSIDFYKRRGASDLSLQEGWRLFRID 160          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Xenopus
Match: sat1 (spermidine/spermine N1-acetyltransferase 1 [Source:NCBI gene;Acc:493359])

HSP 1 Score: 67.3958 bits (163), Expect = 2.311e-13
Identity = 45/160 (28.12%), Postives = 70/160 (43.75%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE--------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M    IR     DC  +   I +L   E + +   LT  DL  D F +HP ++CL+ E   E        I G+ M+   YD   GK +Y+ED +V +  R   +GS + + L +   K   S M  +    NE    FY + G  + +   G+  + +D
Sbjct:    1 MAKFIIRSANAGDCKDILRLIKELAKYEDMENQVVLTEKDLLEDGFGEHPFYHCLVAEVPKETQSADGYTIVGFAMYYFTYDPWIGKLLYLEDFFVMDEFRGFGMGSEIFKHLSQIAMKCRCSSMHFLVAEWNEPSIKFYKRRGAADLSTEEGWRLFKID 160          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Xenopus
Match: sat1 (spermidine/spermine N1-acetyltransferase 1 [Source:NCBI gene;Acc:493359])

HSP 1 Score: 57.7658 bits (138), Expect = 5.396e-10
Identity = 32/103 (31.07%), Postives = 47/103 (45.63%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE--------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNK 372
            M    IR     DC  +   I +L   E + +   LT  DL  D F +HP ++CL+ E   E        I G+ M+   YD   GK +Y+ED +V +  R +
Sbjct:    1 MAKFIIRSANAGDCKDILRLIKELAKYEDMENQVVLTEKDLLEDGFGEHPFYHCLVAEVPKETQSADGYTIVGFAMYYFTYDPWIGKLLYLEDFFVMDEFRGR 103          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Xenopus
Match: sat1 (spermidine/spermine N1-acetyltransferase 1 [Source:NCBI gene;Acc:493359])

HSP 1 Score: 56.225 bits (134), Expect = 2.269e-9
Identity = 43/157 (27.39%), Postives = 68/157 (43.31%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE-----IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M    IR     DC  +   I   + A     HT +  + L  D F +HP ++CL+ E   E     I G+ M+   YD   GK +Y+ED +V +  R   +GS + + L +   K   S M  +    NE    FY + G  + +   G+  + +D
Sbjct:    1 MAKFIIRSANAGDCKDILRLIKVHSFA---AKHTYI-GEYLLEDGFGEHPFYHCLVAEVPKETQRYTIVGFAMYYFTYDPWIGKLLYLEDFFVMDEFRGFGMGSEIFKHLSQIAMKCRCSSMHFLVAEWNEPSIKFYKRRGAADLSTEEGWRLFKID 153          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Xenopus
Match: ivd (isovaleryl-CoA dehydrogenase [Source:Xenbase;Acc:XB-GENE-1008677])

HSP 1 Score: 57.3806 bits (137), Expect = 2.467e-9
Identity = 39/144 (27.08%), Postives = 63/144 (43.75%), Query Frame = 1
Query:  124 DCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDH-PLFYCLIVEEND--------EIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYE 519
             C+     + +L D E L    + + + LRRD F +  PLF CL+ E  D         + G+ +    Y +  G+ +Y+ED+YV    R K +GS L+  + E     G   +    L  N    +FY   G  + T+  G+ 
Sbjct:   76 SCVGAFAPLQELADYEKLPDQVRNSVEGLRRDGFEEPSPLFRCLVAEPTDGCGQGDGPALIGFALCYMTYSTWKGRALYMEDLYVMPQYRGKGVGSQLLAAVAEMCLSLGCCHLQFSVLDWNSPAISFYHSRGAKDLTQAEGWH 219          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000031460.1 (spermidine/spermine N1-acetyl transferase like 1 [Source:NCBI gene;Acc:100488114])

HSP 1 Score: 54.6842 bits (130), Expect = 1.601e-8
Identity = 38/161 (23.60%), Postives = 71/161 (44.10%), Query Frame = 1
Query:  103 IRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE---------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGDN 549
            IR    DDC  +   I +L   E + +  K+T  +L  + F   P +YCLI E         E+++  G+ M+   YD   G+ +++E+ +V    R   IGS +++ + +         M  + L  N     +Y + G  + +++ G  W+    + D 
Sbjct:   44 IRKATKDDCGDILRLIKELATYENMSNAVKITEKELLENGFGGEPCYYCLIAEVPKENLCDAESNKAVGFAMYYFTYDPWIGRALHLEEFFVMEQYRGLGIGSKILKRVSQEAIDQHCKCMNFLVLSWNTPSVEYYKRRGALDLSEKEG--WHVFHFNSDT 202          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Mouse
Match: Sat2 (spermidine/spermine N1-acetyl transferase 2 [Source:MGI Symbol;Acc:MGI:1916465])

HSP 1 Score: 76.6406 bits (187), Expect = 4.965e-17
Identity = 46/167 (27.54%), Postives = 80/167 (47.90%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGDNQK 555
            M + +IR  +  DC  +   I +L + E L    K++ + LR D F ++P F+CL+ E        +   + GY ++  IY +  G+ +Y+EDIYV    R + IG+ +++ + E     G S+  L  L  N+   N Y  +G  + T+  G  W      G+  +
Sbjct:    1 MASTRIREARESDCGDIMRMIRELAEFEKLSHQVKISEEALRADGFGENPFFHCLVAEIIPAPGESQGSLVVGYGLYYFIYSTWTGRNVYLEDIYVMPQYRGQGIGTKIIKKVAEVALNKGCSQFRLAVLDWNKKAVNLYKFLGAQDLTESEG--WLSFRFEGEAMR 165          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Mouse
Match: Sat2 (spermidine/spermine N1-acetyl transferase 2 [Source:MGI Symbol;Acc:MGI:1916465])

HSP 1 Score: 76.6406 bits (187), Expect = 4.965e-17
Identity = 46/167 (27.54%), Postives = 80/167 (47.90%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGDNQK 555
            M + +IR  +  DC  +   I +L + E L    K++ + LR D F ++P F+CL+ E        +   + GY ++  IY +  G+ +Y+EDIYV    R + IG+ +++ + E     G S+  L  L  N+   N Y  +G  + T+  G  W      G+  +
Sbjct:    1 MASTRIREARESDCGDIMRMIRELAEFEKLSHQVKISEEALRADGFGENPFFHCLVAEIIPAPGESQGSLVVGYGLYYFIYSTWTGRNVYLEDIYVMPQYRGQGIGTKIIKKVAEVALNKGCSQFRLAVLDWNKKAVNLYKFLGAQDLTESEG--WLSFRFEGEAMR 165          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Mouse
Match: Sat1 (spermidine/spermine N1-acetyl transferase 1 [Source:MGI Symbol;Acc:MGI:98233])

HSP 1 Score: 75.8702 bits (185), Expect = 1.039e-16
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M   KIR     DC  +   I +L   E +     LT  DL+ D F +HP ++CL+ E        E   I G+ M+   YD   GK +Y+ED +V ++ R   IGS +++ L +   K   S M  +    NE   NFY + G ++ +   G+  + +D
Sbjct:    1 MAKFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKID 160          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Mouse
Match: Satl1 (spermidine/spermine N1-acetyl transferase-like 1 [Source:MGI Symbol;Acc:MGI:1921059])

HSP 1 Score: 76.2554 bits (186), Expect = 1.708e-15
Identity = 42/138 (30.43%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  103 IRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE-------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIG 486
            IR  +P+DC  +   I +L   EG+     LT  DL RD F D+PLFYCL+ E   E         G+ M+   YD   GK +++ED Y+  + +   IG+ +++ L +         M  + +  N++   +YT++G
Sbjct:  580 IRPAEPEDCPDILRLIKELASYEGMEEKVSLTERDLFRDGFGDNPLFYCLVAEAPSEQTESGVKTIGFAMYYFTYDPRIGKLLHLEDFYITEDYQGIGIGADMLKKLSQIAINTECCGMQFLVIIWNQDSVEYYTRLG 717          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Mouse
Match: Satl1 (spermidine/spermine N1-acetyl transferase-like 1 [Source:MGI Symbol;Acc:MGI:1921059])

HSP 1 Score: 72.7886 bits (177), Expect = 1.855e-14
Identity = 42/138 (30.43%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  103 IRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR-------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIG 486
            IR  +P+DC  +   I +L   EG+     LT  DL RD F D+PLFYCL+ E   E         G+ M+   YD   GK +++ED Y+  + +   IG+ +++ L +         M  + +  N++   +YT++G
Sbjct:  269 IRPAEPEDCPDILRLIKELASYEGMEEKVSLTERDLFRDGFGDNPLFYCLVAEAPSEQTESGVKTIGFAMYYFTYDPRIGKLLHLEDFYITEDYQGIGIGADMLKKLSQIAINTECCGMQFLVIIWNQDSVEYYTRLG 406          
BLAST of GNAT family N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q96F10|SAT2_HUMAN (Diamine acetyltransferase 2 OS=Homo sapiens OX=9606 GN=SAT2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.036e-17
Identity = 47/160 (29.38%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M +++IR  K  DC  +   I +L + E L    K++ + LR D F D+P ++CL+ E            + GY ++  IY +  G+ IY+EDIYV    R + IGS +++ + E     G S+  L  L  N+   + Y  +G  + T+  G+ ++C  
Sbjct:    1 MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQ 160          
BLAST of GNAT family N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q7PCJ9|SAT2_PIG (Diamine acetyltransferase 2 OS=Sus scrofa OX=9823 GN=SAT2 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.592e-16
Identity = 50/167 (29.94%), Postives = 83/167 (49.70%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE---ENDEIRGYCM-----FCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGDNQK 555
            M ++ IR  K  DC ++   I +L + E L    K++ + LR D F ++P F+CL+ E      E +G CM     +  IY +  G+ IY+EDIYV+   R + IGS +++ + E     G S+  L  L  N+   + Y  +G  + T+  G  W+     G+  +
Sbjct:    1 MASVLIREAKEGDCGNILRMIRELAEYEKLSDQVKISEEALRADGFGENPFFHCLVAEILPAPGEPQGSCMVGYGLYYFIYSTWTGRNIYLEDIYVKPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNKKAVDLYKTLGARDLTEAEG--WHSFRFEGEAMR 165          
BLAST of GNAT family N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q7PCJ8|SAT2_BOVIN (Diamine acetyltransferase 2 OS=Bos taurus OX=9913 GN=SAT2 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.131e-16
Identity = 47/167 (28.14%), Postives = 82/167 (49.10%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGDNQK 555
            M  + IR  K  DC ++   I +L + E L    K++ + LR D F + P ++CL+ E        +   + GY ++   Y +  G+ IY+EDIYV+   R + IGS +++ + E     G S++ L  L  N+   + Y  +G  + T+  G  W+C    G+  +
Sbjct:    1 MAFVMIREAKEGDCGNILRLIRELAEYEKLSDQVKISEEALRADGFGETPFYHCLVAEILSAPGEPQGPCVVGYGLYYFSYSTWKGRNIYLEDIYVKPEYRGQGIGSKIIKKVAEVALDKGCSQLRLAVLDWNKRAMDLYKALGAQDLTEAEG--WHCFRFEGEAMR 165          
BLAST of GNAT family N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q8AXL1|SAT1_CHICK (Diamine acetyltransferase 1 OS=Gallus gallus OX=9031 GN=SAT1 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.599e-16
Identity = 48/160 (30.00%), Postives = 74/160 (46.25%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M +  IR  +P+DC  L   I +L   E +     LT  +L  D F +HP ++CL+ E        E   I G+ M+   YD   GK +Y+ED YV    R   IGS +++ L +   K   S M  +    NE    FY + G ++ +   G+  + +D
Sbjct:    1 MASFSIRAARPEDCSDLLRLIKELAKYEDMEDQVVLTEKELLEDGFGEHPFYHCLVAEVPKEQWSSEGHSIVGFAMYYFTYDPWIGKLLYLEDFYVMAEYRGLGIGSEILKNLSQVAVKCRCSSMHFLVAEWNEPSIRFYKRRGASDLSTEEGWRLFKID 160          
BLAST of GNAT family N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q6P8J2|SAT2_MOUSE (Diamine acetyltransferase 2 OS=Mus musculus OX=10090 GN=Sat2 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.473e-16
Identity = 46/167 (27.54%), Postives = 80/167 (47.90%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGDNQK 555
            M + +IR  +  DC  +   I +L + E L    K++ + LR D F ++P F+CL+ E        +   + GY ++  IY +  G+ +Y+EDIYV    R + IG+ +++ + E     G S+  L  L  N+   N Y  +G  + T+  G  W      G+  +
Sbjct:    1 MASTRIREARESDCGDIMRMIRELAEFEKLSHQVKISEEALRADGFGENPFFHCLVAEIIPAPGESQGSLVVGYGLYYFIYSTWTGRNVYLEDIYVMPQYRGQGIGTKIIKKVAEVALNKGCSQFRLAVLDWNKKAVNLYKFLGAQDLTESEG--WLSFRFEGEAMR 165          
BLAST of GNAT family N-acetyltransferase vs. TrEMBL
Match: A0A2C9JGE7 (N-acetyltransferase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106055987 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.109e-21
Identity = 54/156 (34.62%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEEND--EIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSN---ENFYTKIGFTNDTKRLGYEWYCMDIS 540
            + +I IR  KP+DC  +   I +L   E L    K+TA+ L++D F D PL YC++ E+ D  E+ GY ++ SIY +  G  +++ED+YV    R + IG+ L + + ++G   G +++ L  LG N   ++ YT  GF + T+  G  W+ M +S
Sbjct:    5 LSDITIRAAKPEDCHEIVRLIKELAVFEKLEDQVKMTAEVLQKDCFGDRPLCYCIVAEQQDSPELVGYALYFSIYSTFEGASLHLEDLYVNPAYRGRGIGTQLWKRVTKHGLDLGCNRLQLTVLGWNTKAKDLYTHYGFKDLTESEG--WHLMRMS 158          
BLAST of GNAT family N-acetyltransferase vs. TrEMBL
Match: C3Z8B6 (N-acetyltransferase domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_285620 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.333e-21
Identity = 54/153 (35.29%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE--------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTK---IGFTNDTK 504
            M + +IR L+P+DC  L N I +L + EGL    K+T + LRRD F D P + CLI E  ++          GY M+   Y +  G+ IY+ED+Y++   R K IG+++M  + + G +N   +M  + L  N+   +FY K   I  T+D K
Sbjct:    1 MSDFRIRDLQPEDCRELVNMIKELAEFEGLPEQVKITEETLRRDGFGDRPFYQCLIAEVRNKGSQDGPWLTVGYAMYFYSYGTWVGRMIYLEDLYIKPQYRGKGIGTSMMTKVAQIGVENECQRMQWVVLNWNQGAIDFYKKHDSIDLTSDEK 153          
BLAST of GNAT family N-acetyltransferase vs. TrEMBL
Match: A0A1L8H4E8 (N-acetyltransferase domain-containing protein OS=Xenopus laevis OX=8355 GN=XELAEV_18019588mg PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.863e-18
Identity = 50/151 (33.11%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  103 IRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR---------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYE 519
            IR  +  DC  +   I +L   EG+    KLT  +L+RD F D P F C++ E  D+ R         GY +F + Y S  G+ +++ED+YV    R + +G  LM+ + + G K+G S++ L  L  NE   + Y  +G  N T+  GY+
Sbjct:   33 IRPAQARDCSHIMAMIQELAQYEGISHFIKLTETELQRDGFGDTPWFRCIVAEVPDKERTGETGAPFAGYALFANSYSSWTGRTLHLEDLYVSPQFRGRGLGRLLMKKVAQEGLKSGCSQIHLTVLKWNEPAIHLYRSLGAENLTEEPGYQ 183          
BLAST of GNAT family N-acetyltransferase vs. TrEMBL
Match: A0A3D9BCH7 (GNAT family N-acetyltransferase OS=Candidatus Chryseobacterium massiliae OX=204089 GN=DRF68_07095 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.071e-18
Identity = 50/134 (37.31%), Postives = 67/134 (50.00%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTK 480
            ME I IR    +DC  +   I +L D E       LT D    D F   P++   + E N EI G  ++   Y +  G+++Y+ED+ V  NLR K+IG  L +  +EYGK N YS M    L  NE   NFY K
Sbjct:    1 MEQIIIRKAAQEDCEPMLELIKELADYEKALHEVTLTLDQFIEDGFGKSPVWGAFVAEFNGEIVGISLYYDRYSTWKGRRLYLEDLVVTENLRGKQIGKKLFEATMEYGKSNQYSGMVFQVLNWNEPAINFYKK 134          
BLAST of GNAT family N-acetyltransferase vs. TrEMBL
Match: A0A340X8E0 (diamine acetyltransferase 2 OS=Lipotes vexillifer OX=118797 GN=SAT2 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.177e-17
Identity = 49/167 (29.34%), Postives = 86/167 (51.50%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE--------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGDNQK 555
            M ++ IR  K  DC ++   I +L + E L    K++ + LR D F ++P ++CL+ E        +   + GY ++C IY +  G+ IY+EDIYV+   R + IGS +++ + E     G S++ L  L  N+   + Y  +G  + T+  G  W+C    G+  +
Sbjct:    1 MASVLIREAKEGDCGNILRLIRELAEYEKLSDQVKISEEALRADGFGENPFYHCLVAEILPAPGEPQGPCVVGYGLYCFIYSTWKGRNIYLEDIYVKPEYRGQGIGSKIIKKVAEVALDKGCSQLRLAVLDWNKGAMDLYKALGAQDLTEAEG--WHCFRFEGEAMR 165          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Cavefish
Match: sat2a (diamine acetyltransferase 2 [Source:NCBI gene;Acc:103043715])

HSP 1 Score: 83.5741 bits (205), Expect = 8.830e-20
Identity = 50/162 (30.86%), Postives = 80/162 (49.38%), Query Frame = 1
Query:   94 NIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGD 546
            +  +R    +DC  +   I +L + E +  H K+T  DL +D F+ +P F+ +I E  ++ R        GY ++   Y S  G+ +Y+ED+YV    R K IG ALM  + + G   G +++    L  N+   NFY   G  + T  +GY  +CM   GD
Sbjct:    2 DFTLRAATLEDCKDIARMITELAEYEKVSDHVKITQKDLEQDGFTKNPFFHGIIAEVPEQHRSKDGHTKVGYALYFYTYSSWKGRAVYMEDLYVMPEFRAKGIGKALMSKVAQLGLAAGCTQLNFAVLNWNKPSLNFYLSQGCFDVTSDMGY--HCMRCEGD 161          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Cavefish
Match: sat1b (diamine acetyltransferase 1-like [Source:NCBI gene;Acc:103030130])

HSP 1 Score: 79.7221 bits (195), Expect = 3.240e-18
Identity = 49/160 (30.63%), Postives = 75/160 (46.88%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            M N  +R  +P D   +   I  L   E +    KLT  DL  D F DHP ++C++ E   E++        G+ M+   YD   GK +Y+ED +V    R   IGS +++ L E   K   S M  I   SN+   NFY + G ++ +   G+  + +D
Sbjct:    1 MANFILRKAEPKDVPDILRLIKDLARYEEMEDQVKLTEKDLLEDGFGDHPFYHCVVAEVPAELQKVEGFSVIGFAMYYFTYDPWIGKLLYLEDFFVMKEYRGFGIGSEILKTLSETAVKTRCSSMHFIVAESNQASINFYKRRGASDLSLEEGWRLFRID 160          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Cavefish
Match: sat2a (diamine acetyltransferase 2 [Source:NCBI gene;Acc:103043715])

HSP 1 Score: 76.2554 bits (186), Expect = 2.080e-16
Identity = 46/143 (32.17%), Postives = 72/143 (50.35%), Query Frame = 1
Query:  151 NKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMDISGD 546
             +L + E +  H K+T  DL +D F+ +P F+ +I E  ++ R        GY ++   Y S  G+ +Y+ED+YV    R K IG ALM  + + G   G +++    L  N+   NFY   G  + T  +GY  +CM   GD
Sbjct:   85 KELAEYEKVSDHVKITQKDLEQDGFTKNPFFHGIIAEVPEQHRSKDGHTKVGYALYFYTYSSWKGRAVYMEDLYVMPEFRAKGIGKALMSKVAQLGLAAGCTQLNFAVLNWNKPSLNFYLSQGCFDVTSDMGY--HCMRCEGD 225          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Sea Lamprey
Match: sat2a (spermidine/spermine N1-acetyltransferase family member 2a [Source:ZFIN;Acc:ZDB-GENE-041212-21])

HSP 1 Score: 53.1434 bits (126), Expect = 4.403e-9
Identity = 32/114 (28.07%), Postives = 57/114 (50.00%), Query Frame = 1
Query:  193 LTADDLRRDAFSDHPLFYCLIVEENDE--------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNEN---FYTKIGFTNDT 501
            ++ +DLR + F ++P+F C++V+   +          GY ++   YD+  G+ I ++ IYV    RN  IG AL++ + E   +N  S +       N+    FY +IG  + T
Sbjct:   37 ISEEDLRTNGFGENPIFQCVVVKVPPKHGSSGKPAAVGYSLYFYSYDTINGRSITMDSIYVMPEFRNNGIGKALLKRVAETAAQNNCSSVCFYVYNWNKPAIAFYQRIGAQDVT 150          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Nematostella
Match: EDO38140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDV2])

HSP 1 Score: 48.521 bits (114), Expect = 2.473e-7
Identity = 24/79 (30.38%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  271 EIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTND 498
            ++ G+ +    Y    G+++ +E IYVE+  R + IG ALM+ + ++  + G  K++   +G NE   +FY  +G T D
Sbjct:   74 QLVGFALVNPGYSCYSGRRLRLEAIYVEDKYRGRGIGKALMKAIAKHATEQGCKKISWTVIGWNEKGISFYEALGATKD 152          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Nematostella
Match: EDO43475 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYK2])

HSP 1 Score: 47.3654 bits (111), Expect = 8.850e-7
Identity = 41/168 (24.40%), Postives = 68/168 (40.48%), Query Frame = 1
Query:   55 NIFYNS*VHFEMENIKIRWLKPDDCLSLKNFINKLNDAEG-LGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE--------------------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIG 486
            N    S V  ++   +IR   P D  ++   I  L   E    S  ++    L++D F +   F CL+ EE D+                    + GY ++   Y +  G+ +++EDI+V    R + IG   ++ L +     G  K+    L  N+   NFY  IG
Sbjct:    3 NTEETSEVPAQLSCWRIRAASPGDIPAILQLIKDLAVYEKEPESVVEINEQVLQKDCFGEERWFECLVAEEYDKNHLKPEGTKSSTPMPSHHHRVVGYALYFHAYSTWQGRMLFLEDIFVTPKSRGQGIGKTFLKELAKIAIHKGCCKIKWHVLDWNKLAINFYDSIG 170          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Medaka
Match: sat2a (diamine acetyltransferase 2 [Source:NCBI gene;Acc:101167325])

HSP 1 Score: 85.5001 bits (210), Expect = 2.127e-20
Identity = 52/162 (32.10%), Postives = 81/162 (50.00%), Query Frame = 1
Query:   94 NIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISL---GSNENFYTKIGFTNDTKRLGYEWYCMDISGD 546
            +  IR    +DC  +   I +L D E +  H K+T  DL +D FS +P F+ +I E  +++R        GY ++   Y S  G+ IY+ED+YV    R K IG ALM  + + G   G +++    L    S+ +FY   G  + T  +GY  +CM   G+
Sbjct:    2 DFSIRAANVEDCKDIARMIVELADYEKVTDHVKITQRDLEQDGFSKNPFFHGIIAEVPEQLRTKDGHTKVGYALYFYSYSSWAGRAIYMEDLYVMPEFRGKGIGKALMSKVAQLGLAAGCNQLNFTVLDWNKSSRDFYMSQGCCDVTTSMGY--HCMRCEGE 161          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Medaka
Match: sat2b (diamine acetyltransferase 2 [Source:NCBI gene;Acc:101174286])

HSP 1 Score: 78.1814 bits (191), Expect = 1.251e-17
Identity = 52/172 (30.23%), Postives = 80/172 (46.51%), Query Frame = 1
Query:   94 NIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE--------IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSN---ENFYTKIGFTNDTKRLGYEWYCMDISGDNQKCQNLSNN 576
            + KIR  K +DC  +   I +L   E +    K+  ++L RD F ++P F CL+ E  +E        + GY ++   Y +  G+ I++ED+YV    R   IG  L+  + E GKK    ++ L  L  N    +FY   G  + T   G  W+   I  D Q   NL+N 
Sbjct:    2 HFKIRPAKKEDCKEISRLIMELAVYEKMPDQVKIAHEELERDGFCENPFFQCLVAEVPEEHKSKEGFTVVGYALYFYTYSTWKGRSIFLEDLYVMPEFRGNGIGKGLLCKVAEVGKKKECVRLQLSVLDWNTPSRDFYAAKGAQDLTVSEG--WHA--IRFDGQSLDNLANE 169          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Medaka
Match: sat1a.1 (spermidine/spermine N1-acetyltransferase 1 [Source:NCBI gene;Acc:101174540])

HSP 1 Score: 68.5514 bits (166), Expect = 4.522e-14
Identity = 40/155 (25.81%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  100 KIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVE-------ENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSNE---NFYTKIGFTNDTKRLGYEWYCMD 534
            K+R  +P D   +   + +L   E +     LT  DL  D F + P ++C+I E       E+ ++ G+ M+   YD   GK++Y+E+ YV N  R   +GS +++ L +   K   + M  +   +N     FY + G  + ++  G+  +  D
Sbjct:    4 KLRKAEPKDVPDILRLVKELAKYEEMEHQVALTEKDLLEDGFGETPFYHCIIAEIQGESSSEDPKVGGFAMYYFTYDPWVGKQLYLEEFYVMNEYRGLGMGSEILRHLSDLAMKTRCTGMMFVVAENNAPSMQFYKRRGAEDLSQEEGWRLFRFD 158          
BLAST of GNAT family N-acetyltransferase vs. Ensembl Medaka
Match: sat2a (diamine acetyltransferase 2 [Source:NCBI gene;Acc:101167325])

HSP 1 Score: 64.6994 bits (156), Expect = 8.587e-13
Identity = 40/124 (32.26%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  208 LRRDAFSDHPLFYCLIVEENDEIR--------GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISL---GSNENFYTKIGFTNDTKRLGYEWYCMDISGD 546
            L +D FS +P F+ +I E  +++R        GY ++   Y S  G+ IY+ED+YV    R K IG ALM  + + G   G +++    L    S+ +FY   G  + T  +GY  +CM   G+
Sbjct:   30 LEQDGFSKNPFFHGIIAEVPEQLRTKDGHTKVGYALYFYSYSSWAGRAIYMEDLYVMPEFRGKGIGKALMSKVAQLGLAAGCNQLNFTVLDWNKSSRDFYMSQGCCDVTTSMGY--HCMRCEGE 151          
BLAST of GNAT family N-acetyltransferase vs. Planmine SMEST
Match: SMESG000036868.1 (SMESG000036868.1)

HSP 1 Score: 169.474 bits (428), Expect = 4.277e-54
Identity = 79/84 (94.05%), Postives = 82/84 (97.62%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIRGYCMFCSIYDSDYGKKIYIE 339
            MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIRGYCMFCSIYDSDYGK+  ++
Sbjct:    1 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDEIRGYCMFCSIYDSDYGKRFILK 84          
BLAST of GNAT family N-acetyltransferase vs. Planmine SMEST
Match: SMESG000037532.1 (SMESG000037532.1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.811e-18
Identity = 53/171 (30.99%), Postives = 81/171 (47.37%), Query Frame = 1
Query:   88 MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEENDE--IRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALISLGSN---ENFYTKIGFTNDTKRLGYEWYCMDISGDNQKCQNLSNNIRF 585
            M+   IRW + +D  ++   I  L   E       L+ D+L+RD FS     YCL+ E N    + G C+F   Y +  G+K+Y+ED+Y+E   R   I  AL++ L++Y + N    + L+ L  N      Y  + F N TK    EW  M+   D      LS++  F
Sbjct:    1 MDPFTIRWARENDAEAILQMIKNLATFERQPEAVILSVDELKRDLFSIDNYCYCLLAENNQTKTLVGMCLFNKAYSTWKGRKLYLEDLYIEEEFRGIGIAKALLKSLMQYAETNQIQVIHLVCLKWNIRALEMYDHLNFKNITKE--EEWELME--ADKVTILKLSHSSEF 167          
BLAST of GNAT family N-acetyltransferase vs. Planmine SMEST
Match: SMESG000026048.1 (SMESG000026048.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.352e-9
Identity = 47/140 (33.57%), Postives = 69/140 (49.29%), Query Frame = 1
Query:  100 KIRWLKPDDCLSLKNFINKL-NDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIV-EENDEIR---GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMAL---ISLGSNENFYTKIGFTN 495
            KI   K +D  S+ NF N L    EG+  +  LT+ +   DAF ++  F CLI+ EE+ EI+   GY ++   Y   +G   Y++D YV   LR K +G  LM  L +   +N    + L   I++   E  Y   GF N
Sbjct:    3 KICKAKVEDIPSVFNFTNNLVQQHEGMEQYF-LTSKESMLDAFKNN-YFECLILFEEDSEIKKAVGYILYTEEYSFLHGHGYYVDDFYVSPELRGKGLGRQLMNELFQIAAQNKAQYLKLVFQITVPGLEKMYLNFGFDN 140          
BLAST of GNAT family N-acetyltransferase vs. Planmine SMEST
Match: SMESG000026047.1 (SMESG000026047.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.406e-9
Identity = 47/140 (33.57%), Postives = 69/140 (49.29%), Query Frame = 1
Query:  100 KIRWLKPDDCLSLKNFINKL-NDAEGLGSHTKLTADDLRRDAFSDHPLFYCLIV-EENDEIR---GYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMAL---ISLGSNENFYTKIGFTN 495
            KI   K +D  S+ NF N L    EG+  +  LT+ +   DAF ++  F CLI+ EE+ EI+   GY ++   Y   +G   Y++D YV   LR K +G  LM  L +   +N    + L   I++   E  Y   GF N
Sbjct:    3 KICKAKVEDIPSVFNFTNNLVQQHEGMEQYF-LTSKESMLDAFKNN-YFECLILFEEDSEIKKAVGYILYTEEYSFLHGHGYYVDDFYVSPELRGKGLGRQLMNELFQIAAQNKAQYLKLVFQITVPGLEKMYLNFGFDN 140          
BLAST of GNAT family N-acetyltransferase vs. Planmine SMEST
Match: SMESG000028726.1 (SMESG000028726.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.989e-8
Identity = 45/141 (31.91%), Postives = 68/141 (48.23%), Query Frame = 1
Query:  103 IRWLKPDDCLSLKNFINKLND-AEGLGSHTKLTADDLRRDAFSDHPLFYCLIVEEN----DEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSALMQVLIEYGKKNGYSKMALI---SLGSNENFYTKIGFTNDT 501
            IR     D  ++ NF + L    EG+  +  L  + L   AF ++  F CLI+ EN    +E  GY ++   Y   +G   +++D +V +NLR K +G  LM  L E       + + LI   S+   EN YT +GF N T
Sbjct:    4 IRKATVSDISTIYNFTHNLVQYHEGMKDYFILNEEALLI-AFQNNA-FECLILFENLKDKEEAVGYLLYMEEYSFLHGNGYFVDDFFVTSNLRGKGLGKMLMHYLYELAITESRNFVKLIFQKSILGLENLYTGLGFVNIT 142          
The following BLAST results are available for this feature:
BLAST of GNAT family N-acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAT22.157e-1829.38spermidine/spermine N1-acetyltransferase family me... [more]
SATL15.941e-1533.81spermidine/spermine N1-acetyl transferase like 1 [... [more]
SATL16.679e-1535.90spermidine/spermine N1-acetyl transferase like 1 [... [more]
SAT19.365e-1528.75spermidine/spermine N1-acetyltransferase 1 [Source... [more]
SATL11.483e-1435.90spermidine/spermine N1-acetyl transferase like 1 [... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
D2023.47.158e-1025.32pep chromosome:WBcel235:V:11825033:11825762:-1 gen... [more]
gna-12.893e-721.43Glucosamine 6-phosphate N-acetyltransferase [Sour... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG42107.646e-721.88gene:FBgn0038302 transcript:FBtr0083049[more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-19b23.151.346e-1931.48si:dkey-19b23.15 [Source:ZFIN;Acc:ZDB-GENE-160728-... [more]
SAT21.346e-1931.48si:dkey-19b23.15 [Source:ZFIN;Acc:ZDB-GENE-160728-... [more]
sat2a2.654e-1830.25spermidine/spermine N1-acetyltransferase family me... [more]
sat2a2.654e-1830.25spermidine/spermine N1-acetyltransferase family me... [more]
sat1b1.957e-1528.13spermidine/spermine N1-acetyltransferase 1b [Sourc... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sat12.311e-1328.13spermidine/spermine N1-acetyltransferase 1 [Source... [more]
sat15.396e-1031.07spermidine/spermine N1-acetyltransferase 1 [Source... [more]
sat12.269e-927.39spermidine/spermine N1-acetyltransferase 1 [Source... [more]
ivd2.467e-927.08isovaleryl-CoA dehydrogenase [Source:Xenbase;Acc:X... [more]
ENSXETT00000031460.11.601e-823.60spermidine/spermine N1-acetyl transferase like 1 [... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sat24.965e-1727.54spermidine/spermine N1-acetyl transferase 2 [Sourc... [more]
Sat24.965e-1727.54spermidine/spermine N1-acetyl transferase 2 [Sourc... [more]
Sat11.039e-1630.00spermidine/spermine N1-acetyl transferase 1 [Sourc... [more]
Satl11.708e-1530.43spermidine/spermine N1-acetyl transferase-like 1 [... [more]
Satl11.855e-1430.43spermidine/spermine N1-acetyl transferase-like 1 [... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96F10|SAT2_HUMAN1.036e-1729.38Diamine acetyltransferase 2 OS=Homo sapiens OX=960... [more]
sp|Q7PCJ9|SAT2_PIG1.592e-1629.94Diamine acetyltransferase 2 OS=Sus scrofa OX=9823 ... [more]
sp|Q7PCJ8|SAT2_BOVIN2.131e-1628.14Diamine acetyltransferase 2 OS=Bos taurus OX=9913 ... [more]
sp|Q8AXL1|SAT1_CHICK2.599e-1630.00Diamine acetyltransferase 1 OS=Gallus gallus OX=90... [more]
sp|Q6P8J2|SAT2_MOUSE3.473e-1627.54Diamine acetyltransferase 2 OS=Mus musculus OX=100... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JGE71.109e-2134.62N-acetyltransferase domain-containing protein OS=B... [more]
C3Z8B67.333e-2135.29N-acetyltransferase domain-containing protein OS=B... [more]
A0A1L8H4E84.863e-1833.11N-acetyltransferase domain-containing protein OS=X... [more]
A0A3D9BCH75.071e-1837.31GNAT family N-acetyltransferase OS=Candidatus Chry... [more]
A0A340X8E03.177e-1729.34diamine acetyltransferase 2 OS=Lipotes vexillifer ... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sat2a8.830e-2030.86diamine acetyltransferase 2 [Source:NCBI gene;Acc:... [more]
sat1b3.240e-1830.63diamine acetyltransferase 1-like [Source:NCBI gene... [more]
sat2a2.080e-1632.17diamine acetyltransferase 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sat2a4.403e-928.07spermidine/spermine N1-acetyltransferase family me... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO381402.473e-730.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434758.850e-724.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sat2a2.127e-2032.10diamine acetyltransferase 2 [Source:NCBI gene;Acc:... [more]
sat2b1.251e-1730.23diamine acetyltransferase 2 [Source:NCBI gene;Acc:... [more]
sat1a.14.522e-1425.81spermidine/spermine N1-acetyltransferase 1 [Source... [more]
sat2a8.587e-1332.26diamine acetyltransferase 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of GNAT family N-acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036868.14.277e-5494.05SMESG000036868.1[more]
SMESG000037532.11.811e-1830.99SMESG000037532.1[more]
SMESG000026048.11.352e-933.57SMESG000026048.1[more]
SMESG000026047.11.406e-933.57SMESG000026047.1[more]
SMESG000028726.12.989e-831.91SMESG000028726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029942 ID=SMED30029942|Name=GNAT family N-acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=706bp
ACATTTCAAATAATATTATTCTGAATAAATACTTATAAAAACTTAAATAA
ATTTAATATTTTCTATAATAGCTGAGTTCATTTCGAAATGGAAAATATAA
AAATTAGATGGTTGAAGCCCGATGATTGCTTGTCTTTAAAAAATTTTATA
AATAAGCTTAACGATGCTGAAGGATTAGGATCACATACCAAATTAACTGC
AGATGATTTAAGACGAGATGCATTTTCTGATCATCCGTTATTTTACTGTT
TAATTGTTGAAGAAAACGATGAAATTAGAGGTTACTGCATGTTTTGTTCG
ATTTACGATTCAGATTATGGGAAAAAGATTTATATTGAAGATATTTATGT
TGAAAATAATTTGCGCAATAAAAAAATAGGATCGGCGCTTATGCAAGTTT
TAATTGAGTATGGTAAAAAGAATGGATATTCGAAAATGGCACTGATAAGT
TTGGGTTCAAACGAAAATTTCTACACGAAAATTGGTTTCACAAATGACAC
GAAACGTTTGGGATATGAATGGTATTGTATGGATATTTCTGGTGATAATC
AGAAATGTCAAAATTTAAGCAATAACATTAGATTTGATTTATAGTATTTT
TAGGCGTTTTAATTATCTTTGGAATTTATTGTGGACTGAACTTTCTACAA
TGTATTCATATCAATATGTTATTAAAAATTTTATGTTCATTTAATAAACA
TTTTAA
back to top

protein sequence of SMED30029942-orf-1

>SMED30029942-orf-1 ID=SMED30029942-orf-1|Name=SMED30029942-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
MENIKIRWLKPDDCLSLKNFINKLNDAEGLGSHTKLTADDLRRDAFSDHP
LFYCLIVEENDEIRGYCMFCSIYDSDYGKKIYIEDIYVENNLRNKKIGSA
LMQVLIEYGKKNGYSKMALISLGSNENFYTKIGFTNDTKRLGYEWYCMDI
SGDNQKCQNLSNNIRFDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016181Acyl_CoA_acyltransferase
IPR000182GNAT_dom
Vocabulary: molecular function
TermDefinition
GO:0008080N-acetyltransferase activity
GO:0016740transferase activity