DUF3715 domain-containing protein

Overview
NameDUF3715 domain-containing protein
Smed IDSMED30029932
Length (bp)2551
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3715 domain-containing protein (SMED30029932) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3715 domain-containing protein (SMED30029932) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3715 domain-containing protein (SMED30029932) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3715 domain-containing protein (SMED30029932) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029932

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029932h1SMcG0018275 SmedASXL_017071SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029932h1SMcG0018275 SmedASXL_017071SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30029932h1SMcG0018275 Contig55297uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029932h1SMcG0018275 Contig55297newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3715 domain-containing protein vs. Ensembl Human
Match: TASOR (transcription activation suppressor [Source:HGNC Symbol;Acc:HGNC:30314])

HSP 1 Score: 66.2402 bits (160), Expect = 2.383e-10
Identity = 56/218 (25.69%), Postives = 109/218 (50.00%), Query Frame = 3
Query:  129 PLDDPQRKF--LISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYV-----------LYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            PL    R+F  +++ +  SY  P  S  +  + +A  + N      +++KR ELK   +     +E Y F+ V   Y+++ I ++G + V    ++ LG   MGV LS++AD+  +NP +    G +++   M+G++  +           + + S +DP PK++CH+ + +  + +S   ++A+  TQ + YEY  D E+   P  +     V F++
Sbjct:  115 PLTPGSREFEDVVNILHSSYLEP-TSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMV-DRYQVQTICEKG-LHVGQSKITILGSPSMGVYLSRYADLLQANPLDTGAMGDVVIFKIMKGKIKSIYDPMGVKSLESMLNKSALDPTPKHECHVSKNANRI-TSLLAYRAYELTQYYFYEYGFD-ELRRRPRHVCPYAVVSFTY 327          
BLAST of DUF3715 domain-containing protein vs. Ensembl Human
Match: TASOR (transcription activation suppressor [Source:HGNC Symbol;Acc:HGNC:30314])

HSP 1 Score: 65.855 bits (159), Expect = 3.361e-10
Identity = 56/218 (25.69%), Postives = 109/218 (50.00%), Query Frame = 3
Query:  129 PLDDPQRKF--LISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYV-----------LYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            PL    R+F  +++ +  SY  P  S  +  + +A  + N      +++KR ELK   +     +E Y F+ V   Y+++ I ++G + V    ++ LG   MGV LS++AD+  +NP +    G +++   M+G++  +           + + S +DP PK++CH+ + +  + +S   ++A+  TQ + YEY  D E+   P  +     V F++
Sbjct:  115 PLTPGSREFEDVVNILHSSYLEP-TSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMV-DRYQVQTICEKG-LHVGQSKITILGSPSMGVYLSRYADLLQANPLDTGAMGDVVIFKIMKGKIKSIYDPMGVKSLESMLNKSALDPTPKHECHVSKNANRI-TSLLAYRAYELTQYYFYEYGFD-ELRRRPRHVCPYAVVSFTY 327          
BLAST of DUF3715 domain-containing protein vs. Ensembl Zebrafish
Match: tasora (transcription activation suppressor a [Source:ZFIN;Acc:ZDB-GENE-030131-6444])

HSP 1 Score: 52.373 bits (124), Expect = 2.747e-6
Identity = 49/154 (31.82%), Postives = 71/154 (46.10%), Query Frame = 3
Query:  354 IVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVLYD----------SSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKS 776
            +V E  + V +  +S LG    GV L Q +D+   NP E   +G I++   ++G+V  V +D          S  +DP PK+D H  + S  V SS + H AF  TQ + YEY  D EI   P  +     V + + G      I K   P +S
Sbjct:   11 VVCEKGLSVGSSWMSMLGNPSKGVYLCQFSDLLQINPFEPGAAGEIIIFKVIKGRVKSV-HDCISRYPDNRTSRGIDPTPKFDSHFSKSSTRVTSSQS-HMAFEYTQQYFYEYV-DFEISSRPRHVCPYAVVSYYFKGKEASTVIPKPLPPFRS 161          
BLAST of DUF3715 domain-containing protein vs. Ensembl Zebrafish
Match: tasor2 (transcription activation suppressor family member 2 [Source:ZFIN;Acc:ZDB-GENE-041111-225])

HSP 1 Score: 51.2174 bits (121), Expect = 7.109e-6
Identity = 45/160 (28.12%), Postives = 76/160 (47.50%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKST----EYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEF---HKSGIILVVNYMRGQVNYVL--YDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYE 650
            SK    ++ A  I N  S+  Y+  R+E +    S     E +GF+ +      +K+ + G + V     S LG    GV +S+++D  + +     K+G I+++   +G+V  V   Y  +   P P +DCH+  Q   V S+T+   AF  TQ + YE
Sbjct:   40 SKEFFTYNSAHLINNPASQQRYAAFRSEKREKGYSEQELEESFGFLLLDDINRARKVGETG-LLVGRAKCSTLGDSLKGVYISKYSDCLDLKRWYDGKTGYIVLLKLTKGKVKEVKDNYTQNFTPPTPGFDCHVSEQLGAVSSTTSSFLAFERTQYYFYE 198          
BLAST of DUF3715 domain-containing protein vs. Ensembl Zebrafish
Match: tasor2 (transcription activation suppressor family member 2 [Source:ZFIN;Acc:ZDB-GENE-041111-225])

HSP 1 Score: 51.2174 bits (121), Expect = 7.226e-6
Identity = 45/160 (28.12%), Postives = 76/160 (47.50%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKST----EYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEF---HKSGIILVVNYMRGQVNYVL--YDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYE 650
            SK    ++ A  I N  S+  Y+  R+E +    S     E +GF+ +      +K+ + G + V     S LG    GV +S+++D  + +     K+G I+++   +G+V  V   Y  +   P P +DCH+  Q   V S+T+   AF  TQ + YE
Sbjct:   40 SKEFFTYNSAHLINNPASQQRYAAFRSEKREKGYSEQELEESFGFLLLDDINRARKVGETG-LLVGRAKCSTLGDSLKGVYISKYSDCLDLKRWYDGKTGYIVLLKLTKGKVKEVKDNYTQNFTPPTPGFDCHVSEQLGAVSSTTSSFLAFERTQYYFYE 198          
BLAST of DUF3715 domain-containing protein vs. Ensembl Xenopus
Match: tasor (urotensin-2 receptor-like [Source:Xenbase;Acc:XB-GENE-5838973])

HSP 1 Score: 68.1662 bits (165), Expect = 4.844e-11
Identity = 54/193 (27.98%), Postives = 98/193 (50.78%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVL-------YDS----SPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            SK S  +  A  + N      +++KR +LK   +      E Y F+ V  + ++  I ++G + V +  ++ LGK  MGV L+++AD+  +NP E   +G I +   ++G++ YV         DS      +DP PK++CH+L+ ++   ++   ++AF  TQ + YEY  D E++  P  +     V F +
Sbjct:   63 SKASFSYKYARLVHNEFLEKEFTEKRRQLKFDGRLDKELAESYAFLLVDQD-QMNSISEKG-LHVGHSRMTTLGKPSMGVYLARYADLLQANPLETGATGDIFIFKVIKGKMKYVFDHIRSNQMDSFSGNGGLDPVPKHECHVLK-NMNAVTALLGYRAFERTQYYFYEYGFD-EVLKRPRHVCPYAIVSFGY 251          
BLAST of DUF3715 domain-containing protein vs. Ensembl Xenopus
Match: tasor (urotensin-2 receptor-like [Source:Xenbase;Acc:XB-GENE-5838973])

HSP 1 Score: 68.1662 bits (165), Expect = 5.206e-11
Identity = 54/193 (27.98%), Postives = 98/193 (50.78%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVL-------YDS----SPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            SK S  +  A  + N      +++KR +LK   +      E Y F+ V  + ++  I ++G + V +  ++ LGK  MGV L+++AD+  +NP E   +G I +   ++G++ YV         DS      +DP PK++CH+L+ ++   ++   ++AF  TQ + YEY  D E++  P  +     V F +
Sbjct:   63 SKASFSYKYARLVHNEFLEKEFTEKRRQLKFDGRLDKELAESYAFLLVDQD-QMNSISEKG-LHVGHSRMTTLGKPSMGVYLARYADLLQANPLETGATGDIFIFKVIKGKMKYVFDHIRSNQMDSFSGNGGLDPVPKHECHVLK-NMNAVTALLGYRAFERTQYYFYEYGFD-EVLKRPRHVCPYAIVSFGY 251          
BLAST of DUF3715 domain-containing protein vs. Ensembl Xenopus
Match: tasor (urotensin-2 receptor-like [Source:Xenbase;Acc:XB-GENE-5838973])

HSP 1 Score: 68.1662 bits (165), Expect = 5.927e-11
Identity = 74/257 (28.79%), Postives = 125/257 (48.64%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVL-------YDS----SPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPV----KRIFEASSKSPPAKRPLINPSKSL----LKSNSFP 890
            SK S  +  A  + N      +++KR +LK   +      E Y F+ V  + ++  I ++G + V +  ++ LGK  MGV L+++AD+  +NP E   +G I +   ++G++ YV         DS      +DP PK++CH+L+ ++   ++   ++AF  TQ + YEY  D E++  P  +     V F +      K+    R P  S+    PV    +R F+ SS +   + PL+N  K L    LKS S P
Sbjct:   99 SKASFSYKYARLVHNEFLEKEFTEKRRQLKFDGRLDKELAESYAFLLVDQD-QMNSISEKG-LHVGHSRMTTLGKPSMGVYLARYADLLQANPLETGATGDIFIFKVIKGKMKYVFDHIRSNQMDSFSGNGGLDPVPKHECHVLK-NMNAVTALLGYRAFERTQYYFYEYGFD-EVLKRPRHVCPYAIVSFGY------KDELATRQP--SLPSSGPVSFTSERSFDRSSFT-LWRGPLLNKGKLLCYASLKSTSGP 342          
BLAST of DUF3715 domain-containing protein vs. Ensembl Xenopus
Match: tasor (urotensin-2 receptor-like [Source:Xenbase;Acc:XB-GENE-5838973])

HSP 1 Score: 66.6254 bits (161), Expect = 1.490e-10
Identity = 54/193 (27.98%), Postives = 98/193 (50.78%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVL-------YDS----SPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            SK S  +  A  + N      +++KR +LK   +      E Y F+ V  + ++  I ++G + V +  ++ LGK  MGV L+++AD+  +NP E   +G I +   ++G++ YV         DS      +DP PK++CH+L+ ++   ++   ++AF  TQ + YEY  D E++  P  +     V F +
Sbjct:   68 SKASFSYKYARLVHNEFLEKEFTEKRRQLKFDGRLDKELAESYAFLLVDQD-QMNSISEKG-LHVGHSRMTTLGKPSMGVYLARYADLLQANPLETGATGDIFIFKVIKGKMKYVFDHIRSNQMDSFSGNGGLDPVPKHECHVLK-NMNAVTALLGYRAFERTQYYFYEYGFD-EVLKRPRHVCPYAIVSFGY 256          
BLAST of DUF3715 domain-containing protein vs. Ensembl Xenopus
Match: tasor (urotensin-2 receptor-like [Source:Xenbase;Acc:XB-GENE-5838973])

HSP 1 Score: 66.6254 bits (161), Expect = 2.016e-10
Identity = 54/193 (27.98%), Postives = 98/193 (50.78%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVL-------YDS----SPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            SK S  +  A  + N      +++KR +LK   +      E Y F+ V  + ++  I ++G + V +  ++ LGK  MGV L+++AD+  +NP E   +G I +   ++G++ YV         DS      +DP PK++CH+L+ ++   ++   ++AF  TQ + YEY  D E++  P  +     V F +
Sbjct:   99 SKASFSYKYARLVHNEFLEKEFTEKRRQLKFDGRLDKELAESYAFLLVDQD-QMNSISEKG-LHVGHSRMTTLGKPSMGVYLARYADLLQANPLETGATGDIFIFKVIKGKMKYVFDHIRSNQMDSFSGNGGLDPVPKHECHVLK-NMNAVTALLGYRAFERTQYYFYEYGFD-EVLKRPRHVCPYAIVSFGY 287          
BLAST of DUF3715 domain-containing protein vs. Ensembl Mouse
Match: Tasor (transcription activation suppressor [Source:MGI Symbol;Acc:MGI:1921694])

HSP 1 Score: 64.6994 bits (156), Expect = 5.094e-10
Identity = 57/219 (26.03%), Postives = 108/219 (49.32%), Query Frame = 3
Query:  129 PLDDPQRKF--LISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVLYD------------SSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            PL    R+F  +++ +  SY  P  S     + +A  I N      +++KR ELK   +     +E Y F+ V   Y+++ I ++G ++V    ++ LG   MG+ L ++AD+  +NP E    G +++   M+G++  + YD             + +DP PK++CH+ + +  + +S   ++A+  TQ + YEY  D E+   P  +     V F++
Sbjct:  110 PLTPGSREFEDVLNILHSSYLEPS-SVTYFNYRRACLIHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMV-DRYQVQSICEKG-LQVGQSKITVLGSPSMGIYLCRYADLLQANPLEAGAVGDVVIFKIMKGKIKSI-YDPLSVKSLESMLSKNALDPTPKHECHVSKNASRI-TSLLAYRAYELTQYYFYEYGFD-EVRRRPRHVCPYAVVSFTY 322          
BLAST of DUF3715 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UK61|TASOR_HUMAN (Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 1.862e-9
Identity = 56/218 (25.69%), Postives = 109/218 (50.00%), Query Frame = 3
Query:  129 PLDDPQRKF--LISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYV-----------LYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            PL    R+F  +++ +  SY  P  S  +  + +A  + N      +++KR ELK   +     +E Y F+ V   Y+++ I ++G + V    ++ LG   MGV LS++AD+  +NP +    G +++   M+G++  +           + + S +DP PK++CH+ + +  + +S   ++A+  TQ + YEY  D E+   P  +     V F++
Sbjct:  115 PLTPGSREFEDVVNILHSSYLEP-TSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMV-DRYQVQTICEKG-LHVGQSKITILGSPSMGVYLSRYADLLQANPLDTGAMGDVVIFKIMKGKIKSIYDPMGVKSLESMLNKSALDPTPKHECHVSKNANRI-TSLLAYRAYELTQYYFYEYGFD-ELRRRPRHVCPYAVVSFTY 327          
BLAST of DUF3715 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2T9I9|TASOR_XENLA (Protein TASOR OS=Xenopus laevis OX=8355 GN=tasor PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.299e-9
Identity = 54/193 (27.98%), Postives = 98/193 (50.78%), Query Frame = 3
Query:  198 SKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVL-------YDS----SPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            SK S  +  A  + N      +++KR +LK   +      E Y F+ V  E ++  I ++G + V +  ++ LGK  MGV LS++AD+  +NP E   +G I +   ++G++ +V         DS      +DP PK++CH+L+ ++   ++   ++AF  TQ + YEY  D E++  P  +     + F +
Sbjct:  101 SKASFSYKCARLVHNEFLEKEFTEKRRQLKFDGRLDKELVESYVFLLVDQE-QMHSITEKG-LHVGHSRMTTLGKPSMGVYLSRYADLLQANPLETGTTGDIFIFKVIKGKMKFVFDHIRNNQMDSFSGNGGLDPVPKHECHVLK-NMNAVTALLGYRAFERTQYYFYEYGFD-EVLKRPRHVCPYAVMSFGY 289          
BLAST of DUF3715 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q69ZR9|TASOR_MOUSE (Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE=1 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 4.508e-9
Identity = 57/219 (26.03%), Postives = 108/219 (49.32%), Query Frame = 3
Query:  129 PLDDPQRKF--LISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVLYD------------SSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSW 722
            PL    R+F  +++ +  SY  P  S     + +A  I N      +++KR ELK   +     +E Y F+ V   Y+++ I ++G ++V    ++ LG   MG+ L ++AD+  +NP E    G +++   M+G++  + YD             + +DP PK++CH+ + +  + +S   ++A+  TQ + YEY  D E+   P  +     V F++
Sbjct:  110 PLTPGSREFEDVLNILHSSYLEPS-SVTYFNYRRACLIHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMV-DRYQVQSICEKG-LQVGQSKITVLGSPSMGIYLCRYADLLQANPLEAGAVGDVVIFKIMKGKIKSI-YDPLSVKSLESMLSKNALDPTPKHECHVSKNASRI-TSLLAYRAYELTQYYFYEYGFD-EVRRRPRHVCPYAVVSFTY 322          
BLAST of DUF3715 domain-containing protein vs. TrEMBL
Match: A0A1I8H9D3 (DUF3715 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.322e-18
Identity = 59/163 (36.20%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  276 AELKTIFKSTEYYGFVY---VKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFH--KSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCH-MLRQSLTVD------SSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHG 728
            A L    K  E YGFVY   V    +  + + E  I+  N+P S L     GVSL ++ D  +P+F   K+G +++  Y+RG+V Y     S ++PQP YDCH  +RQ+LT D      +++     FHS+QVFL+EY  D E++  P  +  + AV+F + G
Sbjct:  189 AALAGSVKLDERYGFVYLAPVPDVMDRLRGIAENGIRRGNLPDSTLAIGSTGVSLGRYVDRISPKFGLPKTGWLVICRYVRGRVCYWTEGDSVVEPQPMYDCHESVRQTLTDDELINRKAASIIEAGFHSSQVFLFEYGPDLELMDHPRHVLPVAAVQFKFDG 351          
BLAST of DUF3715 domain-containing protein vs. TrEMBL
Match: A0A267DHH8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000723g9 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.403e-18
Identity = 59/163 (36.20%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  276 AELKTIFKSTEYYGFVY---VKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFH--KSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCH-MLRQSLTVD------SSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHG 728
            A L    K  E YGFVY   V    +  + + E  I+  N+P S L     GVSL ++ D  +P+F   K+G +++  Y+RG+V Y     S ++PQP YDCH  +RQ+LT D      +++     FHS+QVFL+EY  D E++  P  +  + AV+F + G
Sbjct:  170 AALAGSVKLDERYGFVYLAPVPDVMDRLRGIAENGIRRGNLPDSTLAIGSTGVSLGRYVDRISPKFGLPKTGWLVICRYVRGRVCYWTEGDSVVEPQPMYDCHESVRQTLTDDELINRKAASIIEAGFHSSQVFLFEYGPDLELMDHPRHVLPVAAVQFKFDG 332          
BLAST of DUF3715 domain-containing protein vs. TrEMBL
Match: A0A267GWU4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007037g3 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.737e-18
Identity = 59/163 (36.20%), Postives = 88/163 (53.99%), Query Frame = 3
Query:  276 AELKTIFKSTEYYGFVY---VKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFH--KSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCH-MLRQSLTVD------SSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHG 728
            A L    K  E YGFVY   V    +  + + E  I+  N+P S L     GVSL ++ D  +P+F   K+G +++  Y+RG+V Y     S ++PQP YDCH  +RQ+LT D      + +     FHS+QVFL+EY  D E++  P  +  + AV+F + G
Sbjct:  167 AALAGSVKLDERYGFVYLAPVPDVMDRLRGIAENGIRRGNLPDSTLAIGSTGVSLGRYVDRISPKFGLPKTGWLVICRYVRGRVCYWTEGDSVVEPQPMYDCHESVRQTLTDDELINSKAESIIEAGFHSSQVFLFEYGPDLELMDHPRHVLPVAAVQFKFDG 329          
BLAST of DUF3715 domain-containing protein vs. TrEMBL
Match: A0A1I8H023 (DUF3715 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.182e-18
Identity = 58/159 (36.48%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  276 AELKTIFKSTEYYGFVY---VKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFH--KSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCH-MLRQSLTVD------SSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKF 716
            A L    K  E YGFVY   V    +  + + E  I+  N+P S L     GVSL ++ D  +P+F   K+G +++  Y+RG+V Y     S ++PQP YDCH  +RQ+LT D      +++     FHS+QVFL+EY  D E++  P  +  + AV+F
Sbjct:  189 AALAGSVKLDERYGFVYLAPVPDVMDRLRGIAENGIRRGNLPDSTLAIGSTGVSLGRYVDRISPKFGLPKTGWLVICRYVRGRVCYWTEGDSVVEPQPMYDCHESVRQTLTDDELINRKAASIIEAGFHSSQVFLFEYGPDLELMDHPRHVLPVAAVQF 347          
BLAST of DUF3715 domain-containing protein vs. TrEMBL
Match: A0A267EDJ0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000723g2 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.200e-17
Identity = 58/163 (35.58%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  276 AELKTIFKSTEYYGFVY---VKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFH--KSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCH-MLRQSLTVD------SSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHG 728
            A L    K  E YGFVY   V    +  + + E  I+  N+P S L     GVSL ++ D  +P+F   K+G +++  Y+RG+V Y     S ++PQP Y+CH  +RQ+LT D      +++     FHS+QVFL+EY  D E++  P  +  + AV+F + G
Sbjct:  155 AALAGSVKLDERYGFVYLAPVPDVMDRLRGIAENGIRRGNLPDSTLAIGSTGVSLGRYVDRISPKFGLPKTGWLVICRYVRGRVCYWTEGDSVVEPQPMYNCHESVRQTLTDDELINRKAASIIEAGFHSSQVFLFEYGPDLELMDHPRHVLPVAAVQFKFDG 317          
BLAST of DUF3715 domain-containing protein vs. Ensembl Cavefish
Match: tasorb (protein TASOR-like [Source:NCBI gene;Acc:103032451])

HSP 1 Score: 63.929 bits (154), Expect = 7.256e-10
Identity = 73/286 (25.52%), Postives = 135/286 (47.20%), Query Frame = 3
Query:   72 NFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADIS--NP-EFHKSGIILVVNYMRGQVNYVLYD--SSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRIFEASSKSPPAKRPLINPSKSL----LKSNSFP 890
            NF +  ++ K +   +Q LP D  + + L+ K+  S+     S+ +  + +A  I N      + +K+ ELK   ++    TE Y F+   +       + E  + V +  +S LG    GV LS+++D+   NP +   SG I++   M+G++  +  +   S ++P PK+DCH+ + +  V +S   ++AF  TQ + YE++ D E+   P  +     V F + G        ++   + S+ E N V+R +   S       PL+N  + L    ++S S P
Sbjct:   96 NFQIPRKI-KERKGLLQMLPPDSREFEELV-KVLSSFYLDAPSRGAFTYTKACLIHNELLEKEFVEKKRELKQAGRTEAELTESYAFLLPDTNK--THWICEKGLSVGHARLSNLGNPAKGVYLSKYSDLLQINPFDAGASGDIIIFKVMKGRLKSIFENMPKSNLEPAPKFDCHVHKNASKV-TSLLSYRAFELTQQYFYEFAFD-ELKSRPRHVCPYAVVSFQYKGKESATAAHRL---SSSMYEGNRVRRRYTVWSG------PLVNKGEELYQVCIRSPSLP 366          
BLAST of DUF3715 domain-containing protein vs. Ensembl Medaka
Match: tasorb (protein TASOR [Source:NCBI gene;Acc:101164979])

HSP 1 Score: 63.5438 bits (153), Expect = 8.623e-10
Identity = 59/213 (27.70%), Postives = 112/213 (52.58%), Query Frame = 3
Query:  120 QNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKS----TEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNP-EFHKSGIILVVNYMRGQVNYVLYDSSP---MDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHG 728
            Q LP D  + + LI K+  S+     S+ +  + +A  I N      + +KR E+K   ++     E Y F++   + +L+ + ++G + V +  ++ LG   MGV LS+++D+   NP E    G +++   MRG++ ++ +++ P   ++P PK+DCH+ + +  V S  + ++AF  TQ F +E++ D EI   P  +     V F + G
Sbjct:  105 QFLPPDSREFEDLI-KLISSFNLDPSSRTAFSYSKARLIHNELLEKEFIEKRREMKQEGRTEQDLAESYCFLF-PDKSKLQWVCEKG-LSVGHCRITTLGNPSMGVYLSKYSDLLQINPFEVGSFGDMIIFKIMRGRIKHI-HENMPKNAIEPSPKFDCHLSKIANRVTSLLS-YRAFELTQQFFFEFAFD-EIKARPRHVCPYAVVSFQYKG 311          
BLAST of DUF3715 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035887.1 (protein TASOR [Source:NCBI gene;Acc:101174829])

HSP 1 Score: 51.9878 bits (123), Expect = 3.178e-6
Identity = 36/124 (29.03%), Postives = 59/124 (47.58%), Query Frame = 3
Query:  306 EYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNPEFH-KSGIILVVNYMRGQVNYVL--YDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSED 662
            E YGF+      +   + + G +   N   S LG    G+ +S ++D    N  +H KSG I ++   +G+   VL  Y     +P   +DCH+  Q  +V + T+   AF  TQ ++YE  +D
Sbjct:   81 ESYGFLLFDDASKANALGETG-VLTGNSSCSILGDPSKGIYISMYSDCLDQNRWYHGKSGYIAIIRLTKGKQKKVLENYTERFTEPTVGFDCHVSDQLASVSAKTSSFLAFERTQYYMYELLDD 203          
BLAST of DUF3715 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000032425.1 (protein TASOR [Source:NCBI gene;Acc:101174829])

HSP 1 Score: 51.9878 bits (123), Expect = 3.369e-6
Identity = 36/124 (29.03%), Postives = 59/124 (47.58%), Query Frame = 3
Query:  306 EYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI--SNPEFH-KSGIILVVNYMRGQVNYVL--YDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSED 662
            E YGF+      +   + + G +   N   S LG    G+ +S ++D    N  +H KSG I ++   +G+   VL  Y     +P   +DCH+  Q  +V + T+   AF  TQ ++YE  +D
Sbjct:   81 ESYGFLLFDDASKANALGETG-VLTGNSSCSILGDPSKGIYISMYSDCLDQNRWYHGKSGYIAIIRLTKGKQKKVLENYTERFTEPTVGFDCHVSDQLASVSAKTSSFLAFERTQYYMYELLDD 203          
BLAST of DUF3715 domain-containing protein vs. Planmine SMEST
Match: SMESG000028557.1 (SMESG000028557.1)

HSP 1 Score: 1397.1 bits (3615), Expect = 0.000e+0
Identity = 703/703 (100.00%), Postives = 703/703 (100.00%), Query Frame = 3
Query:   57 MSSDHNFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFHKSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRIFEASSKSPPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLENRILHEYLYYTENSVRRTLSFNPKIINKLPHTINDRKKLGATFRPKYALYFKMIPSSSKEKKMQRIMENLALKNMVGVVRCNSLNNMLFYIIPNGSFSMSIGLPSIDAENSHVIIFTEQHPQFLPCNYSSYXXXXXXXXXXXXXXXSDYESKIIKPKQILLLDLLINVKKPIASSSHNKHDSDMDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS 2165
            MSSDHNFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFHKSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRIFEASSKSPPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLENRILHEYLYYTENSVRRTLSFNPKIINKLPHTINDRKKLGATFRPKYALYFKMIPSSSKEKKMQRIMENLALKNMVGVVRCNSLNNMLFYIIPNGSFSMSIGLPSIDAENSHVIIFTEQHPQFLPCNYSSYDKDIKKEQKIFQEIISDYESKIIKPKQILLLDLLINVKKPIASSSHNKHDSDMDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS
Sbjct:    1 MSSDHNFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFHKSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRIFEASSKSPPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLENRILHEYLYYTENSVRRTLSFNPKIINKLPHTINDRKKLGATFRPKYALYFKMIPSSSKEKKMQRIMENLALKNMVGVVRCNSLNNMLFYIIPNGSFSMSIGLPSIDAENSHVIIFTEQHPQFLPCNYSSYDKDIKKEQKIFQEIISDYESKIIKPKQILLLDLLINVKKPIASSSHNKHDSDMDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS 703          
BLAST of DUF3715 domain-containing protein vs. Planmine SMEST
Match: SMESG000028557.1 (SMESG000028557.1)

HSP 1 Score: 1377.84 bits (3565), Expect = 0.000e+0
Identity = 696/703 (99.00%), Postives = 696/703 (99.00%), Query Frame = 3
Query:   57 MSSDHNFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFHKSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRIFEASSKSPPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLENRILHEYLYYTENSVRRTLSFNPKIINKLPHTINDRKKLGATFRPKYALYFKMIPSSSKEKKMQRIMENLALKNMVGVVRCNSLNNMLFYIIPNGSFSMSIGLPSIDAENSHVIIFTEQHPQFLPCNYSSYXXXXXXXXXXXXXXXSDYESKIIKPKQILLLDLLINVKKPIASSSHNKHDSDMDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS 2165
            MSSDHNFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFHKSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRIFEASSKSPPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLENRILHEYLYYTENSVRRTLSFNPKIINKLPHTINDRKKLGATFRPKYALYFKMIPSSSKEKKMQRIMENLALKNMVGVVRCNSLNNMLFYIIPNGSFSMSIGLPSIDAENSHVIIFTEQHPQFLP       KDIKKEQKIFQEIISDYESKIIKPKQILLLDLLINVKKPIASSSHNKHDSDMDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS
Sbjct:    1 MSSDHNFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAELKTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFHKSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRIFEASSKSPPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLENRILHEYLYYTENSVRRTLSFNPKIINKLPHTINDRKKLGATFRPKYALYFKMIPSSSKEKKMQRIMENLALKNMVGVVRCNSLNNMLFYIIPNGSFSMSIGLPSIDAENSHVIIFTEQHPQFLP------YKDIKKEQKIFQEIISDYESKIIKPKQILLLDLLINVKKPIASSSHNKHDSDMDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS 697          
BLAST of DUF3715 domain-containing protein vs. Planmine SMEST
Match: SMESG000028560.1 (SMESG000028560.1)

HSP 1 Score: 384.415 bits (986), Expect = 5.068e-129
Identity = 189/189 (100.00%), Postives = 189/189 (100.00%), Query Frame = 3
Query: 1599 MDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS 2165
            MDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS
Sbjct:    1 MDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPKSKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPHITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYKPKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYNGQS 189          
BLAST of DUF3715 domain-containing protein vs. Planmine SMEST
Match: SMESG000026149.1 (SMESG000026149.1)

HSP 1 Score: 192.586 bits (488), Expect = 6.914e-51
Identity = 139/510 (27.25%), Postives = 250/510 (49.02%), Query Frame = 3
Query:   81 VGYRVPKIKTETIQNLPLDDPQRKF---LISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAEL-KTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFH-----KSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICK--EI-------SKIRTPTKSVTEKNP-VKRIFEASSKS--------------PPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLE----NRILHEYLYYTENSVRRT-------LSFNPKIINKLPHTIN-DRKKLGATFR-------PKYALYFKMIPSSSKEKKMQ--RIMENLALKNMVGVVRCNSLNN----MLFYIIPNGSFSMSIGLPSIDAENS--HVIIFTEQHPQFLPCN 1430
              ++VPK+K +   + P+     +F   +  KI +S+ +P  S+   KF   W I N  S + Y  +R  + K I  + E  GF+++KS+  L  + ++G  ++ N+  SYL    +GVS+ QHAD+ +P        K+G +++  Y++G++N+V +D SPM+PQP++DCHML+ +  +D+      AFH TQVF+YEYSED EIV +PSQI    AV+F+W+G  + +  EI       S+ R   KS+   N  +++   A +KS              P      ++   S+ + NS  +   L   + L  +      ++ +   +   +  PI    L   +W++ ++LE     + L  + ++ ++ + ++       LS +  I N  P  +     ++  +F        PKYA Y +++P S K  +    +++E+      VG +      +    +L +  P+G FS  +G+ S+  ++   H +I   QHP+F  CN
Sbjct:   38 ANFKVPKLKIKKCLD-PIKLTSNQFTSEIYPKIVQSFIKPKQSESCFKFTNGWLIRNAQSENPYITRRHLIRKEIPNAIETIGFIFLKSKDNLVDLARKGVFRIGNLSESYLSIASLGVSVCQHADVYHPGGKSHGVPKTGYLVLCKYLKGRINFVQFDQSPMEPQPQFDCHMLKTNTIIDNHVNVFTAFHKTQVFIYEYSEDGEIVRYPSQILPFAAVEFNWYGDYVYRISEISLSKSKSSRTRVKNKSLISVNSNIEKTDSAKTKSNRRIIKDVQTQSVQPKCLSRFLSIDNSIHRLNSTFQ---LPCQICLINNKIEKPVEVKITCTVYMYMTNPIVFPQLYNSRWHVTDILEITEFEKELKLFQFHLQDKLTKSSTDLLDPLSHDIIISNSSPTLLTISENQINESFLYSNDTTIPKYATYLRLVPDSCKLSRFNTLKLIEHFRNTKTVGRISFGGFADVSYKILIFFFPDGKFSQKLGITSVKTDDCYFHGLILHFQHPEFTICN 543          
BLAST of DUF3715 domain-containing protein vs. Planmine SMEST
Match: SMESG000026149.1 (SMESG000026149.1)

HSP 1 Score: 192.2 bits (487), Expect = 7.058e-51
Identity = 139/510 (27.25%), Postives = 250/510 (49.02%), Query Frame = 3
Query:   81 VGYRVPKIKTETIQNLPLDDPQRKF---LISKIEESYKRPDLSKVSMKFHQAWSITNIDSRSSYSKKRAEL-KTIFKSTEYYGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFH-----KSGIILVVNYMRGQVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYSEDCEIVPFPSQITIIGAVKFSWHGPSICK--EI-------SKIRTPTKSVTEKNP-VKRIFEASSKS--------------PPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDLNLNVKLISRLEQPINLSNLMFKKWNLLELLE----NRILHEYLYYTENSVRRT-------LSFNPKIINKLPHTIN-DRKKLGATFR-------PKYALYFKMIPSSSKEKKMQ--RIMENLALKNMVGVVRCNSLNN----MLFYIIPNGSFSMSIGLPSIDAENS--HVIIFTEQHPQFLPCN 1430
              ++VPK+K +   + P+     +F   +  KI +S+ +P  S+   KF   W I N  S + Y  +R  + K I  + E  GF+++KS+  L  + ++G  ++ N+  SYL    +GVS+ QHAD+ +P        K+G +++  Y++G++N+V +D SPM+PQP++DCHML+ +  +D+      AFH TQVF+YEYSED EIV +PSQI    AV+F+W+G  + +  EI       S+ R   KS+   N  +++   A +KS              P      ++   S+ + NS  +   L   + L  +      ++ +   +   +  PI    L   +W++ ++LE     + L  + ++ ++ + ++       LS +  I N  P  +     ++  +F        PKYA Y +++P S K  +    +++E+      VG +      +    +L +  P+G FS  +G+ S+  ++   H +I   QHP+F  CN
Sbjct:    8 ANFKVPKLKIKKCLD-PIKLTSNQFTSEIYPKIVQSFIKPKQSESCFKFTNGWLIRNAQSENPYITRRHLIRKEIPNAIETIGFIFLKSKDNLVDLARKGVFRIGNLSESYLSIASLGVSVCQHADVYHPGGKSHGVPKTGYLVLCKYLKGRINFVQFDQSPMEPQPQFDCHMLKTNTIIDNHVNVFTAFHKTQVFIYEYSEDGEIVRYPSQILPFAAVEFNWYGDYVYRISEISLSKSKSSRTRVKNKSLISVNSNIEKTDSAKTKSNRRIIKDVQTQSVQPKCLSRFLSIDNSIHRLNSTFQ---LPCQICLINNKIEKPVEVKITCTVYMYMTNPIVFPQLYNSRWHVTDILEITEFEKELKLFQFHLQDKLTKSSTDLLDPLSHDIIISNSSPTLLTISENQINESFLYSNDTTIPKYATYLRLVPDSCKLSRFNTLKLIEHFRNTKTVGRISFGGFADVSYKILIFFFPDGKFSQKLGITSVKTDDCYFHGLILHFQHPEFTICN 513          
The following BLAST results are available for this feature:
BLAST of DUF3715 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TASOR2.383e-1025.69transcription activation suppressor [Source:HGNC S... [more]
TASOR3.361e-1025.69transcription activation suppressor [Source:HGNC S... [more]
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tasora2.747e-631.82transcription activation suppressor a [Source:ZFIN... [more]
tasor27.109e-628.13transcription activation suppressor family member ... [more]
tasor27.226e-628.13transcription activation suppressor family member ... [more]
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tasor4.844e-1127.98urotensin-2 receptor-like [Source:Xenbase;Acc:XB-G... [more]
tasor5.206e-1127.98urotensin-2 receptor-like [Source:Xenbase;Acc:XB-G... [more]
tasor5.927e-1128.79urotensin-2 receptor-like [Source:Xenbase;Acc:XB-G... [more]
tasor1.490e-1027.98urotensin-2 receptor-like [Source:Xenbase;Acc:XB-G... [more]
tasor2.016e-1027.98urotensin-2 receptor-like [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tasor5.094e-1026.03transcription activation suppressor [Source:MGI Sy... [more]
back to top
BLAST of DUF3715 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9UK61|TASOR_HUMAN1.862e-925.69Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=... [more]
sp|Q2T9I9|TASOR_XENLA3.299e-927.98Protein TASOR OS=Xenopus laevis OX=8355 GN=tasor P... [more]
sp|Q69ZR9|TASOR_MOUSE4.508e-926.03Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE... [more]
back to top
BLAST of DUF3715 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H9D31.322e-1836.20DUF3715 domain-containing protein OS=Macrostomum l... [more]
A0A267DHH82.403e-1836.20Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GWU43.737e-1836.20Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8H0239.182e-1836.48DUF3715 domain-containing protein OS=Macrostomum l... [more]
A0A267EDJ01.200e-1735.58Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tasorb7.256e-1025.52protein TASOR-like [Source:NCBI gene;Acc:103032451... [more]
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3715 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tasorb8.623e-1027.70protein TASOR [Source:NCBI gene;Acc:101164979][more]
ENSORLT00000035887.13.178e-629.03protein TASOR [Source:NCBI gene;Acc:101174829][more]
ENSORLT00000032425.13.369e-629.03protein TASOR [Source:NCBI gene;Acc:101174829][more]
back to top
BLAST of DUF3715 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028557.10.000e+0100.00SMESG000028557.1[more]
SMESG000028557.10.000e+099.00SMESG000028557.1[more]
SMESG000028560.15.068e-129100.00SMESG000028560.1[more]
SMESG000026149.16.914e-5127.25SMESG000026149.1[more]
SMESG000026149.17.058e-5127.25SMESG000026149.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029932 ID=SMED30029932|Name=DUF3715 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2551bp
TACCAAATATTTAATTTATTTAAAAATCAGCTTCCATCTATTAATCTCTT
ACATAAATGAGCTCTGATCACAATTTTTTAGTAGGATATAGAGTACCAAA
AATTAAAACAGAAACAATTCAAAATTTACCTCTCGATGATCCTCAAAGAA
AATTTTTAATTAGCAAAATAGAAGAATCATATAAAAGACCAGATTTATCA
AAGGTTTCCATGAAATTTCACCAGGCATGGTCTATTACTAATATAGATTC
TCGATCATCTTATTCTAAAAAGCGTGCTGAATTAAAAACTATCTTTAAAT
CAACGGAATATTATGGATTTGTTTATGTGAAAAGCGAATATGAATTAAAA
AAAATAGTTAAAGAAGGAAACATAAAGGTTCATAATGTTCCAGTATCTTA
TTTGGGGAAATGTGAAATGGGTGTTAGTTTATCGCAGCATGCAGATATTT
CTAATCCAGAATTTCATAAATCTGGAATAATTCTCGTTGTAAATTACATG
AGGGGCCAGGTTAATTATGTTCTTTATGATTCATCGCCGATGGATCCACA
ACCGAAATATGATTGTCATATGCTAAGGCAATCTTTAACAGTCGATTCTT
CAACTACTCCACATAAAGCCTTTCACTCCACTCAGGTGTTTCTCTATGAA
TATTCGGAAGATTGTGAAATAGTTCCATTTCCATCACAAATCACAATTAT
CGGAGCCGTGAAATTTAGCTGGCACGGCCCATCTATTTGCAAGGAAATAT
CGAAAATAAGAACTCCTACGAAATCTGTCACGGAAAAAAATCCTGTCAAA
CGAATATTTGAGGCTTCATCAAAATCACCGCCAGCAAAACGGCCGCTAAT
AAATCCATCGAAAAGTTTACTGAAGTCGAACTCTTTCCCTGAATCAGAGT
TACTGTCAGCAACACTGATTCTAGGCAAGTCGTCCAGTTATTCCCATCCC
GATTTGAATCTCAATGTCAAGCTGATTTCTCGTCTCGAACAGCCAATCAA
TCTTTCGAATTTAATGTTCAAAAAATGGAATTTACTCGAGTTGCTGGAAA
ACAGAATACTTCATGAATACCTCTATTATACAGAAAATAGTGTCCGTCGA
ACTTTATCGTTTAATCCAAAAATAATCAATAAACTTCCGCACACAATAAA
TGATCGGAAAAAACTCGGAGCAACATTTCGTCCAAAATATGCGCTTTATT
TTAAAATGATTCCCAGTAGTTCGAAAGAGAAAAAAATGCAAAGAATTATG
GAAAATTTAGCATTAAAAAATATGGTAGGAGTCGTTCGCTGCAATTCTCT
CAACAATATGTTGTTTTATATCATTCCTAATGGATCATTCTCCATGTCAA
TCGGTTTGCCTTCTATAGATGCAGAAAATAGTCATGTAATTATTTTTACG
GAACAACATCCACAATTTCTTCCCTGTAATTATTCCTCTTACGACAAAGA
CATTAAAAAGGAACAAAAAATATTTCAAGAAATTATATCAGATTATGAAT
CTAAAATTATCAAACCAAAGCAAATACTCTTACTTGATTTATTGATTAAC
GTGAAAAAACCGATAGCCTCATCCTCTCATAATAAGCATGATAGTGATAT
GGATATCGATAGTGATGGAGAACCAAACCTAGAATCCTCTAAACAAATAA
ATTTTATGAATTTCAATCACAAAAAAAATCCTATCCAAATCAATCTTGGT
CCGAAATCAAAAACTTTAGCACTAGTTAAGAGTCACACTTTGACAAGTTC
TATCGTAAATCGTTCTCCTGTTGAAATGTCACTTGTAAATCAACCACACC
TCACTAAACCTCTTCATACTGTTACTCCCTCCAATCAGATTTCTCCTCGT
CCACACATAACTAAGTCACCTCAGATAGTGGACACTCAAGCATTGCATAC
TGTTTCTAAGCCGCCAGTTCAAACGATAAATACTCCATTGCCCAATGGAA
TATCCGCATCAAATACAACCGATTTTGTGTCTGAAACTCCTGTTGTAAAT
TATAAACCCAAATCGTTCGGCCGATTTAAACTGATGGAGAAACAGGCATC
GGGAATGTGCAAGCCAGACAATAAGCGTACATCGAGACGGCAAGTCCATC
TCGATTCAGTGATATTTTCAAAAATATCTGGATATTCGCATATTTCTTTG
TATAATGGACAATCATAATTTGTTTTTCCTTGATGTTTTAATGATAATAT
TTTTGAGTTTTTCTCTTATTAATATTTAACAAAATATTCCCTAATTTTGT
ATTGTTAATGCGATTTCATGTACAGAAATTCTTAAAACGAAAAAGAAAAT
GGATTTATTTTTAATTGAAAAGTTGTAACTATGATATTTTGATAGAAATT
ATCATGTGGAATTGTTTATGTTATCTAATTTTGTTACCCAAAGTTATTTA
CGCAAATAAACGCTGTTGGTTGGAAAACATTTACAATTTCGGTGAAAATA
TAATTACATCAAGTGTTCAGATTTTTTCCCCATTTTCTTTCATTAATGAT
GTGTGAGAAGTGACTGAGTGCTATATAGCAAACCTTTTCTAACAGTATGT
C
back to top

protein sequence of SMED30029932-orf-1

>SMED30029932-orf-1 ID=SMED30029932-orf-1|Name=SMED30029932-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=704bp
MSSDHNFLVGYRVPKIKTETIQNLPLDDPQRKFLISKIEESYKRPDLSKV
SMKFHQAWSITNIDSRSSYSKKRAELKTIFKSTEYYGFVYVKSEYELKKI
VKEGNIKVHNVPVSYLGKCEMGVSLSQHADISNPEFHKSGIILVVNYMRG
QVNYVLYDSSPMDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQVFLYEYS
EDCEIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRI
FEASSKSPPAKRPLINPSKSLLKSNSFPESELLSATLILGKSSSYSHPDL
NLNVKLISRLEQPINLSNLMFKKWNLLELLENRILHEYLYYTENSVRRTL
SFNPKIINKLPHTINDRKKLGATFRPKYALYFKMIPSSSKEKKMQRIMEN
LALKNMVGVVRCNSLNNMLFYIIPNGSFSMSIGLPSIDAENSHVIIFTEQ
HPQFLPCNYSSYDKDIKKEQKIFQEIISDYESKIIKPKQILLLDLLINVK
KPIASSSHNKHDSDMDIDSDGEPNLESSKQINFMNFNHKKNPIQINLGPK
SKTLALVKSHTLTSSIVNRSPVEMSLVNQPHLTKPLHTVTPSNQISPRPH
ITKSPQIVDTQALHTVSKPPVQTINTPLPNGISASNTTDFVSETPVVNYK
PKSFGRFKLMEKQASGMCKPDNKRTSRRQVHLDSVIFSKISGYSHISLYN
GQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007129synapsis
GO:0007140male meiotic nuclear division
GO:0010569regulation of double-strand break repair via homologous recombination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR022188DUF3715
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022188Protein of unknown function DUF3715PFAMPF12509DUF3715coord: 84..211
e-value: 5.7E-17
score: 62.1