G-patch domain-containing protein

Overview
NameG-patch domain-containing protein
Smed IDSMED30029912
Length (bp)1081
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G-patch domain-containing protein (SMED30029912) t-SNE clustered cells

Violin plots show distribution of expression levels for G-patch domain-containing protein (SMED30029912) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G-patch domain-containing protein (SMED30029912) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G-patch domain-containing protein (SMED30029912) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029912

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029912h1SMcG0003467 SmedASXL_012856SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029912h1SMcG0003467 SmedASXL_012856SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G-patch domain-containing protein vs. Ensembl Human
Match: GPKOW (G-patch domain and KOW motifs [Source:HGNC Symbol;Acc:HGNC:30677])

HSP 1 Score: 53.9138 bits (128), Expect = 2.144e-7
Identity = 23/55 (41.82%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSML 865
            +W+   L VR +D  Y+ G+Y N  ++I+DVL PD C C T    VL  +R+ ML
Sbjct:  356 HWLHRDLRVRFVDNMYKGGQYYNTKMIIEDVLSPDTCVCRTDEGRVLEGLREDML 410          
BLAST of G-patch domain-containing protein vs. Ensembl Zebrafish
Match: gpkow (G patch domain and KOW motifs [Source:NCBI gene;Acc:368735])

HSP 1 Score: 53.1434 bits (126), Expect = 2.656e-7
Identity = 23/60 (38.33%), Postives = 35/60 (58.33%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
            +W+   L VR ID +++ G+Y N  + ++DVL P  C C T    +L D+RQ ML  + P
Sbjct:  388 SWLQRDLRVRFIDKAFKGGKYYNSKMRVEDVLTPHTCVCRTEEGRMLDDIRQKMLETIVP 447          
BLAST of G-patch domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000032061.1 (G-patch domain and KOW motifs [Source:NCBI gene;Acc:496860])

HSP 1 Score: 59.6918 bits (143), Expect = 3.392e-9
Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
             W+   L VR ID +Y+ G+Y N  + I+DVL P  CSC T +  +L D+RQ ML  + P
Sbjct:  380 GWLHRDLRVRFIDKNYKGGKYYNSKMFIEDVLSPTRCSCRTESGRILDDMRQDMLETIIP 439          
BLAST of G-patch domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000017333.1 (G-patch domain and KOW motifs [Source:NCBI gene;Acc:496860])

HSP 1 Score: 59.3066 bits (142), Expect = 3.557e-9
Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
             W+   L VR ID +Y+ G+Y N  + I+DVL P  CSC T +  +L D+RQ ML  + P
Sbjct:  341 GWLHRDLRVRFIDKNYKGGKYYNSKMFIEDVLSPTRCSCRTESGRILDDMRQDMLETIIP 400          
BLAST of G-patch domain-containing protein vs. Ensembl Mouse
Match: Gpkow (G patch domain and KOW motifs [Source:MGI Symbol;Acc:MGI:1859610])

HSP 1 Score: 60.8474 bits (146), Expect = 1.470e-10
Identity = 54/187 (28.88%), Postives = 79/187 (42.25%), Query Frame = 2
Query:  446 PEQILINDLVVINNGKFSGYIGKVIYLSGDSDLVRVYVE------------------ELQKEVNVRSAAVEAISNDEINIGGNSKVXXXXXXXXXXXXDRVVD----------NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQPIRKQH-AKVLGGPH 919
            P+ ++    VV+ +G + G  GKV  L  D D VR  V                   E Q      +++++A  N E +     K          + +D  V           +W+   L VR ID  +++GRY N  + I+DVL PD C C T    VL DVR+ ML  + P  + H   V+ GPH
Sbjct:    5 PQGLMHGRAVVVLSGPYRGLYGKVEGL--DPDNVRAMVRLAVGNRIVTVSHVSQTSTEQQNRATGTASSLKAAQNQE-DSKRRQKGSEKKRKHSPDRQDGPVPKTEKAAPRNKHWLHRDLRVRFIDKLHKSGRYYNTKMTIEDVLSPDTCVCRTDEGRVLEDVREDMLETLIPKGEGHRVMVVLGPH 188          
BLAST of G-patch domain-containing protein vs. Ensembl Mouse
Match: Gpkow (G patch domain and KOW motifs [Source:MGI Symbol;Acc:MGI:1859610])

HSP 1 Score: 61.6178 bits (148), Expect = 6.392e-10
Identity = 32/77 (41.56%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQPIRKQH-AKVLGGPHLSR 928
            +W+   L VR ID  +++GRY N  + I+DVL PD C C T    VL DVR+ ML  + P  + H   V+ GPH  +
Sbjct:  368 HWLHRDLRVRFIDKLHKSGRYYNTKMTIEDVLSPDTCVCRTDEGRVLEDVREDMLETLIPKGEGHRVMVVLGPHAGK 444          
BLAST of G-patch domain-containing protein vs. UniProt/SwissProt
Match: sp|Q56A08|GPKOW_MOUSE (G-patch domain and KOW motifs-containing protein OS=Mus musculus OX=10090 GN=Gpkow PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 4.471e-9
Identity = 32/77 (41.56%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQPIRKQH-AKVLGGPHLSR 928
            +W+   L VR ID  +++GRY N  + I+DVL PD C C T    VL DVR+ ML  + P  + H   V+ GPH  +
Sbjct:  368 HWLHRDLRVRFIDKLHKSGRYYNTKMTIEDVLSPDTCVCRTDEGRVLEDVREDMLETLIPKGEGHRVMVVLGPHAGK 444          
BLAST of G-patch domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NU07|GPKOW_XENLA (G-patch domain and KOW motifs-containing protein OS=Xenopus laevis OX=8355 GN=gpkow PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.673e-7
Identity = 24/60 (40.00%), Postives = 36/60 (60.00%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
             W+   + VR ID +Y+ G+Y N  ++++DVL P  C C T N  +L D+RQ ML  + P
Sbjct:  369 GWLRRDIRVRFIDKNYKGGKYYNSKMLVEDVLSPTRCVCRTENGCILEDIRQDMLETIIP 428          
BLAST of G-patch domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92917|GPKOW_HUMAN (G-patch domain and KOW motifs-containing protein OS=Homo sapiens OX=9606 GN=GPKOW PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 1.030e-6
Identity = 23/55 (41.82%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSML 865
            +W+   L VR +D  Y+ G+Y N  ++I+DVL PD C C T    VL  +R+ ML
Sbjct:  356 HWLHRDLRVRFVDNMYKGGQYYNTKMIIEDVLSPDTCVCRTDEGRVLEGLREDML 410          
BLAST of G-patch domain-containing protein vs. UniProt/SwissProt
Match: sp|Q90X38|GPKOW_DANRE (G-patch domain and KOW motifs-containing protein OS=Danio rerio OX=7955 GN=gpkow PE=2 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 2.041e-6
Identity = 23/60 (38.33%), Postives = 35/60 (58.33%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
            +W+   L VR ID +++ G+Y N  + ++DVL P  C C T    +L D+RQ ML  + P
Sbjct:  388 SWLQRDLRVRFIDKAFKGGKYYNSKMRVEDVLTPHTCVCRTEEGRMLDDIRQKMLETIVP 447          
BLAST of G-patch domain-containing protein vs. TrEMBL
Match: F6XU64 (G-patch domain and KOW motifs-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Gpkow PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.047e-7
Identity = 54/187 (28.88%), Postives = 79/187 (42.25%), Query Frame = 2
Query:  446 PEQILINDLVVINNGKFSGYIGKVIYLSGDSDLVRVYVE------------------ELQKEVNVRSAAVEAISNDEINIGGNSKVXXXXXXXXXXXXDRVVD----------NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQPIRKQH-AKVLGGPH 919
            P+ ++    VV+ +G + G  GKV  L  D D VR  V                   E Q      +++++A  N E +     K          + +D  V           +W+   L VR ID  +++GRY N  + I+DVL PD C C T    VL DVR+ ML  + P  + H   V+ GPH
Sbjct:    5 PQGLMHGRAVVVLSGPYRGLYGKVEGL--DPDNVRAMVRLAVGNRIVTVSHVSQTSTEQQNRATGTASSLKAAQNQE-DSKRRQKGSEKKRKHSPDRQDGPVPKTEKAAPRNKHWLHRDLRVRFIDKLHKSGRYYNTKMTIEDVLSPDTCVCRTDEGRVLEDVREDMLETLIPKGEGHRVMVVLGPH 188          
BLAST of G-patch domain-containing protein vs. TrEMBL
Match: A0A1A6HSE8 (G-patch domain-containing protein OS=Neotoma lepida OX=56216 GN=A6R68_20666 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.965e-6
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQPIRK-QHAKVLGGPHLSR 928
            +W+   L VR ID  ++ GRY N  + I+DVL PD C C T    VL  VR+ ML  + P  +  H  V+ GPH  +
Sbjct:  368 HWLHRDLRVRFIDKLHKGGRYYNTKMTIEDVLSPDTCVCRTDEGRVLEGVREGMLETLIPKEEGHHVMVVLGPHAGK 444          
BLAST of G-patch domain-containing protein vs. TrEMBL
Match: A0A5G3JBT6 (G-patch domain and KOW motifs OS=Xenopus tropicalis OX=8364 GN=gpkow PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 5.326e-6
Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
             W+   L VR ID +Y+ G+Y N  + I+DVL P  CSC T +  +L D+RQ ML  + P
Sbjct:  380 GWLHRDLRVRFIDKNYKGGKYYNSKMFIEDVLSPTRCSCRTESGRILDDMRQDMLETIIP 439          
BLAST of G-patch domain-containing protein vs. TrEMBL
Match: A0A5G3JAH1 (G-patch domain and KOW motifs OS=Xenopus tropicalis OX=8364 GN=gpkow PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 5.585e-6
Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
             W+   L VR ID +Y+ G+Y N  + I+DVL P  CSC T +  +L D+RQ ML  + P
Sbjct:  341 GWLHRDLRVRFIDKNYKGGKYYNSKMFIEDVLSPTRCSCRTESGRILDDMRQDMLETIIP 400          
BLAST of G-patch domain-containing protein vs. TrEMBL
Match: C3Z963 (G-patch domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_174745 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 5.827e-6
Identity = 28/59 (47.46%), Postives = 37/59 (62.71%), Query Frame = 2
Query:  704 WMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
            WM   L VR+ID  Y+NG+Y N  V IDDV   + C+C+T +  V+  V+QSML  V P
Sbjct:  361 WMRPQLRVRVIDKHYKNGKYYNAKVAIDDVTDAETCTCVTEDGRVIDGVKQSMLETVIP 419          
BLAST of G-patch domain-containing protein vs. Ensembl Sea Lamprey
Match: gpkow (G patch domain and KOW motifs [Source:NCBI gene;Acc:368735])

HSP 1 Score: 51.6026 bits (122), Expect = 1.775e-7
Identity = 22/59 (37.29%), Postives = 34/59 (57.63%), Query Frame = 2
Query:  704 WMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
            W+   L VR +D  Y+ G+Y N+ + +DDV+ P+ C C T    +L  + QSML  + P
Sbjct:  410 WLRRDLRVRFVDKFYKGGKYYNKKMTVDDVVTPEICVCRTEEGRILEGIEQSMLETIIP 468          
BLAST of G-patch domain-containing protein vs. Ensembl Nematostella
Match: EDO48178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK31])

HSP 1 Score: 53.9138 bits (128), Expect = 5.572e-8
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 2
Query:  704 WMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQPIRKQHA--KVLGGP 916
            W+   L VR+I   Y+ GRY N  V + DV+  +EC C T +  +L  V+QSML  V P +KQ A  +++ GP
Sbjct:  366 WLHPELRVRIISKDYKKGRYYNTKVKVVDVISRNECDCETEDGKLLEGVKQSMLETVVP-KKQDAYIRIVRGP 437          
BLAST of G-patch domain-containing protein vs. Ensembl Medaka
Match: gpkow (G-patch domain and KOW motifs [Source:NCBI gene;Acc:101167619])

HSP 1 Score: 50.8322 bits (120), Expect = 1.253e-6
Identity = 23/60 (38.33%), Postives = 35/60 (58.33%), Query Frame = 2
Query:  701 NWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQP 880
            +W+   L VR ID +++ GR+ N  + ++DVL P  C C T    +L DV+Q ML  + P
Sbjct:  394 SWLQRDLKVRFIDKAFKGGRFYNSKMQVEDVLTPFTCVCRTEEGRLLDDVKQDMLETIIP 453          
BLAST of G-patch domain-containing protein vs. Planmine SMEST
Match: SMESG000080913.1 (SMESG000080913.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 327/331 (98.79%), Postives = 329/331 (99.40%), Query Frame = 2
Query:   62 MISFSFNKKISDTKNKIIKQKEKVEFISSFSNDNAVVLPAKYPSNASCSYKRKRKCIMNKTDVKNFVTNDIENTSASESKDFLKSLLNTKMKLTENDNYDRTLKLFSNNSLCXXXXXXXXXXXXXXXXPEQILINDLVVINNGKFSGYIGKVIYLSGDSDLVRVYVEELQKEVNVRSAAVEAISNDEINIGGNSKVXXXXXXXXXXXXDRVVDNWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQPIRKQHAKVLGGPHLSRXXXXXXXXXXXXXXXXXNSEEKFAIDIRLLCRMSSYDHVGPA 1054
            MISFSFNKKISDTKNKIIKQKEKVE+IS FSNDNAVVLPAKYPSNASCSYKRKRKCIMNKTDVKNFVTNDIENTSASESKDFLKSLLNTKMKLTENDNYDRTLKLFSNNSLCKQKQNRKRRKGSSKKKPEQI+INDLVVINNGKFSGYIGKVIYLSGDSDLVRVYVEELQKEVNVRSAAVEAISNDEINIGGNSKVISPMESIEIEMEDRVVDNWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQ IRKQHAKVLGGPHLSRVVLVLAIDDLVATVVDVNSEEKFAIDIRLLCRMSSYDHVGPA
Sbjct:    1 MISFSFNKKISDTKNKIIKQKEKVEYISRFSNDNAVVLPAKYPSNASCSYKRKRKCIMNKTDVKNFVTNDIENTSASESKDFLKSLLNTKMKLTENDNYDRTLKLFSNNSLCKQKQNRKRRKGSSKKKPEQIVINDLVVINNGKFSGYIGKVIYLSGDSDLVRVYVEELQKEVNVRSAAVEAISNDEINIGGNSKVISPMESIEIEMEDRVVDNWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDECSCITSNKNVLYDVRQSMLIRVQLIRKQHAKVLGGPHLSRVVLVLAIDDLVATVVDVNSEEKFAIDIRLLCRMSSYDHVGPA 331          
The following BLAST results are available for this feature:
BLAST of G-patch domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GPKOW2.144e-741.82G-patch domain and KOW motifs [Source:HGNC Symbol;... [more]
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpkow2.656e-738.33G patch domain and KOW motifs [Source:NCBI gene;Ac... [more]
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000032061.13.392e-943.33G-patch domain and KOW motifs [Source:NCBI gene;Ac... [more]
ENSXETT00000017333.13.557e-943.33G-patch domain and KOW motifs [Source:NCBI gene;Ac... [more]
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gpkow1.470e-1028.88G patch domain and KOW motifs [Source:MGI Symbol;A... [more]
Gpkow6.392e-1041.56G patch domain and KOW motifs [Source:MGI Symbol;A... [more]
back to top
BLAST of G-patch domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q56A08|GPKOW_MOUSE4.471e-941.56G-patch domain and KOW motifs-containing protein O... [more]
sp|Q6NU07|GPKOW_XENLA1.673e-740.00G-patch domain and KOW motifs-containing protein O... [more]
sp|Q92917|GPKOW_HUMAN1.030e-641.82G-patch domain and KOW motifs-containing protein O... [more]
sp|Q90X38|GPKOW_DANRE2.041e-638.33G-patch domain and KOW motifs-containing protein O... [more]
back to top
BLAST of G-patch domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F6XU643.047e-728.88G-patch domain and KOW motifs-containing protein (... [more]
A0A1A6HSE81.965e-640.26G-patch domain-containing protein OS=Neotoma lepid... [more]
A0A5G3JBT65.326e-643.33G-patch domain and KOW motifs OS=Xenopus tropicali... [more]
A0A5G3JAH15.585e-643.33G-patch domain and KOW motifs OS=Xenopus tropicali... [more]
C3Z9635.827e-647.46G-patch domain-containing protein (Fragment) OS=Br... [more]
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpkow1.775e-737.29G patch domain and KOW motifs [Source:NCBI gene;Ac... [more]
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481785.572e-841.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G-patch domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpkow1.253e-638.33G-patch domain and KOW motifs [Source:NCBI gene;Ac... [more]
back to top
BLAST of G-patch domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000080913.10.000e+098.79SMESG000080913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029912 ID=SMED30029912|Name=G-patch domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1081bp
ATTTAATTTACTGAATTTTAAATTATTTTAAATAAAATTTAGTATTATAT
TATACAATAATATGATTTCATTTTCTTTCAATAAAAAAATTAGTGATACA
AAAAACAAAATTATAAAGCAGAAAGAAAAAGTCGAATTTATATCAAGTTT
TTCTAATGATAATGCTGTCGTGCTACCAGCAAAATATCCTTCAAATGCAT
CCTGTTCATATAAACGTAAAAGAAAATGTATTATGAATAAAACAGATGTA
AAGAATTTTGTAACTAATGACATTGAAAATACAAGTGCTTCAGAATCAAA
AGACTTTTTAAAGTCACTTTTAAATACAAAAATGAAGTTAACAGAAAACG
ACAACTATGATAGAACATTAAAGTTATTTTCAAATAATTCACTTTGCAAA
CAAAAACAAAATAGAAAACGGAGAAAAGGCTCATCGAAAAAGAAACCTGA
GCAAATTCTCATCAATGATTTAGTTGTAATTAACAATGGAAAATTTAGCG
GATATATCGGAAAGGTGATTTATTTGTCAGGTGATTCAGATTTGGTCCGT
GTTTATGTTGAAGAATTGCAAAAGGAAGTCAACGTGCGCTCAGCTGCTGT
TGAAGCGATTTCCAACGATGAAATCAATATCGGAGGAAATTCCAAAGTAA
TCTCACCAATGGAGTCGATTGAAATCGAAATGGAAGATCGGGTTGTCGAT
AATTGGATGTTTGTCGGTCTGTGTGTGAGATTAATCGATGGAAGTTATCA
GAACGGTAGATATGACAATGAAACCGTTGTCATTGACGATGTTCTGGGAC
CGGACGAGTGCTCGTGCATAACATCCAATAAAAATGTCCTTTACGATGTC
CGCCAATCAATGCTCATTCGAGTCCAGCCAATCAGAAAACAGCATGCAAA
AGTCCTCGGTGGTCCTCATTTGTCCCGTGTTGTACTTGTATTAGCAATCG
ATGATCTGGTAGCAACGGTTGTCGATGTAAATTCAGAGGAAAAGTTCGCC
ATTGACATCCGGTTGTTGTGTCGAATGAGTTCTTACGATCATGTTGGGCC
TGCGTGATAATAAATTGTTTTGTATTCTTTG
back to top

protein sequence of SMED30029912-orf-1

>SMED30029912-orf-1 ID=SMED30029912-orf-1|Name=SMED30029912-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=332bp
MISFSFNKKISDTKNKIIKQKEKVEFISSFSNDNAVVLPAKYPSNASCSY
KRKRKCIMNKTDVKNFVTNDIENTSASESKDFLKSLLNTKMKLTENDNYD
RTLKLFSNNSLCKQKQNRKRRKGSSKKKPEQILINDLVVINNGKFSGYIG
KVIYLSGDSDLVRVYVEELQKEVNVRSAAVEAISNDEINIGGNSKVISPM
ESIEIEMEDRVVDNWMFVGLCVRLIDGSYQNGRYDNETVVIDDVLGPDEC
SCITSNKNVLYDVRQSMLIRVQPIRKQHAKVLGGPHLSRVVLVLAIDDLV
ATVVDVNSEEKFAIDIRLLCRMSSYDHVGPA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR005824KOW
IPR008991Translation_prot_SH3-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0003676nucleic acid binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR15818:SF2G-PATCH DOMAIN AND KOW MOTIFS-CONTAINING PROTEINcoord: 115..297
NoneNo IPR availablePANTHERPTHR15818G PATCH AND KOW-CONTAININGcoord: 115..297
IPR008991Translation protein SH3-like domain superfamilySUPERFAMILYSSF50104Translation proteins SH3-like domaincoord: 124..175