LIM homeobox transcription factor 1-alpha

Overview
NameLIM homeobox transcription factor 1-alpha
Smed IDSMED30029919
Length (bp)2024
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM homeobox transcription factor 1-alpha (SMED30029919) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM homeobox transcription factor 1-alpha (SMED30029919) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM homeobox transcription factor 1-alpha (SMED30029919) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM homeobox transcription factor 1-alpha (SMED30029919) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029919

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029919SMESG000021903.1 Contig1531newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029919SMESG000021903.1 Contig1531uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 129.798 bits (325), Expect = 5.454e-32
Identity = 77/219 (35.16%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       ++G                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 129.798 bits (325), Expect = 5.454e-32
Identity = 77/219 (35.16%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       ++G                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 129.798 bits (325), Expect = 5.454e-32
Identity = 77/219 (35.16%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       ++G                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 121.324 bits (303), Expect = 4.512e-29
Identity = 69/221 (31.22%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVS---------------------QTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +S WH+ C++C +CQ  L  +C+     L C+  Y +  +  KC GC   +   E  M +L   YHL CF C  C+  + KGD+F++  G L+CK DYE  +   S+VS                     Q S+ +    D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQL-FAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 275          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 121.324 bits (303), Expect = 5.681e-29
Identity = 69/221 (31.22%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVS---------------------QTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +S WH+ C++C +CQ  L  +C+     L C+  Y +  +  KC GC   +   E  M +L   YHL CF C  C+  + KGD+F++  G L+CK DYE  +   S+VS                     Q S+ +    D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQL-FAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 275          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: ceh-14 (Homeobox protein ceh-14 [Source:UniProtKB/Swiss-Prot;Acc:P20271])

HSP 1 Score: 107.071 bits (266), Expect = 6.455e-25
Identity = 60/202 (29.70%), Postives = 100/202 (49.50%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF--IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C++C+  I+++ +  +    +H SC++C +C+ +L  TCFL ++++ CR  + K  + TKC  C   +    V   + N  YH+ CF+C  CK  +  G++F  I  +  L+CK DYE  R              H ++   + +  R +T IS +  + L+  Y     P    R  +A E  L ++VVQ WF N R K K
Sbjct:   48 CSLCDKKIRDRFVSKVNGRCYHSSCLRCSTCKDELGATCFLREDSMYCRAHFYK-KFGTKCSSCNEGIVPDHVVRKASNHVYHVECFQCFICKRSLETGEEFYLIADDARLVCKDDYEQAR------------DKHCNELEGDGSNKRPRTTISAKSLETLKQAYQTSSKPARHVREQLASETGLDMRVVQVWFQNRRAKEK 236          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 104.76 bits (260), Expect = 7.004e-24
Identity = 59/232 (25.43%), Postives = 109/232 (46.98%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNG-FLICKQDYENGRINNSTVSQTSKPQSHKS----------------------------DNPPESNGVRRK---TKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++++F +    WH+SC++C  C+  +  TCF     +LC+  +++  Y  +C GC   ++  ++   + ++ +H+ CF+C+ C+ L+  GD+  I  G   +C+ D++      ST +   +P S+ S                            DN  +SN  +R+   T I  +Q + L+N +     PT   R  +A E  L ++V+Q WF N R+K +
Sbjct:   68 CAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTCFSRDGLILCKTDFSRR-YSQRCAGCDGKLEKEDLVRRARDKVFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQTA-TKTSTPTSIHRPVSNGSECNSDVEEDNVDACDEVGLDDGEGDCGKDNSDDSNSAKRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRSKER 297          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 99.7525 bits (247), Expect = 1.437e-22
Identity = 59/205 (28.78%), Postives = 94/205 (45.85%), Query Frame = 3
Query:  207 AIINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTV-SQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
             I+ C  C   I++K    I    +H++C++C +C+  L   CF    T  C+ CY +     KC  C   +Q  +    + N  YHL+CF CN CK  +S G+++ +  G L+CKQ +      +S V SQ +K +             R +T  + +Q   L+ ++ +  NP       IA    L  +V Q WF N R + K
Sbjct:   94 VIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRE-LGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFLELVEGDSGVSSQKAKTK-------------RVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQK 284          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 99.7525 bits (247), Expect = 1.467e-22
Identity = 59/206 (28.64%), Postives = 95/206 (46.12%), Query Frame = 3
Query:  207 AIINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVT-KCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTV-SQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
             I+ C  C   I++K    I    +H++C++C +C+  L   CF    T  C+ CY +   +  KC  C   +Q  +    + N  YHL+CF CN CK  +S G+++ +  G L+CKQ +      +S V SQ +K +             R +T  + +Q   L+ ++ +  NP       IA    L  +V Q WF N R + K
Sbjct:   94 VIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFLELVEGDSGVSSQKAKTK-------------RVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQK 286          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 98.2117 bits (243), Expect = 5.588e-22
Identity = 59/215 (27.44%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  207 AIINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVT----------KCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTV-SQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
             I+ C  C   I++K    I    +H++C++C +C+  L   CF    T  C+ CY ++   +          KC  C   +Q  +    + N  YHL+CF CN CK  +S G+++ +  G L+CKQ +      +S V SQ +K +             R +T  + +Q   L+ ++ +  NP       IA    L  +V Q WF N R + K
Sbjct:   94 VIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRTHVTSTASSCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFLELVEGDSGVSSQKAKTK-------------RVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQK 295          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309834)

HSP 1 Score: 107.842 bits (268), Expect = 9.426e-25
Identity = 63/207 (30.43%), Postives = 101/207 (48.79%), Query Frame = 3
Query:  204 MAII-NCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            MA I  C  C++LI ++ +  + +  WH  C++C  C  QL++ CF     L C+  + K  Y TKC  C + +   +V   + +  YHL CF C  C   ++ GD+F ++ +  LICK+DYE  +     +       S   D P +    R +T I+ +Q + L+  Y     P    R  ++ +  L ++VVQ WF N R K K
Sbjct:    1 MATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLD-----GSLDGDQPNK----RPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEK 197          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0081170)

HSP 1 Score: 107.457 bits (267), Expect = 1.760e-24
Identity = 61/204 (29.90%), Postives = 99/204 (48.53%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C  C++LI ++ +  + +  WH  C++C  C  QL++ CF     L C+  + K  Y TKC  C + +   +V   + +  YHL CF C  C   ++ GD+F ++ +  LICK+DYE  +     +       S   D P +    R +T I+ +Q + L+  Y     P    R  ++ +  L ++VVQ WF N R K K
Sbjct:   39 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLD-----GSLDGDQPNK----RPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEK 232          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0081169)

HSP 1 Score: 108.227 bits (269), Expect = 2.176e-24
Identity = 61/204 (29.90%), Postives = 99/204 (48.53%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C  C++LI ++ +  + +  WH  C++C  C  QL++ CF     L C+  + K  Y TKC  C + +   +V   + +  YHL CF C  C   ++ GD+F ++ +  LICK+DYE  +     +       S   D P +    R +T I+ +Q + L+  Y     P    R  ++ +  L ++VVQ WF N R K K
Sbjct:  119 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLD-----GSLDGDQPNK----RPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEK 312          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309832)

HSP 1 Score: 108.227 bits (269), Expect = 2.176e-24
Identity = 61/204 (29.90%), Postives = 99/204 (48.53%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C  C++LI ++ +  + +  WH  C++C  C  QL++ CF     L C+  + K  Y TKC  C + +   +V   + +  YHL CF C  C   ++ GD+F ++ +  LICK+DYE  +     +       S   D P +    R +T I+ +Q + L+  Y     P    R  ++ +  L ++VVQ WF N R K K
Sbjct:  119 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLD-----GSLDGDQPNK----RPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEK 312          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309833)

HSP 1 Score: 108.227 bits (269), Expect = 2.176e-24
Identity = 61/204 (29.90%), Postives = 99/204 (48.53%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C  C++LI ++ +  + +  WH  C++C  C  QL++ CF     L C+  + K  Y TKC  C + +   +V   + +  YHL CF C  C   ++ GD+F ++ +  LICK+DYE  +     +       S   D P +    R +T I+ +Q + L+  Y     P    R  ++ +  L ++VVQ WF N R K K
Sbjct:  119 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLD-----GSLDGDQPNK----RPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEK 312          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 126.716 bits (317), Expect = 3.231e-31
Identity = 71/217 (32.72%), Postives = 109/217 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGR-INNSTVSQTSKPQSHKSDNPPESNGV----------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C+  I ++ L  + DS WH+ C++C  CQ  L  +C+   + L C++ Y +  + TKC GC   +   E+ M +L   YHLSCF C  C+  + KGD+F++  G L+CK DYE  + + +  +S + K +    D  PE                    R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   31 CEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLLTMSCYSRDHKLYCKHDYQQL-FATKCSGCLEKISPTELVMRALESVYHLSCFCCCVCERRLCKGDEFVLKEGQLLCKTDYEREKDLASPDLSDSDKSEDEDLDVKPEKGAGGQGKGSDDSKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 246          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 126.716 bits (317), Expect = 3.231e-31
Identity = 71/217 (32.72%), Postives = 109/217 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGR-INNSTVSQTSKPQSHKSDNPPESNGV----------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C+  I ++ L  + DS WH+ C++C  CQ  L  +C+   + L C++ Y +  + TKC GC   +   E+ M +L   YHLSCF C  C+  + KGD+F++  G L+CK DYE  + + +  +S + K +    D  PE                    R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   31 CEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLLTMSCYSRDHKLYCKHDYQQL-FATKCSGCLEKISPTELVMRALESVYHLSCFCCCVCERRLCKGDEFVLKEGQLLCKTDYEREKDLASPDLSDSDKSEDEDLDVKPEKGAGGQGKGSDDSKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 246          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-31
Identity = 71/217 (32.72%), Postives = 109/217 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGR-INNSTVSQTSKPQSHKSDNPPESNGV----------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C+  I ++ L  + DS WH+ C++C  CQ  L  +C+   + L C++ Y +  + TKC GC   +   E+ M +L   YHLSCF C  C+  + KGD+F++  G L+CK DYE  + + +  +S + K +    D  PE                    R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   33 CEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLLTMSCYSRDHKLYCKHDYQQL-FATKCSGCLEKISPTELVMRALESVYHLSCFCCCVCERRLCKGDEFVLKEGQLLCKTDYEREKDLASPDLSDSDKSEDEDLDVKPEKGAGGQGKGSDDSKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1al (LIM homeobox transcription factor 1, alpha-like [Source:ZFIN;Acc:ZDB-GENE-131213-1])

HSP 1 Score: 123.635 bits (309), Expect = 7.611e-30
Identity = 70/216 (32.41%), Postives = 104/216 (48.15%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKS----------------DNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +  WH++CVKC  C+  L  TC+     L C++ Y K  +V KC  C   +   E+ M  L Q YHL CF C  C+  + +GD+F++  G L+C+ DYE  R   + +S  +  +S KS                D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   60 CAGCESPIADRFLLRVNELSWHETCVKCAVCRSALSGTCYCRDRLLYCKHDYEKL-FVRKCSACLQAIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRGDYEKEREMLAAIS-PAPTESVKSEDEEGGGVSVGGKAGDDGKEHKRSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMK 273          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1al (LIM homeobox transcription factor 1, alpha-like [Source:ZFIN;Acc:ZDB-GENE-131213-1])

HSP 1 Score: 123.25 bits (308), Expect = 7.620e-30
Identity = 70/216 (32.41%), Postives = 104/216 (48.15%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKS----------------DNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +  WH++CVKC  C+  L  TC+     L C++ Y K  +V KC  C   +   E+ M  L Q YHL CF C  C+  + +GD+F++  G L+C+ DYE  R   + +S  +  +S KS                D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   52 CAGCESPIADRFLLRVNELSWHETCVKCAVCRSALSGTCYCRDRLLYCKHDYEKL-FVRKCSACLQAIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRGDYEKEREMLAAIS-PAPTESVKSEDEEGGGVSVGGKAGDDGKEHKRSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMK 265          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:NCBI gene;Acc:100492433])

HSP 1 Score: 124.02 bits (310), Expect = 4.709e-30
Identity = 72/215 (33.49%), Postives = 102/215 (47.44%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSD-----------NPPESNGVRR----KTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  I DS WH+ C +C +C+  L+ +CF     L CRN Y K  +  KC  C   +   E  M +    YHL CF C  C   + KGD+F++ +G L+CK DYE  R   S VS  +       D            P +    +R    +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCERVICDRFLLRISDSLWHEQCAQCCTCKEPLESSCFYRDKKLYCRNDYEKL-FAVKCGTCLDTITPSEFVMRAQKNVYHLGCFCCCVCDRQLQKGDEFVLKDGQLLCKSDYERERDLLSLVSPAASDSGKSEDEDDAGKFDDSKGPEDGKDQKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: dcp1b (decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-877165])

HSP 1 Score: 120.553 bits (301), Expect = 5.848e-29
Identity = 69/214 (32.24%), Postives = 107/214 (50.00%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTS--------------KPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C + I ++ L  + D  WH+ CVKC +C   L  TC+     L C+  Y+K  + TKC  C   +   E+ M  L+  YH++CF C  C+  + +GD+F++  G L+C+ DYE  +   S +S T               + +S +  +P  S   R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   27 CAGCGNTISDRFLLRVNDRSWHECCVKCAACLQILSGTCYYRNRQLYCKEDYDKL-FATKCNSCLKTVLPSELIMRVLSNVYHVACFFCCECERRLERGDEFVLKEGQLLCRSDYEREKEMLSALSLTPSGSVKSEDEDGASLQGKSDEGKDPKRSK--RPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMK 237          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 117.857 bits (294), Expect = 4.768e-28
Identity = 64/204 (31.37%), Postives = 102/204 (50.00%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C+ CN+ I +K +  + D +WH +C+KC  CQ+ L E CF     + C+  + K  + TKC  C+  +   +V   + +  YHL CF C  C   ++ GD+F ++ +G L+CK+DYE  + N+ +                E    R +T I+ +Q + L+N Y     P    R  ++ E  L ++VVQ WF N R K K
Sbjct:   27 IPRCSGCNEHILDKFILKVLDRHWHSACLKCCECQVPLAERCFYRAGNVYCKEDFFK-CFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFSCIICSRQLATGDEFYLMEDGRLVCKEDYETAKQNDDS----------------EGGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEK 213          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: LMX1B (LIM homeobox transcription factor 1, beta, gene 1 [Source:NCBI gene;Acc:100495130])

HSP 1 Score: 115.161 bits (287), Expect = 4.748e-27
Identity = 68/220 (30.91%), Postives = 104/220 (47.27%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGR-------------INNSTVSQTSKP------QSHKSDNPPESNGVRR-KTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + ++ WH+ C++C  CQ  L  +C+     L C+  Y +  +  KC GC   +   E  M +L   YHLSCF C  C+  + KGD+F++  G L+CK DYE  +             + +       KP      Q   SD+  +    +R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   56 CEGCQRPISDRFLMRVNEASWHEECLQCTVCQQPLTTSCYFRDRKLFCKQDYQQL-FAAKCSGCMEKIAPTEFVMRALECVYHLSCFCCCVCERQLRKGDEFVLKEGQLLCKSDYEKEKDLLSSGSPDDSDSVKSDDEEGDVKPGKCHVNQGKGSDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 274          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 116.316 bits (290), Expect = 1.021e-26
Identity = 64/204 (31.37%), Postives = 102/204 (50.00%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C+ CN+ I +K +  + D +WH +C+KC  CQ+ L E CF     + C+  + K  + TKC  C+  +   +V   + +  YHL CF C  C   ++ GD+F ++ +G L+CK+DYE  + N+ +                E    R +T I+ +Q + L+N Y     P    R  ++ E  L ++VVQ WF N R K K
Sbjct:  187 IPRCSGCNEHILDKFILKVLDRHWHSACLKCCECQVPLAERCFYRAGNVYCKEDFFK-CFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFSCIICSRQLATGDEFYLMEDGRLVCKEDYETAKQNDDS----------------EGGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEK 373          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1a (LIM homeobox transcription factor 1 alpha [Source:MGI Symbol;Acc:MGI:1888519])

HSP 1 Score: 130.568 bits (327), Expect = 2.033e-32
Identity = 74/218 (33.94%), Postives = 107/218 (49.08%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSK------------PQSHKSDNPPESNG------VRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +               +H +      +G       R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGASEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1a (LIM homeobox transcription factor 1 alpha [Source:MGI Symbol;Acc:MGI:1888519])

HSP 1 Score: 130.568 bits (327), Expect = 2.033e-32
Identity = 74/218 (33.94%), Postives = 107/218 (49.08%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSK------------PQSHKSDNPPESNG------VRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +               +H +      +G       R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGASEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 120.939 bits (302), Expect = 2.609e-29
Identity = 69/221 (31.22%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVS---------------------QTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +S WH+ C++C +CQ  L  +C+     L C+  Y +  +  KC GC   +   E  M +L   YHL CF C  C+  + KGD+F++  G L+CK DYE  +   S+VS                     Q S+ +    D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   23 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQL-FAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 242          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 121.324 bits (303), Expect = 2.644e-29
Identity = 69/221 (31.22%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVS---------------------QTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +S WH+ C++C +CQ  L  +C+     L C+  Y +  +  KC GC   +   E  M +L   YHL CF C  C+  + KGD+F++  G L+CK DYE  +   S+VS                     Q S+ +    D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   33 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQL-FAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 252          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lhx4 (LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:101776])

HSP 1 Score: 120.168 bits (300), Expect = 6.744e-29
Identity = 65/204 (31.86%), Postives = 103/204 (50.49%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C  CN  I +K +  + D +WH SC+KC  CQ+QL + CF    ++ C+  + K  + TKC  C+  +   +V   + +  YHL CF C  C   ++ GD+F ++ +G L+CK+DYE  + N+ +                E+   R +T I+ +Q + L+N Y     P    R  ++ E  L ++VVQ WF N R K K
Sbjct:   27 IPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFK-RFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQNDDS----------------EAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEK 213          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q9JKU8|LMX1A_MOUSE (LIM homeobox transcription factor 1-alpha OS=Mus musculus OX=10090 GN=Lmx1a PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.422e-31
Identity = 74/218 (33.94%), Postives = 107/218 (49.08%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSK------------PQSHKSDNPPESNG------VRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +               +H +      +G       R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGASEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q04650|LMX1A_MESAU (LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus OX=10036 GN=LMX1A PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.477e-31
Identity = 77/219 (35.16%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       ++G                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSAHGAGKGTSEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q8TE12|LMX1A_HUMAN (LIM homeobox transcription factor 1-alpha OS=Homo sapiens OX=9606 GN=LMX1A PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.619e-31
Identity = 77/219 (35.16%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       ++G                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|P36200|LHX3_XENLA (LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.067e-28
Identity = 74/247 (29.96%), Postives = 120/247 (48.58%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK-LQRNNEIKIFNEKLQIDDNESENSVQVKNMIQQQCFTPDQDC 944
            I  C  CN  I ++ +  + D +WH  C+KC+ CQIQL E CF   +++ C++ + K  + TKC  C+  +   +V   +    YHL CF C  CK  ++ GD+F ++ +  L+CK DYE  +   +                 ES   R +T I+ +Q + L+N Y     P    R  ++ E  L ++VVQ WF N R K K L+++   + + +  +       NS   K+ IQ++   PD D 
Sbjct:   25 IPQCAGCNQHIVDRFILKVLDRHWHSKCLKCNDCQIQLAEKCFSRGDSVYCKDDFFK-RFGTKCAACQQGIPPTQVVRRAQEFVYHLHCFACIVCKRQLATGDEFYLMEDSRLVCKADYETAKQREA-----------------ESTAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGNSKSDKDSIQEE--GPDSDA 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|O88609|LMX1B_MOUSE (LIM homeobox transcription factor 1-beta OS=Mus musculus OX=10090 GN=Lmx1b PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 2.167e-28
Identity = 69/221 (31.22%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVS---------------------QTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +S WH+ C++C +CQ  L  +C+     L C+  Y +  +  KC GC   +   E  M +L   YHL CF C  C+  + KGD+F++  G L+CK DYE  +   S+VS                     Q S+ +    D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQL-FAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 275          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: W5LZM0 (Uncharacterized protein OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.770e-30
Identity = 76/216 (35.19%), Postives = 110/216 (50.93%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKP---------------QSHKSDNPPESNGVRR-KTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C+ LI++K+L  + + +WH+ CV C +C+  L  TCFL +  L C+  Y K  +  KC GC   +   E+ M +    YHL CF C  C+  + KGD+F++  G L+CK DYE  R   S VS  S                 +S K+   PE    +R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   29 CEGCHRLIRDKYLLRVNNCFWHEQCVHCAACRETLKNTCFLRETKLYCKRDYEKL-FAVKCSGCLEVITPAELVMRAHKLVYHLQCFCCCVCERRLQKGDEFVLKEGQLLCKSDYEKERELLSLVSPASSDSGKSDEDEDSADKSMRSTKAGEDPEHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 243          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: I3M5L7 (LIM homeobox transcription factor 1 alpha OS=Ictidomys tridecemlineatus OX=43179 GN=LMX1A PE=4 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 4.538e-30
Identity = 78/219 (35.62%), Postives = 108/219 (49.32%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDN--------PPESNGV-----------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD         P    G            R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVRCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAITPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDEEESLCKSAPGAGKGASEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: A0A2U3WHZ9 (LIM homeobox transcription factor 1-alpha OS=Odobenus rosmarus divergens OX=9708 GN=LMX1A PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.107e-29
Identity = 78/219 (35.62%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       +NG                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSANGAGKGAAEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: A0A3Q7QQG8 (LIM homeobox transcription factor 1-alpha OS=Callorhinus ursinus OX=34884 GN=LOC112839207 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.107e-29
Identity = 78/219 (35.62%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       +NG                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSANGAGKGAAEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: A0A2Y9HR96 (LIM homeobox transcription factor 1-alpha OS=Neomonachus schauinslandi OX=29088 GN=LMX1A PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.230e-29
Identity = 78/219 (35.62%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPP----ESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C  +I ++ L  + DS+WH+ CV+C SC+  L+ TCF     L C+  Y K  +  KC GC   +  +E  M +    YHLSCF C  C+  + KGD+F++  G L+CK DYE  R   S VS  +   S KSD+       +NG                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAAS-DSGKSDDEESLCKSANGAGKGATEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1al (LIM homeobox transcription factor 1-alpha-like [Source:NCBI gene;Acc:103034908])

HSP 1 Score: 122.094 bits (305), Expect = 1.294e-29
Identity = 70/216 (32.41%), Postives = 104/216 (48.15%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKS----------------DNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +  WH++CVKC  C   L  TC+     L C++ Y K  +V KC  C   +   E+ M  L Q YHL CF C  C+  + +GD+F++  G L+C+ DYE  R   + +S  +  +S KS                D+       R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   28 CAGCESPIADRFLLRVNEQSWHETCVKCAVCLSTLSGTCYCRDRLLYCKHDYEKL-FVRKCSACMQVIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRGDYEKEREMLAAIS-PAPTESVKSEDEEGGSGSVGGKAGDDSKEHKRSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMK 241          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1al (LIM homeobox transcription factor 1-alpha-like [Source:NCBI gene;Acc:103034908])

HSP 1 Score: 122.094 bits (305), Expect = 1.841e-29
Identity = 70/216 (32.41%), Postives = 104/216 (48.15%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKS----------------DNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +  WH++CVKC  C   L  TC+     L C++ Y K  +V KC  C   +   E+ M  L Q YHL CF C  C+  + +GD+F++  G L+C+ DYE  R   + +S  +  +S KS                D+       R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   52 CAGCESPIADRFLLRVNEQSWHETCVKCAVCLSTLSGTCYCRDRLLYCKHDYEKL-FVRKCSACMQVIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRGDYEKEREMLAAIS-PAPTESVKSEDEEGGSGSVGGKAGDDSKEHKRSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMK 265          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 117.857 bits (294), Expect = 1.166e-28
Identity = 68/219 (31.05%), Postives = 108/219 (49.32%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGR-INNSTVSQTSKPQSHKSD---NPPESNGV---------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +S WH+ C++C  CQ  L  +C+     + C++ Y +  + TKC GC   +   E  M +L   YHL CF C  C+  + KGD+F++ +  L+CK+DYE  + + N+   + S  +S   D    P + +G                R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   31 CAGCQRPIADRFLLRVNESSWHEECLQCAVCQQPLTMSCYCRDRKVYCKHDYQRL-FATKCSGCLEKIAPTEFVMRALKSVYHLGCFCCCVCERQLCKGDEFVLKDSQLLCKKDYEREKDLLNAISPEMSDSKSEDEDVDVKPEKGSGGQNKGSDDSKDSRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:103022970])

HSP 1 Score: 119.013 bits (297), Expect = 1.953e-28
Identity = 70/219 (31.96%), Postives = 109/219 (49.77%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTS-------------KPQS-----HKSDNPPESNGVRR-KTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + ++ WH+ C++C  CQ  L  +C+L +  L C++ Y +  + TKC GC   +   E  M +L   YHL+CF C  C   + KGD+F++ +G L+CK DYE  +    +VS                KP+       K D+  +    +R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   68 CEGCQRPISDRFLMRVNEASWHEECLQCAVCQQPLTTSCYLRERKLYCKHDYQQL-FATKCSGCLEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLKDGQLLCKSDYEKEKDLLGSVSPDDSESEKSEDEELDIKPEKCSGGPGKGDDSKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 285          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:103022970])

HSP 1 Score: 117.857 bits (294), Expect = 3.890e-28
Identity = 70/219 (31.96%), Postives = 109/219 (49.77%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTS-------------KPQS-----HKSDNPPESNGVRR-KTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + ++ WH+ C++C  CQ  L  +C+L +  L C++ Y +  + TKC GC   +   E  M +L   YHL+CF C  C   + KGD+F++ +G L+CK DYE  +    +VS                KP+       K D+  +    +R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   36 CEGCQRPISDRFLMRVNEASWHEECLQCAVCQQPLTTSCYLRERKLYCKHDYQQL-FATKCSGCLEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLKDGQLLCKSDYEKEKDLLGSVSPDDSESEKSEDEELDIKPEKCSGGPGKGDDSKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 76.6406 bits (187), Expect = 1.480e-16
Identity = 40/123 (32.52%), Postives = 57/123 (46.34%), Query Frame = 3
Query:  216 NCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDE---TCFLVKNTLLCRNCYNKS-SYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENG 572
             C  C   I ++ L    D YWH  C+KC  CQ QL +   +C+  +  +LCR+ Y +       C  C   +   E+ M +    YHL CF C  C+  +  GD+F   NG L C+ D   G
Sbjct:   17 RCAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQGNVYHLKCFACATCRTRLVPGDRFHYVNGSLFCEHDRPAG 139          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 68.9366 bits (167), Expect = 4.791e-14
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTL---LCRNCYNKS-SYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQD-YENGRIN 581
            ++ C  C   I +++L    + +WH+ C+ CD C  +L E    +   L   LCR  Y +       C  C   ++  E+ M   ++ YHL CFKC  C+     GD++++ N  +IC+QD YE  +IN
Sbjct:   27 MLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDIYEWSKIN 155          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 67.3958 bits (163), Expect = 1.935e-13
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTL---LCRNCYNKS-SYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQD-YENGRIN 581
            ++ C  C   I +++L    + +WH+ C+ CD C  +L E    +   L   LCR  Y +       C  C   ++  E+ M   ++ YHL CFKC  C+     GD++++ N  +IC+QD YE  +IN
Sbjct:   26 MLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDIYEWSKIN 154          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002189.1 (pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gene:ENSPMAG00000001979.1 transcript:ENSPMAT00000002189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 3.258e-6
Identity = 39/171 (22.81%), Postives = 67/171 (39.18%), Query Frame = 3
Query:  387 YVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISN-GFLICKQDYEN----------------GRINNSTVSQTSKPQS--HKSDNPPESNGV--------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            +  KC  C       +  M + +  YH+ CF+C  C   +  GD+F + + G L+C+ D  +                G       +  ++P S  H S +   S G+        R +T ++ +Q Q L   Y     P    +  + +   L  +V++ WF N R K K
Sbjct:    3 FGIKCAKCNASFSKTDFVMRARSHIYHMECFRCETCSRQLLPGDEFALRDGGGLLCRADQHHGGGGGGGAGGAGGGAGGGGGGLLGTALTRPGSPVHSSRSLHLSGGIPSGPEKATRVRTVLNEKQLQTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDK 173          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006267.1 (pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 gene:ENSPMAG00000005668.1 transcript:ENSPMAT00000006267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 5.718e-6
Identity = 32/127 (25.20%), Postives = 57/127 (44.88%), Query Frame = 3
Query:  216 NCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNT--LLCRNCYNKSSYVTK-------CFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYEN 569
             C  C D ++ + +  +G +Y H  C  C  C+        +  N    LC  C    S V +       C GC   ++  + A+ +L + +HL CFKC  C  +++   ++I  +G   C++DY +
Sbjct:   83 RCQACGDFVEGEVVTALGRTY-HPRCFVCSVCRQPFPSGARVTFNGRECLCHECTQPISPVLRDPSNPSNCAGCGRDIKNGQ-ALLALERHWHLGCFKCRACGKVLT--GEYISKDGMPYCERDYHS 205          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 105.531 bits (262), Expect = 1.568e-25
Identity = 64/229 (27.95%), Postives = 104/229 (45.41%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDE--TCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYE----NGRINNSTVSQTSKPQSHK-----------------SDNPPE-SNGV-----RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I E+   +  D  WH  C+KC  C+++LD   TCF     +LCR  Y +   V KC  C   + + E+ M + +Q YH++CF C+ CK +++ G+ F +    + CK+DYE        N + ++  SK +  K                 SD P E + G      R +T     Q + ++ ++    NP  K    ++ +  L  +V+Q WF N R K +
Sbjct:    9 CAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATGEYFGMRGIRIYCKEDYEELLREESRNPTKINSLSKGRPRKRRIATAIESITNLGYDLSDRPGELTTGADGRPKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARAKFR 237          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 100.523 bits (249), Expect = 3.232e-24
Identity = 62/209 (29.67%), Postives = 102/209 (48.80%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDK-FIISNGFLICKQDYENGRINN-STVSQTSKPQSHKSDNPPESNGV--RR--KTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            +  C  C   I +K L  + D  WH  CV+C  C+  L E CF  +  L C+  + +  Y TKC GC   +  +++   + +  +H+ CF C+YCK  I+ GD+ + I +G  IC+ DY +    N        K  S+  D   ++     RR  +T I  +Q + L++ +     P+   R  +A E  L ++V+Q WF N R+K +
Sbjct:    2 VQQCAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFSREGKLFCKTDFYR-RYGTKCSGCDQGISPNDMVRRAKHLVFHVDCFVCSYCKRQITTGDELYYIGDGSFICRDDYYHSHPTNLDDAIDEPKDLSYGLDEDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQNRRSKER 209          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 96.2857 bits (238), Expect = 8.704e-22
Identity = 65/233 (27.90%), Postives = 103/233 (44.21%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLF-VIGDSYWHKSCVKCDSCQIQLDE--TCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYE----------------NGRINNSTVSQT-------SKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMKLQRNNEI 839
            C  C   I ++++  V  D  WH SC+KC  C + LDE  TCF+ +    C+  Y +  + TKC  C L    ++  M + N+ YH+ CF+C  C   +  GD+F +    L CK D+E                NG+ ++ +  QT       S P   K+D P      R +T ++ +Q   L   Y     P    +  + +   L  +V++ WF N R K K +  N +
Sbjct:   17 CVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRL-FGTKCAKCSLNFSKNDFVMRARNKIYHIDCFRCVACSRQLVPGDEFALREDGLFCKADHEIVEKATATAQATHVRNNGQRSSQSGGQTNGQTTPDSTPSKRKTDRP-----TRVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKNPNSL 243          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 84.7297 bits (208), Expect = 5.643e-18
Identity = 57/212 (26.89%), Postives = 93/212 (43.87%), Query Frame = 3
Query:  216 NCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQL--DETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVS----QTSKPQSHKSDNPPESNGVRRKTK-----ISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
             C  C   I +++L  +    WH  C+KC  C  +L  + TC+     + C+  Y +  + TKC  C   +  ++    + N  YHL+CF C+ CK  +S G++F + +G ++CK  Y    ++ S       +   P     D+P      R K K      + +Q Q L+  +    NP  +    IA    L  +V Q WF N R + K
Sbjct:   27 RCVGCEAKIVDRYLVKVSGRAWHTKCLKCCLCSDELGREATCYTKDGKIYCKADYARQ-FGTKCARCGRSIHANDWVRRAKNCVYHLACFACDNCKRQLSTGEEFALKDGHVLCKLHYLEA-LDTSPAERDYQEVFSPDVDGDDSPNSLKSGRHKAKRVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQNSRARQK 236          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO37316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG43])

HSP 1 Score: 72.4034 bits (176), Expect = 5.011e-15
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDE---TCFLVKNTLLCRNCYNKS-SYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYEN 569
            C  C + I ++ L +  D YWH +C+KC  C+ +L E   +C+     +LC+  Y +       C  C   +   E+ M  L + YHL CF C  C N +  GD+F + NG L C+ D  N
Sbjct:   19 CAGCGEKIIDRFLLLALDQYWHVNCLKCSCCEARLGEIGTSCYSKGGMILCKTDYVRLYGNSGACAVCAKLIPATELVMKVLGKVYHLHCFTCTTCHNQLVPGDRFHVVNGRLFCENDDPN 139          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1a (LIM homeobox transcription factor 1-alpha-like [Source:NCBI gene;Acc:101175472])

HSP 1 Score: 120.553 bits (301), Expect = 2.481e-29
Identity = 67/216 (31.02%), Postives = 107/216 (49.54%), Query Frame = 3
Query:  213 INCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLIC-KQDYE-------NGRINNSTVSQTSKPQSHKSDNPPESNG------VRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            + C  C   I ++ L  + D  WH+ CV+C +C   L  +CFL++  L C+  Y+ S +   C GC   +   E+ M +    +HLSCF C+ C + +  GD+ I+ +G L+C ++DY        +  I  S   +  +P +   D P  S+        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   14 VVCVGCQRRITDRFLLRVADGLWHERCVRCAACGDALRNSCFLLERKLYCKRDYS-SLFAVHCGGCAEAISPSELVMRAGAAVFHLSCFTCSVCFHHLKTGDRCILQDGRLLCAREDYHQLQASPPSSDIGKSGDDEEEEPSAKVMDKPGRSHDQENKRPKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 228          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1ba (LIM/homeobox protein LMX-1.2-like [Source:NCBI gene;Acc:101158371])

HSP 1 Score: 117.087 bits (292), Expect = 2.832e-28
Identity = 66/216 (30.56%), Postives = 107/216 (49.54%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGV-----------------RRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKM 815
            C  C  +I ++ L  +  + WH+ C++C +C+  L  TC++  + L CR  Y +  +  KC GC   +   ++ + +L + YHLSCF C  C++ + KGD+F++  G L CK+DY+  R  +ST    S     + D   ES                    R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R K+
Sbjct:   13 CQGCRRVICDRFLLWVNGACWHEECLRCAACRQPLATTCYVNDSKLYCRRDYRRL-FSAKCSGCLERIAATDLVIRALERVYHLSCFCCCICEHQLCKGDEFVLKEGQLFCKKDYDKERNLSSTGGDNSDSDKSRDDFEAESEHFVTAVKGSDDNKDPFRPKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKV 227          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1al (LIM homeobox transcription factor 1-alpha [Source:NCBI gene;Acc:101160412])

HSP 1 Score: 117.857 bits (294), Expect = 4.718e-28
Identity = 69/222 (31.08%), Postives = 101/222 (45.50%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQT----------------------SKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + +  WH++CVKC  C   L  TC+     L C+  Y K  +V KC  C   +   E+ M  L Q YHL CF C  C+  + +GD+F++  G L+C+ DYE  R   + +S T                       + + HK    P       +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:   55 CAGCESPISDRFLLRVNERSWHETCVKCAVCLSTLTGTCYCRDRLLYCKLDYEKL-FVRKCSACLQVIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRMDYEKEREMLAAISPTPTESVKSEDEDGGGGSGSGKGGDESKEHKRSKRP-------RTILTTQQRRAFKASFEVSAKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMK 268          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:101159592])

HSP 1 Score: 117.472 bits (293), Expect = 1.181e-27
Identity = 70/219 (31.96%), Postives = 102/219 (46.58%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGR-------------INNSTVSQTSKP------QSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C  C   I ++ L  + DS WH+ C++C  CQ  L  +C+L +  L C++ Y +  + TKC GC   +   E  M +L   YHL+CF C  C   + KGD+F++  G L+CK DYE  +               +       KP      Q    D        R +T ++T+QR+  +  +     P  K R  +A E  L V+VVQ WF N R KMK
Sbjct:  120 CEGCQRPISDRFLMRVNDSSWHEECLQCAVCQQPLTTSCYLRERKLYCKHDYQQL-FATKCSGCMEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLKEGQLLCKVDYEREKDLLSSVSPDDSDSEKSDDEELDIKPEKGIGSQGKGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 337          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lhx4 (LIM homeobox 4 [Source:NCBI gene;Acc:101165225])

HSP 1 Score: 112.079 bits (279), Expect = 2.838e-26
Identity = 61/204 (29.90%), Postives = 100/204 (49.02%), Query Frame = 3
Query:  210 IINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKF-IISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            I  C  C+  I +K +  + D +WH  C+KC  CQ  L + CF    ++ C+  + K  + TKC  C+  +   +V   + +  YHL CF C  C   ++ GD+F ++ +G L+CK DYE  + N+ + + T +P                +T I+ +Q + L++ Y     P    R  ++ E  L ++VVQ WF N R K K
Sbjct:   28 IPQCAGCSQHILDKFILKVLDRHWHSKCLKCADCQTPLADKCFSRAGSVYCKEDFFK-RFGTKCASCQQGIPPTQVVRKAQDFVYHLHCFACIMCSRQLATGDEFYLMEDGRLVCKVDYETAKQNDDSEAGTKRP----------------RTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEK 214          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000020988.1 (SMESG000020988.1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 424/426 (99.53%), Postives = 424/426 (99.53%), Query Frame = 3
Query:   63 MATGDTLQSKRMEFNDQSNNWMSNNSEAFXXXXXXXXXXXXXXXXXXMAIINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMKLQRNNEIKIFNEKLQIDDNESENSVQVKNMIQQQCFTPDQDCPTNCQISQSTEDHTSPQDLSSSDMSGMYNCPDLKAFPLRSSNEPLSNSDHQNESMEDTGLTYADLSNSCVKSINHSILDGYSATPTNHPNDFRTRPFSNATAATINYKQQTTNNNHDDRSDHRSKSICMTWS 1340
            MATGDTLQSKRMEFNDQSNNWMSNNSEAFKTPTEEPHTTKKTKKKIKMAIINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNS VSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMKLQRNNEIKIFNEKLQIDDNESENSVQVKNMIQQQCFTPDQDCPTNCQISQSTEDHTSPQDLSSSDMSGMYNCPDLKAFPLRSSNEPLSNSDHQNESMEDTGLTYADLSNSCVKSINHSILDGYSATPTNHPNDFRTRPFSNATAA INYKQQTTNNNHDDRSDHRSKSICMTWS
Sbjct:    1 MATGDTLQSKRMEFNDQSNNWMSNNSEAFKTPTEEPHTTKKTKKKIKMAIINCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDYENGRINNSAVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMKLQRNNEIKIFNEKLQIDDNESENSVQVKNMIQQQCFTPDQDCPTNCQISQSTEDHTSPQDLSSSDMSGMYNCPDLKAFPLRSSNEPLSNSDHQNESMEDTGLTYADLSNSCVKSINHSILDGYSATPTNHPNDFRTRPFSNATAAPINYKQQTTNNNHDDRSDHRSKSICMTWS 426          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000005304.1 (SMESG000005304.1)

HSP 1 Score: 193.741 bits (491), Expect = 1.079e-54
Identity = 123/328 (37.50%), Postives = 177/328 (53.96%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVK-NTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISN--GFLICKQDYENG---RINNSTVSQTSKPQSHKSDNPP-----------------------ESNG---------------VRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMKLQRNNEIKIFNEKLQIDDNESE----------NSVQVKNMIQQQC-----------FTPDQDCPTNCQISQSTEDHTS-PQDLS 1004
            C  CN +I +K+LF + D++WHKSC  C  C+  L+E+CF++K N L CRN Y KSS+ TKC GC LPMQTHEVAM++LN+ YH++CF C+ CK L+ +GD+FI+      L+C+ DYE+G     +++T++   +  SHK  N                          SNG                R +T ++ +Q++ L  F+   QNP  KQR  +A+E+ LP+KVVQ WF N R K++  +    +I N +    D+ S           +SV  ++ I Q             +  DQ+ P NCQISQSTEDH S P+DLS
Sbjct:   34 CTGCNGVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKLSNQISNSQHHSSDDPSNVDNEPLDQCVSSVNKESDIDQNYGVDNRSDIDFNYNCDQEKP-NCQISQSTEDHNSPPEDLS 360          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000071273.1 (SMESG000071273.1)

HSP 1 Score: 96.2857 bits (238), Expect = 7.837e-21
Identity = 55/206 (26.70%), Postives = 96/206 (46.60%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDK-FIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMKLQRNN 833
            C  C   I ++ +  +G S WH  C+ C  C I L + C+   + + C+  + +  Y T+C  C   +   EV   + N  YHL CF C  C   ++ G++ F++S+  L+C+ D+E  +     + Q +K               R +T I+ +Q + L+  Y +   P    R  ++ +  L ++VVQ WF N R K K  + +
Sbjct:   46 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRR-YGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNK---------------RPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKD 235          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000001774.1 (SMESG000001774.1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.653e-18
Identity = 58/239 (24.27%), Postives = 107/239 (44.77%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDET--CFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLICKQ----------------DYENGRINNSTVSQT----SKPQSHKS--DNPPESN-----------GVRRKTKIST----EQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMK 818
            C+ C  +I +K+     +  WH SC+KCD C+  LD+T  C+    T  C++ Y +     KC  C+  ++  E+ M  LN  +H+ CF C  C   ++ G+ F+++   L C+                 D+  G  NN ++ ++    SKP+      D+  + N           G+ ++ ++ T     Q + +  ++    NP  K    ++++  L  +V+Q WF N R K +
Sbjct:   12 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFR 250          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000039808.1 (SMESG000039808.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.982e-17
Identity = 63/257 (24.51%), Postives = 111/257 (43.19%), Query Frame = 3
Query:  219 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLV---KNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAM-YSLNQPYHLSCFKCNYCKNLISKGDKFIISNGFLIC-------------------------KQDYENGRINN--STVSQTSKP--------QSHKSDNP---------------------PESNGVRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRT 809
            C  C + I +KH+ +I D +WH++CV C+ C I L + C+     K  + CR  + K    +KC  C++ +Q  ++ +   L+  +H SCFKC+ C   +  GD+++++  ++I                          +Q+++  R  N  ++++ TS          +SH S N                      P     R +T ++  QR+  +  +     P+ K R  +A E  L V+VVQ WF N R 
Sbjct:    4 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIKKKQSSKCQSCQMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGSSSINSTNSNVLLYIEQNHKINRAGNIDNSINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 260          
The following BLAST results are available for this feature:
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMX1A5.454e-3235.16LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1A5.454e-3235.16LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1A5.454e-3235.16LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1B4.512e-2931.22LIM homeobox transcription factor 1 beta [Source:H... [more]
LMX1B5.681e-2931.22LIM homeobox transcription factor 1 beta [Source:H... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-146.455e-2529.70Homeobox protein ceh-14 [Source:UniProtKB/Swiss-P... [more]
lin-117.004e-2425.43pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
lim-41.437e-2228.78LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lim-41.467e-2228.64LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lim-45.588e-2227.44LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lim39.426e-2530.43gene:FBgn0002023 transcript:FBtr0309834[more]
Lim31.760e-2429.90gene:FBgn0002023 transcript:FBtr0081170[more]
Lim32.176e-2429.90gene:FBgn0002023 transcript:FBtr0081169[more]
Lim32.176e-2429.90gene:FBgn0002023 transcript:FBtr0309832[more]
Lim32.176e-2429.90gene:FBgn0002023 transcript:FBtr0309833[more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1ba3.231e-3132.72LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1ba3.231e-3132.72LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1ba3.579e-3132.72LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1al7.611e-3032.41LIM homeobox transcription factor 1, alpha-like [S... [more]
lmx1al7.620e-3032.41LIM homeobox transcription factor 1, alpha-like [S... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMX1A4.709e-3033.49LIM homeobox transcription factor 1 alpha [Source:... [more]
dcp1b5.848e-2932.24decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-8771... [more]
clpb4.768e-2831.37ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
LMX1B4.748e-2730.91LIM homeobox transcription factor 1, beta, gene 1 ... [more]
clpb1.021e-2631.37ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmx1a2.033e-3233.94LIM homeobox transcription factor 1 alpha [Source:... [more]
Lmx1a2.033e-3233.94LIM homeobox transcription factor 1 alpha [Source:... [more]
Lmx1b2.609e-2931.22LIM homeobox transcription factor 1 beta [Source:M... [more]
Lmx1b2.644e-2931.22LIM homeobox transcription factor 1 beta [Source:M... [more]
Lhx46.744e-2931.86LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JKU8|LMX1A_MOUSE1.422e-3133.94LIM homeobox transcription factor 1-alpha OS=Mus m... [more]
sp|Q04650|LMX1A_MESAU1.477e-3135.16LIM homeobox transcription factor 1-alpha OS=Mesoc... [more]
sp|Q8TE12|LMX1A_HUMAN2.619e-3135.16LIM homeobox transcription factor 1-alpha OS=Homo ... [more]
sp|P36200|LHX3_XENLA2.067e-2829.96LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=835... [more]
sp|O88609|LMX1B_MOUSE2.167e-2831.22LIM homeobox transcription factor 1-beta OS=Mus mu... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5LZM02.770e-3035.19Uncharacterized protein OS=Lepisosteus oculatus OX... [more]
I3M5L74.538e-3035.62LIM homeobox transcription factor 1 alpha OS=Ictid... [more]
A0A2U3WHZ91.107e-2935.62LIM homeobox transcription factor 1-alpha OS=Odobe... [more]
A0A3Q7QQG81.107e-2935.62LIM homeobox transcription factor 1-alpha OS=Callo... [more]
A0A2Y9HR961.230e-2935.62LIM homeobox transcription factor 1-alpha OS=Neomo... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1al1.294e-2932.41LIM homeobox transcription factor 1-alpha-like [So... [more]
lmx1al1.841e-2932.41LIM homeobox transcription factor 1-alpha-like [So... [more]
lmx1ba1.166e-2831.05LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1bb1.953e-2831.96LIM homeobox transcription factor 1 beta [Source:N... [more]
lmx1bb3.890e-2831.96LIM homeobox transcription factor 1 beta [Source:N... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo4b1.480e-1632.52LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
lmo24.791e-1431.01LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo21.935e-1331.01LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
ENSPMAT00000002189.13.258e-622.81pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gen... [more]
ENSPMAT00000006267.15.718e-625.20pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 g... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433541.568e-2527.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LHX13.232e-2429.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460738.704e-2227.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343705.643e-1826.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373165.011e-1533.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1a2.481e-2931.02LIM homeobox transcription factor 1-alpha-like [So... [more]
lmx1ba2.832e-2830.56LIM/homeobox protein LMX-1.2-like [Source:NCBI gen... [more]
lmx1al4.718e-2831.08LIM homeobox transcription factor 1-alpha [Source:... [more]
lmx1bb1.181e-2731.96LIM homeobox transcription factor 1 beta [Source:N... [more]
lhx42.838e-2629.90LIM homeobox 4 [Source:NCBI gene;Acc:101165225][more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020988.10.000e+099.53SMESG000020988.1[more]
SMESG000005304.11.079e-5437.50SMESG000005304.1[more]
SMESG000071273.17.837e-2126.70SMESG000071273.1[more]
SMESG000001774.14.653e-1824.27SMESG000001774.1[more]
SMESG000039808.11.982e-1724.51SMESG000039808.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029919 ID=SMED30029919|Name=LIM homeobox transcription factor 1-alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=2024bp
CTTATTTTAACAAATATTTGTTTGAATATATCTCAAGCCGATAGCCTTTA
ATATTGTAGACAATGGCTACTGGTGATACTTTACAGTCTAAAAGAATGGA
GTTTAATGATCAAAGTAATAATTGGATGTCTAATAATTCAGAAGCTTTTA
AAACCCCTACAGAAGAGCCCCACACAACAAAGAAAACCAAAAAGAAAATT
AAAATGGCTATTATTAATTGCAACATGTGCAATGATCTCATTAAAGAAAA
GCACTTATTTGTTATTGGTGATAGTTATTGGCATAAATCTTGTGTCAAAT
GTGATAGTTGTCAAATCCAATTAGATGAAACTTGTTTTTTAGTCAAAAAT
ACTTTATTATGCAGAAATTGTTACAACAAAAGTTCGTATGTGACCAAATG
TTTCGGTTGCAAGTTACCGATGCAAACTCACGAAGTCGCAATGTATAGTT
TAAATCAACCATATCACTTGTCATGTTTTAAATGCAATTATTGTAAAAAT
CTAATTTCTAAAGGGGATAAATTTATTATAAGCAACGGGTTTTTGATATG
TAAACAAGATTATGAGAATGGTCGAATCAACAATTCTACTGTTAGTCAGA
CTTCAAAGCCACAATCACACAAATCAGACAATCCACCGGAATCGAATGGT
GTAAGGCGTAAAACGAAAATCTCTACCGAACAAAGACAATATTTGGAAAA
TTTCTATTTAAAATATCAAAATCCCACAATCAAACAACGGGCTTATATTG
CCGATGAGTTAAGTTTACCAGTTAAAGTTGTCCAAACTTGGTTTTGTAAT
TATCGGACTAAAATGAAACTTCAAAGAAATAATGAAATAAAAATCTTCAA
TGAAAAATTGCAGATCGACGATAATGAGAGTGAGAACTCAGTTCAAGTGA
AAAATATGATCCAGCAACAGTGCTTCACACCGGATCAAGATTGTCCAACA
AATTGTCAAATCAGCCAATCAACTGAAGATCACACATCTCCACAAGACCT
CTCTTCGTCAGATATGTCCGGAATGTACAATTGTCCCGATCTCAAAGCTT
TTCCGCTTCGATCATCAAATGAGCCGCTATCAAATTCCGATCACCAGAAT
GAATCAATGGAGGACACTGGATTAACATATGCTGATCTGTCGAATTCATG
TGTGAAATCCATTAATCACTCGATTCTCGATGGTTATTCAGCAACACCAA
CTAATCACCCAAATGATTTCAGGACTCGGCCGTTTTCCAATGCGACTGCC
GCCACTATAAATTACAAACAGCAGACCACCAACAACAATCATGACGACAG
ATCCGATCATCGATCTAAATCAATATGCATGACATGGTCATAAATAGATA
TTACCAGAGGATTTCTGGTTTTTTTACTGCTTTGATTAAATTACCCAATC
ATCCATCACATACGCGCGCTACCCAATAATCATAAACCATATGATACCCA
ATTGTGATGAAGCTGCAATACTATTTCTACTTATCATTACCTTCACTCAG
TAAATAAATCAACCGGCAATACGGGATGAGATAATAGATGATGATTATAT
AGTATTATATTTGATGATGGTGATATATATATATATGTATGTACAAATAT
ATATTGCTTGTGTTTTTCATTAATTAATTGCTTTATGTTTTCTATTTTTG
GATAATTATTTTATCGGCAAGTTTGTTGCTATATATTTCCTATGTGTCTG
GTGGTAATCTGAGTGGTTCAAATATAATATTGTTTTTATGAGTCAATTCG
AGTCGGGCAGCTTTAATCTCAACTATGCATTTGTGATGTTTGATTTTTAT
TTCATGTGTGTGCGTGTGTACTGTTATGTTATTGAAATATCTATTTATCT
TGAATTGTTGAAAATTCATTTTTATTTTGTAGCCAAATTGATGCATGGCC
TATGTATTTCTGTACAGATTCATTCAAGTGTACTGCTTATTAATAATGGT
AATTTAAAATGGGAACGAGATGTATTTAAAAGTTTTACAAAAATATGATT
ATTACATTTTTTTTTGTTTTTATG
back to top

protein sequence of SMED30029919-orf-1

>SMED30029919-orf-1 ID=SMED30029919-orf-1|Name=SMED30029919-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=427bp
MATGDTLQSKRMEFNDQSNNWMSNNSEAFKTPTEEPHTTKKTKKKIKMAI
INCNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVKNTLLC
RNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISK
GDKFIISNGFLICKQDYENGRINNSTVSQTSKPQSHKSDNPPESNGVRRK
TKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTK
MKLQRNNEIKIFNEKLQIDDNESENSVQVKNMIQQQCFTPDQDCPTNCQI
SQSTEDHTSPQDLSSSDMSGMYNCPDLKAFPLRSSNEPLSNSDHQNESME
DTGLTYADLSNSCVKSINHSILDGYSATPTNHPNDFRTRPFSNATAATIN
YKQQTTNNNHDDRSDHRSKSICMTWS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0001558regulation of cell growth
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007411axon guidance
GO:0007417central nervous system development
GO:0007420brain development
GO:0007613memory
GO:0007626locomotory behavior
GO:0010468regulation of gene expression
GO:0021542dentate gyrus development
GO:0021549cerebellum development
GO:0021766hippocampus development
GO:0021953central nervous system neuron differentiation
GO:0030182neuron differentiation
GO:0030901midbrain development
GO:0042048olfactory behavior
GO:0045665negative regulation of neuron differentiation
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0050808synapse organization
GO:0071542dopaminergic neuron differentiation
GO:0090263positive regulation of canonical Wnt signaling pathway
GO:1904948midbrain dopaminergic neuron differentiation
GO:1905426positive regulation of Wnt-mediated midbrain dopaminergic neuron differentiation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 196..258
e-value: 2.4E-15
score: 67.0
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 198..252
e-value: 8.5E-15
score: 54.3
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 194..254
score: 14.074
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 198..255
e-value: 2.28409E-14
score: 65.3424
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 112..166
e-value: 6.8E-9
score: 45.5
coord: 52..103
e-value: 1.4E-8
score: 44.5
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 113..169
e-value: 5.9E-11
score: 42.4
coord: 53..106
e-value: 3.4E-10
score: 40.0
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 113..148
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 51..110
score: 11.613
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 111..173
score: 11.93
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 5..172
e-value: 1.2E-30
score: 108.4
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 173..253
e-value: 2.3E-16
score: 61.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 398..426
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..202
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..191
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 45..355
NoneNo IPR availableCDDcd08368LIMcoord: 53..104
e-value: 9.23356E-10
score: 51.9347
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 79..145
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 229..252
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 190..256