Pre-mRNA-processing factor 40

Overview
NamePre-mRNA-processing factor 40
Smed IDSMED30029911
Length (bp)2474
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-processing factor 40 (SMED30029911) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-processing factor 40 (SMED30029911) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-processing factor 40 (SMED30029911) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-processing factor 40 (SMED30029911) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029911

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029911SMESG000044274.1 SmedASXL_015298SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029911SMESG000044274.1 SmedASXL_015298SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30029911SMESG000044274.1 dd_Smed_v4_1909_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029911SMESG000044274.1 dd_Smed_v4_1909_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029911SMESG000044274.1 dd_Smed_v4_1909_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029911SMESG000044274.1 dd_Smed_v4_1909_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029911SMESG000044274.1 dd_Smed_v4_1909_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029911SMESG000044274.1 dd_Smed_v4_1909_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029911SMESG000044274.1 dd_Smed_v6_1909_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Human
Match: PRPF40A (pre-mRNA processing factor 40 homolog A [Source:HGNC Symbol;Acc:HGNC:16463])

HSP 1 Score: 370.933 bits (951), Expect = 3.928e-114
Identity = 207/415 (49.88%), Postives = 292/415 (70.36%), Query Frame = 1
Query:  616 PIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYL 1854
            P  +   + TKEE ++ ++ +LKE  VP NA+WE A+KMI  DPRY  L K ++KKQ FN YK Q +K+E+EEAR + K+AKE  ++FL NH K++S   Y+KA+ +  +   W A+ ERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T+ TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F +F+DELHE G+L S+S W +LY  IS D RF  ML QPGST LDLFKFYV +LK+R+  EK+I+K+IL+D+ F  + NT+ E F+ +I   +R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK  +  I+    WE++ ++      F+ + LES+R + +K+++
Sbjct:  356 PAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFM 770          

HSP 2 Score: 122.865 bits (307), Expect = 6.149e-28
Identity = 65/140 (46.43%), Postives = 88/140 (62.86%), Query Frame = 1
Query:  148 LPP----TSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENN--TTDKPKESSAIDEAIKATLGSMPSS 549
            LPP      V     +  +  WTEH + DGRTYYYN  TKQSTWEKPD+LKTPAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E   Y N   + + I ++N     K +ESS  +E    +   +P++
Sbjct:   98 LPPGVNSMDVAAGTASGAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLE--GYQNTIVAGSLITKSNLHAMIKAEESSKQEECTTTSTAPVPTT 235          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Human
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:HGNC Symbol;Acc:HGNC:25031])

HSP 1 Score: 363.229 bits (931), Expect = 1.170e-111
Identity = 205/444 (46.17%), Postives = 302/444 (68.02%), Query Frame = 1
Query:  631 VVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSSREH 1956
            + +  +E+ ++ ++ +L++  VP NA+WE A+KM+  DPRY  L K ++KKQ FN YK QR+K+E+EEARLR K+AK+ L+ FL  H +++S   YR+A+    +   W  VPERDR+E+Y+D L  + K+EKE+AK LR+RNI+    ILD M ++ F+TTW +AQ+ L++NP F +D  LQ+MDKEDALICFEEHIR LE++ EEE+ER + R +R QRKNREAF  F+DELHE G+L S+S W +LY  +S D RF  ML QPGSTPLDLFKFYV ELK+RF  EK+I+K+IL+DR F  + NT+ E F  VI  D+R   LD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  F+ ML+     ++   +WEEV ++      F+ + LES+R++ ++E+L  + +  +   +    + RKH    K+    R H
Sbjct:  293 LSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRYRRAEQTFGELEVWAVVPERDRKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLETECQHLHT----KGRKHGRKGKKHHHKRSH 732          

HSP 2 Score: 102.834 bits (255), Expect = 1.008e-21
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  112 PLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL 426
            P+T +   P +    ++V  + P  P   W+EH+A DGR YYYN   KQS WEKP  LK+ AE +LS+CPWKE+KS+ GK YYYN  +++S W +P +L + E L
Sbjct:   94 PVT-AATAPGADTASSAVAGTGP--PRALWSEHVAPDGRIYYYNADDKQSVWEKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDDLEVL 195          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Human
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:HGNC Symbol;Acc:HGNC:25031])

HSP 1 Score: 361.688 bits (927), Expect = 2.596e-111
Identity = 205/444 (46.17%), Postives = 302/444 (68.02%), Query Frame = 1
Query:  631 VVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSSREH 1956
            + +  +E+ ++ ++ +L++  VP NA+WE A+KM+  DPRY  L K ++KKQ FN YK QR+K+E+EEARLR K+AK+ L+ FL  H +++S   YR+A+    +   W  VPERDR+E+Y+D L  + K+EKE+AK LR+RNI+    ILD M ++ F+TTW +AQ+ L++NP F +D  LQ+MDKEDALICFEEHIR LE++ EEE+ER + R +R QRKNREAF  F+DELHE G+L S+S W +LY  +S D RF  ML QPGSTPLDLFKFYV ELK+RF  EK+I+K+IL+DR F  + NT+ E F  VI  D+R   LD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  F+ ML+     ++   +WEEV ++      F+ + LES+R++ ++E+L  +    +++      + RKH    K+    R H
Sbjct:  271 LSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRYRRAEQTFGELEVWAVVPERDRKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVL---EQTECQHLHTKGRKHGRKGKKHHHKRSH 711          

HSP 2 Score: 102.834 bits (255), Expect = 1.002e-21
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  112 PLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL 426
            P+T +   P +    ++V  + P  P   W+EH+A DGR YYYN   KQS WEKP  LK+ AE +LS+CPWKE+KS+ GK YYYN  +++S W +P +L + E L
Sbjct:   72 PVT-AATAPGADTASSAVAGTGP--PRALWSEHVAPDGRIYYYNADDKQSVWEKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDDLEVL 173          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Human
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:HGNC Symbol;Acc:HGNC:25031])

HSP 1 Score: 347.436 bits (890), Expect = 5.475e-106
Identity = 202/444 (45.50%), Postives = 298/444 (67.12%), Query Frame = 1
Query:  631 VVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSSREH 1956
            + +  +E+ ++ ++ +L++  VP NA+WE A+KM+  DPRY  L K ++KKQ FN YK QR+K+E+EEARLR K+AK+ L+ FL  H +++S   YR+A+    +   W  VPERDR+E+Y+D L  + K+EKE+AK LR+RNI+    ILD M ++ F+TTW +AQ+ L++NP F +D  LQ+MDKEDALICFEEHIR LE++ EEE+ER + R +R QRKNREAF  F+DELHE G+L S+S W +LY  +S D RF  ML QPGSTPLDLFKFYV ELK+RF  EK+I+K+IL+        NT+ E F  VI  D+R   LD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  F+ ML+     ++   +WEEV ++      F+ + LES+R++ ++E+L  +    +++      + RKH    K+    R H
Sbjct:  265 LSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRYRRAEQTFGELEVWAVVPERDRKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILK-------VNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVL---EQTECQHLHTKGRKHGRKGKKHHHKRSH 698          

HSP 2 Score: 102.834 bits (255), Expect = 1.058e-21
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  112 PLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL 426
            P+T +   P +    ++V  + P  P   W+EH+A DGR YYYN   KQS WEKP  LK+ AE +LS+CPWKE+KS+ GK YYYN  +++S W +P +L + E L
Sbjct:   66 PVT-AATAPGADTASSAVAGTGP--PRALWSEHVAPDGRIYYYNADDKQSVWEKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDDLEVL 167          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Human
Match: PRPF40A (pre-mRNA processing factor 40 homolog A [Source:HGNC Symbol;Acc:HGNC:16463])

HSP 1 Score: 117.857 bits (294), Expect = 4.820e-28
Identity = 54/97 (55.67%), Postives = 68/97 (70.10%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKP 489
            WTEH + DGRTYYYN  TKQSTWEKPD+LKTPAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E +      +   E    +T   P
Sbjct:  139 WTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLEAMIKAEESSKQEECTTTSTAPVP 235          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Celegans
Match: ZK1098.1 (WW domain-containing protein ZK1098.1 [Source:UniProtKB/Swiss-Prot;Acc:P34600])

HSP 1 Score: 392.504 bits (1007), Expect = 5.339e-125
Identity = 242/616 (39.29%), Postives = 361/616 (58.60%), Query Frame = 1
Query:   91 NYQFTLPPLTHSYPVPTSYLPPTSV---QNSLPTLP--------------------EQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECP----WKEFKSEQGKIYYYNTVTQQSVWQKPP--ELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEY 1851
            N +F +PP+     VP   +P  SV     + PT P                    E  W+ H  + G  YY+N +TKQ++W KPD LKTP E+  S  P    WKEF S+ GK YYYNT+T+++ W KP   E+ + E+       T D  +       + K  S +D+A+KATL SMP+        ++ S  DEV          ++  R  E   E  R    +  +  N  W+ AVK I  DPR++ L K ++KKQ+FN +K QR K+ER+E RL IKK+KEDLEKFL  H K+  ++ Y+KA  + S  P W AV + DR+EI+ D +  + +R+KE+ +  RKR+I  F+ +L  M  +T+KTTW +AQRIL ENP+F E +DL  MDKEDAL  FE+HI+  EK+H+EEKE+E++RL+R QRK RE + + ++ LH++G+LTS+S+W  L+ IIS D RF  ML QPGS+PLDLFKF+V +LK ++++++R++KEIL ++       T    F   +   E+G  +D GN+++ Y SLIE+AES  K   KE L+++++ E  F+ +LK H++     W  +  K+   + +  +E + +R   +  Y
Sbjct:   25 NQRFGMPPVGSIAQVPLLQMPTHSVVAPHVAAPTRPSPMLVPPGMGIDESHSSPSVESDWSVHTNEKGTPYYHNRVTKQTSWIKPDVLKTPLERSTSGQPQQGQWKEFMSDDGKPYYYNTLTKKTQWVKPDGEEITKGEQKPAAKAATVDT-VALAAAVQQKKAESDLDKAMKATLASMPNVPLPSEKKEEESVNDEV----------ELKKRQSERFRELLRDKYNDGKITTNCNWDQAVKWIQNDPRFRILNKVSEKKQLFNAWKVQRGKEERDEKRLAIKKSKEDLEKFLQEHPKMKESLKYQKASDIFSKEPLWIAVNDEDRKEIFRDCIDFVARRDKEKKEEDRKRDIAAFSHVLQSMEQITYKTTWAQAQRILYENPQFAERKDLHFMDKEDALTVFEDHIKQAEKEHDEEKEQEEKRLRRQQRKVREEYRLLLESLHKRGELTSMSLWTSLFPIISTDTRFELMLFQPGSSPLDLFKFFVEDLKEQYTEDRRLIKEILTEKGCQVIATTEYREFSDWVVSHEKGGKVDHGNMKLCYNSLIEKAESKAKDEEKESLRRKRRLESEFRNLLKEHNVDKDSEWTVIKPKIEKDKAYLAMENDDERETAFNHY 629          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Celegans
Match: ZK1098.1 (WW domain-containing protein ZK1098.1 [Source:UniProtKB/Swiss-Prot;Acc:P34600])

HSP 1 Score: 226.483 bits (576), Expect = 5.097e-66
Identity = 132/310 (42.58%), Postives = 208/310 (67.10%), Query Frame = 1
Query:  898 LSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHDIKSSVSWEEVCQKLGNLEDFKFVELESD 1827
            +  ++ Y+KA  + S  P W AV + DR+EI+ D +  + +R+KE+ +  RKR+I  F+ +L  M  +T+KTTW +AQRIL ENP+F E +DL  MDKEDAL  FE+HI+  EK+H+EEKE+E++RL+R QRK RE + + ++ LH++G+LTS+S+W  L+ IIS D RF  ML QPGS+PLDLFKF+V +LK ++++++R++KEIL ++       T    F   +   E+G  +D GN+++ Y SLIE+AES  K   KE L+++++ E  F+ +LK H++     W  +  K+   +D  ++ +E+D
Sbjct:    1 MKESLKYQKASDIFSKEPLWIAVNDEDRKEIFRDCIDFVARRDKEKKEEDRKRDIAAFSHVLQSMEQITYKTTWAQAQRILYENPQFAERKDLHFMDKEDALTVFEDHIKQAEKEHDEEKEQEEKRLRRQQRKVREEYRLLLESLHKRGELTSMSLWTSLFPIISTDTRFELMLFQPGSSPLDLFKFFVEDLKEQYTEDRRLIKEILTEKGCQVIATTEYREFSDWVVSHEKGGKVDHGNMKLCYNSLIEKAESKAKDEEKESLRRKRRLESEFRNLLKEHNVDKDSEWTVIKPKIE--KDKAYLAMEND 308          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Celegans
Match: tcer-1 (TransCription Elongation Regulator homolog [Source:UniProtKB/TrEMBL;Acc:Q95PX9])

HSP 1 Score: 71.633 bits (174), Expect = 1.546e-12
Identity = 77/303 (25.41%), Postives = 140/303 (46.20%), Query Frame = 1
Query:  307 LSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL-AYGNNDTSDNEINENNTTDK-------------PKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEE---GWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFV 1161
            +S  PW    +   K+++YN  T+ SVW++PP+    E +     N  S     ENN + K             PK   +  E  K  L    ++  K         +  V+PA    + +    R K  LEE    ++ +L+E NV  ++T+E  +  I  D RY  L    +++  F+ +  ++ + E+ E R R+K+AKE+ +K L+   +L+    Y    S     P + AV   RDR + + D + ++ K+EK+E +  +++    F ++L+    LT K+ W   ++ L +  R++
Sbjct:  124 VSGTPWCVVWTGDDKVFFYNPSTKCSVWERPPDTYGREDVDKLVQNPPSPKAEEENNQSKKESESESESDEDGPPKAKKSRAEKKKEAL---IAAQKKEKERPRQMLQKPVDPAIEAEM-QAAKEREKVPLEERLKQFKEMLEEKNVSTSSTFEKELSKIVFDKRYLSLG-ATERRACFDAFCREKIESEKAERRKRVKEAKEEFQK-LLAECELNGRSSYSSFTSKFGKDPRYKAVERNRDREDAFNDFVGELHKKEKDEKRAKKEKLKAAFVKLLEEQTGLTRKSKWSTTKKTLEDEERYI 420          

HSP 2 Score: 49.6766 bits (117), Expect = 7.963e-6
Identity = 20/40 (50.00%), Postives = 26/40 (65.00%), Query Frame = 1
Query:  166 QNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDEL 285
               +P  P+ AW E  A DGR YY+N IT+++TWEKP  L
Sbjct:    3 HGQIPQNPDDAWNEFNAPDGRKYYFNSITQENTWEKPKAL 42          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Celegans
Match: tcer-1 (TransCription Elongation Regulator homolog [Source:UniProtKB/TrEMBL;Acc:Q95PX9])

HSP 1 Score: 71.633 bits (174), Expect = 1.546e-12
Identity = 77/303 (25.41%), Postives = 140/303 (46.20%), Query Frame = 1
Query:  307 LSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL-AYGNNDTSDNEINENNTTDK-------------PKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEE---GWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFV 1161
            +S  PW    +   K+++YN  T+ SVW++PP+    E +     N  S     ENN + K             PK   +  E  K  L    ++  K         +  V+PA    + +    R K  LEE    ++ +L+E NV  ++T+E  +  I  D RY  L    +++  F+ +  ++ + E+ E R R+K+AKE+ +K L+   +L+    Y    S     P + AV   RDR + + D + ++ K+EK+E +  +++    F ++L+    LT K+ W   ++ L +  R++
Sbjct:  124 VSGTPWCVVWTGDDKVFFYNPSTKCSVWERPPDTYGREDVDKLVQNPPSPKAEEENNQSKKESESESESDEDGPPKAKKSRAEKKKEAL---IAAQKKEKERPRQMLQKPVDPAIEAEM-QAAKEREKVPLEERLKQFKEMLEEKNVSTSSTFEKELSKIVFDKRYLSLG-ATERRACFDAFCREKIESEKAERRKRVKEAKEEFQK-LLAECELNGRSSYSSFTSKFGKDPRYKAVERNRDREDAFNDFVGELHKKEKDEKRAKKEKLKAAFVKLLEEQTGLTRKSKWSTTKKTLEDEERYI 420          

HSP 2 Score: 49.6766 bits (117), Expect = 7.963e-6
Identity = 20/40 (50.00%), Postives = 26/40 (65.00%), Query Frame = 1
Query:  166 QNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDEL 285
               +P  P+ AW E  A DGR YY+N IT+++TWEKP  L
Sbjct:    3 HGQIPQNPDDAWNEFNAPDGRKYYFNSITQENTWEKPKAL 42          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Celegans
Match: tcer-1 (TransCription Elongation Regulator homolog [Source:UniProtKB/TrEMBL;Acc:Q95PX9])

HSP 1 Score: 71.633 bits (174), Expect = 1.546e-12
Identity = 77/303 (25.41%), Postives = 140/303 (46.20%), Query Frame = 1
Query:  307 LSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL-AYGNNDTSDNEINENNTTDK-------------PKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEE---GWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFV 1161
            +S  PW    +   K+++YN  T+ SVW++PP+    E +     N  S     ENN + K             PK   +  E  K  L    ++  K         +  V+PA    + +    R K  LEE    ++ +L+E NV  ++T+E  +  I  D RY  L    +++  F+ +  ++ + E+ E R R+K+AKE+ +K L+   +L+    Y    S     P + AV   RDR + + D + ++ K+EK+E +  +++    F ++L+    LT K+ W   ++ L +  R++
Sbjct:  124 VSGTPWCVVWTGDDKVFFYNPSTKCSVWERPPDTYGREDVDKLVQNPPSPKAEEENNQSKKESESESESDEDGPPKAKKSRAEKKKEAL---IAAQKKEKERPRQMLQKPVDPAIEAEM-QAAKEREKVPLEERLKQFKEMLEEKNVSTSSTFEKELSKIVFDKRYLSLG-ATERRACFDAFCREKIESEKAERRKRVKEAKEEFQK-LLAECELNGRSSYSSFTSKFGKDPRYKAVERNRDREDAFNDFVGELHKKEKDEKRAKKEKLKAAFVKLLEEQTGLTRKSKWSTTKKTLEDEERYI 420          

HSP 2 Score: 49.6766 bits (117), Expect = 7.963e-6
Identity = 20/40 (50.00%), Postives = 26/40 (65.00%), Query Frame = 1
Query:  166 QNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDEL 285
               +P  P+ AW E  A DGR YY+N IT+++TWEKP  L
Sbjct:    3 HGQIPQNPDDAWNEFNAPDGRKYYFNSITQENTWEKPKAL 42          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Fly
Match: CG3542 (gene:FBgn0031492 transcript:FBtr0077648)

HSP 1 Score: 451.055 bits (1159), Expect = 2.749e-146
Identity = 263/590 (44.58%), Postives = 371/590 (62.88%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNND----------TSDN---------------------------EINENNTTDKPKESS-AIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYL 1854
            WTEH A DGR YYYN  TKQS+WEKP+ L TPAE + ++CPWKE++S+ GK+YY+N  T+++ W+ PPE  + +  A               TS +                           EI+   T    + SS A+D+A+ ATL ++     + N+ KD  SE              VV++ K E  E ++ +L++ NVP NA W+  VK+IS DPRY   K  N++KQ FN YKTQ+ KDEREE+RL+ KKAKEDLE+FLM+  K++S + Y + + + +    WTAVPE DRR+IYED +  + KREKEEA++L+KRN+K+  E+L+ M ++   TTW EAQ +LL+N  F  D  L  MDKEDALI FEEHIR LEK+ +EE+EREK+R+KR QRKNR++F   +D LHE+GKLTS+S+W +LY IIS D RF  ML Q GSTPLDLFKFYV  LK+RF  EK+I++EIL+++ F     TS E F  V+  D+R  +LD GNV++ Y SL+E+AE+IEK+R+KE +++ +K E   K      ++  +  +E   + + +LE F   E E    K +++++
Sbjct:   56 WTEHKAPDGRPYYYNQNTKQSSWEKPEALMTPAELLHNQCPWKEYRSDTGKVYYHNVATKETCWEPPPEYVDMKAKAKAEEAAAAAKAVAAMTSSSLAGMVPPAALASILPAALPVAPRLPTPEIHSPLTPSSNENSSSAMDQAMAATLAAI--EVPQQNAKKDDKSES------------AVVFKDKREAIESFKELLRDRNVPSNANWDQCVKIISKDPRYAAFKNLNERKQTFNAYKTQKIKDEREESRLKAKKAKEDLEQFLMSSDKMNSQMKYFRCEEVFAGTRTWTAVPEPDRRDIYEDCIFNLAKREKEEARLLKKRNMKVLGELLESMTSINHATTWSEAQVMLLDNVAFKNDVTLLGMDKEDALIVFEEHIRTLEKEEDEEREREKKRMKRQQRKNRDSFLALLDSLHEEGKLTSMSLWVELYPIISADLRFSAMLGQSGSTPLDLFKFYVENLKARFHDEKKIIREILKEKAFVVQAKTSFEDFATVVCEDKRSASLDAGNVKLTYNSLLEKAEAIEKERMKEEVRRLRKLENEIKNEWLEANVSVAEPYESAKKLVEHLEAFALYEKEIGVEKIWEDFV 631          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Fly
Match: CG42724 (gene:FBgn0261641 transcript:FBtr0334545)

HSP 1 Score: 65.855 bits (159), Expect = 1.522e-10
Identity = 74/327 (22.63%), Postives = 141/327 (43.12%), Query Frame = 1
Query:  307 LSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDK-PKESSAIDEAIKATLGSMPSSSDKVNSHK----------------------DSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRV------------------ILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNI-KLFNEILDVMPNLTFKTTWYEAQRILLENPRF 1158
            ++  PW    +   ++++YN  T+ SVW +P +L         N +  D  +NE     K P+E SA  E       +   +  +V + +                      +S S  E  P   + +  K        LE   R                   +L+E +V   +TWE  +  I  DPRY  L    ++KQ+F  Y   R ++ER+E R ++++ +ED  + LM  ++L     + +     +    + A+ + R+R  ++ + ++++ +REKE+ K+L+K  I K F ++L    ++   T WY+ ++    +PR+
Sbjct:  438 IAGTPWCVVWTGDSRVFFYNPSTRTSVWDRPEDLL--------NREDVDKAVNERPEQLKTPQEKSAEAEQKSGEEANQEQAKSQVQAQQLDQVQRVDADDDDDDEVIKIRTESESSVEEVPTKRVRMISKSKRAEDAALEAEQRAAKERALVPLEMRVTQFKEMLREKDVSAFSTWEKELHKIVFDPRYL-LLTSKERKQVFEKYVKDRAEEERKEKRNKMRQKREDF-RSLMEEARLHGKSSFSEFSQRNAKDERYRAIEKVRERESLFNEYIVEVRRREKED-KLLKKEQIRKDFLDMLRERHDIERHTRWYDIKKKFESDPRY 753          

HSP 2 Score: 50.0618 bits (118), Expect = 9.592e-6
Identity = 20/46 (43.48%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  181 TLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSEC 318
            T P + W E  A+DGR+YYY+ +T+++TW +PD    PA KI+++ 
Sbjct:  111 TGPPEIWVETKAEDGRSYYYHAVTRETTWSRPD---GPAVKIMTQA 153          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Fly
Match: CG42724 (gene:FBgn0261641 transcript:FBtr0303013)

HSP 1 Score: 65.855 bits (159), Expect = 1.522e-10
Identity = 74/327 (22.63%), Postives = 141/327 (43.12%), Query Frame = 1
Query:  307 LSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDK-PKESSAIDEAIKATLGSMPSSSDKVNSHK----------------------DSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRV------------------ILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNI-KLFNEILDVMPNLTFKTTWYEAQRILLENPRF 1158
            ++  PW    +   ++++YN  T+ SVW +P +L         N +  D  +NE     K P+E SA  E       +   +  +V + +                      +S S  E  P   + +  K        LE   R                   +L+E +V   +TWE  +  I  DPRY  L    ++KQ+F  Y   R ++ER+E R ++++ +ED  + LM  ++L     + +     +    + A+ + R+R  ++ + ++++ +REKE+ K+L+K  I K F ++L    ++   T WY+ ++    +PR+
Sbjct:  438 IAGTPWCVVWTGDSRVFFYNPSTRTSVWDRPEDLL--------NREDVDKAVNERPEQLKTPQEKSAEAEQKSGEEANQEQAKSQVQAQQLDQVQRVDADDDDDDEVIKIRTESESSVEEVPTKRVRMISKSKRAEDAALEAEQRAAKERALVPLEMRVTQFKEMLREKDVSAFSTWEKELHKIVFDPRYL-LLTSKERKQVFEKYVKDRAEEERKEKRNKMRQKREDF-RSLMEEARLHGKSSFSEFSQRNAKDERYRAIEKVRERESLFNEYIVEVRRREKED-KLLKKEQIRKDFLDMLRERHDIERHTRWYDIKKKFESDPRY 753          

HSP 2 Score: 50.0618 bits (118), Expect = 9.592e-6
Identity = 20/46 (43.48%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  181 TLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSEC 318
            T P + W E  A+DGR+YYY+ +T+++TW +PD    PA KI+++ 
Sbjct:  111 TGPPEIWVETKAEDGRSYYYHAVTRETTWSRPD---GPAVKIMTQA 153          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Zebrafish
Match: prpf40a (PRP40 pre-mRNA processing factor 40 homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-274])

HSP 1 Score: 471.47 bits (1212), Expect = 1.644e-153
Identity = 279/585 (47.69%), Postives = 392/585 (67.01%), Query Frame = 1
Query:  196 AWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGN-NDTSD----------NEINENNTTDKP---KESSAIDEAIKATLGSMPS-----SSD-KVNSHKDSSSEDEVNPAHNI-----PIPEKVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
             WTEH + DG+ YYYN  TKQSTWEKPDELK+PAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E +     N T+D             NE++ T  P    E++     I+     +P+     SSD  VNS +++ S  E  P++++     P   K VY+  TKEE ++ ++ +LKE  V  NA+WE A+K+I  DPRY  L K ++KKQ FN YK Q +K+E+EEAR++ K++KE  ++FL NH K++S   Y+KA+ +  D   W+ VPERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T++TTW EAQ+ LL+NP F EDE+LQ+MDKEDALICFEEHIR LEK+ E+EK++   R +R QRKNRE+F  F+DELH+ G+L S+S W ++Y  IS D RF  ML QPGSTPLDLFKFYV +LK+R+  EKRI+K+IL+D+ F  + NT  E F  VI  D+R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK  +  ++   +WE V ++      F+ + LES+R + +K+++  +
Sbjct:  111 VWTEHKSLDGKIYYYNTETKQSTWEKPDELKSPAEQMLSKCPWKEYKSDTGKPYYYNSQTKESRWTKPKELEDLEAMIKAEENGTADVVAPGTTPALTAQNESSVTVAPVAETEATMATGTIEEQPSHVPAQVAEVSSDVAVNSTEETPSV-ETQPSNDVSKEERPELVKKVYKWNTKEEAKQAFKELLKEKGVSSNASWEQAMKLIINDPRYSALPKLSEKKQAFNAYKVQTEKEEKEEARIKYKESKETFQRFLENHEKMTSTTRYKKAEQMFGDQEVWSCVPERDRLEIYEDVLFYLAKKEKEQAKQLRKRNWEALKNILDNMANVTYRTTWSEAQQYLLDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEDEKQKTLLRERRRQRKNRESFQKFLDELHDHGQLHSMSAWMEMYPTISADIRFSNMLGQPGSTPLDLFKFYVEDLKARYHDEKRIIKDILKDKGFLVEINTGFEDFGSVISSDKRATTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKEAAFKSMLKQATPPLEPEATWEGVRERFLKEPAFEDITLESERKRIFKDFMHVL 694          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Zebrafish
Match: CU929230.1 (transcription elongation regulator 1b (CA150) [Source:NCBI gene;Acc:797473])

HSP 1 Score: 77.411 bits (189), Expect = 4.828e-14
Identity = 98/397 (24.69%), Postives = 169/397 (42.57%), Query Frame = 1
Query:   55 IILNGIEISMSNNYQFTLPPLT-HSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELK------------------------------------TPAEKILSE------------------CPWKEFKSEQGKIYYYNTVTQQSVWQKPPEL-AEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDK--------VNSHKDSSSEDEVNPAHN---IPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAK 1041
            + L G+ I +        PPL    +P  T    P S+  ++P LPE  W+E    DGR YYYN  T +STWEKP ELK                                     P E+ ++E                   PW    +   +++YYN  T+ S+W +P EL   A+   Y         +++       KE   ID A++  L   PS + K          + KD + E E+  A +   +P+  ++           +R +L E  V   +TW+  +  I  DPRY  L    ++KQ+F+ Y   R ++ER+E + ++ ++K+D  + +M  +KL +   + +  +  S  P + A+ + +DR  ++ + +    K++KE++K
Sbjct:  307 VPLPGMHIPLPG----MGPPLVPMMHPQLTIAASPMSLAGAIP-LPE--WSEFKTADGRIYYYNNRTLESTWEKPFELKERDKDSDKARDIHNNINLDLKLIDMEAKADFGKSKELPREEDMTEEEKATQKGKPVATNPIPGTPWCVVWTGDERVFYYNPTTRLSMWDRPEELVGRADVDRYIQEPPHKRGLDDIKKIGFNKEE--IDTAMEDMLDDEPSKAKKRKKDDVKEPEAAKDVAVEAELKAARDRALVPLEARM---------NQFRDMLLERGVSAFSTWDKELHKIVFDPRYLLLNP-KERKQVFDQYVKTRAEEERKEKKNKLMQSKDDFRR-MMEDAKLHTRTTFSEFAAKHSKDPRFKAIEKMKDREVMFTEFMTAFRKKDKEDSK 683          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Zebrafish
Match: TCERG1L (transcription elongation regulator 1 like [Source:NCBI gene;Acc:110437752])

HSP 1 Score: 56.9954 bits (136), Expect = 6.994e-8
Identity = 59/261 (22.61%), Postives = 117/261 (44.83%), Query Frame = 1
Query:  274 PDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQ-MGKREKEEAKVLRK 1053
            P + +  A   +   PW    +   +++++N     SVW+KP +L +   L     D       ++++++        DE   +      S   K++   D   + +   +H + +P ++           +R +L E  V   +TWE  +  +  DPRY  L    Q+KQI++ +   R  +E +E + ++++AKE+ +K L+  SK++S   ++         P +  V +R  +E++    I  + KR+KE    LRK
Sbjct:  341 PKDKRPVASTPIPGSPWCVVWTGDDRVFFFNPTMHLSVWEKPVDLKDRGDLNRIIEDPPHKRKKDDDSSNSSSGDEEDDEEHNSK-----SKRYKLDHSVDCDEDGKNGSSHRMVLPLELRI-------AHFRDMLLERGVSAFSTWEKELHKVVFDPRYLLLNP-EQRKQIYDQFVKARMNEEHKEKKCKLQQAKEEYKK-LLEESKITSKSTFKDFSEKYGKDPRFKQVQKRKDQELFFSQFINTLKKRDKENRIRLRK 587          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Zebrafish
Match: arhgap12a (Rho GTPase activating protein 12a [Source:ZFIN;Acc:ZDB-GENE-050809-38])

HSP 1 Score: 50.447 bits (119), Expect = 6.786e-6
Identity = 26/71 (36.62%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKP---DELKTPAEKI-LSECPWKEFKSEQGKIYYYNTVTQQSVWQKP 399
            W  H  Q+GR YYYN  T++ TW+ P   D L    EK  +++  W     E+G++YYY+    +S W+ P
Sbjct:  207 WETHKDQNGRHYYYNRSTQERTWKPPRARDSLPRKEEKHDMTDTEWLRHTDERGRLYYYSADGSRSEWELP 277          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Xenopus
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:NCBI gene;Acc:100493450])

HSP 1 Score: 486.878 bits (1252), Expect = 1.267e-158
Identity = 291/605 (48.10%), Postives = 402/605 (66.45%), Query Frame = 1
Query:  124 SYPVPTSYLPPTSVQNSLPT--LPEQA--WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINEN-----------NTTDKPKESSA-----IDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPI-PEKVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            + P PT  +   +V+ S P   +P++   WTEH A DGRTYYYN  TKQSTWEKPDELK+ AE +LS+CPWKE+KS+ GK YYYN+ T++S W KP +L E E L     D S  +  ++           +T   P E  A     I E ++A+    P   + +   KD S+ + +     + + PEK  Y   TKEE ++ ++ +LK+  VP NATWE A+KMI  DPRY  L K ++KKQ FN YK QR+K+E+EE RLR K+AKE L++FL  H K++S   YRKA+ +  +   W+ VPERDR+EIY+D L  + K+EKE+AK LRKRN++    ILD M N++F+TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEKD  EEKER + R +R QRKNRE+F VF+DELHE G+L S+S W +LY  IS D RF  ML Q GSTPLDLFKFYV ELK+RF  EK+I+K+I++DRNF+ + NT+ E F  +I  D+R  TLD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  FK MLK     +++   W+EV ++      F  + +ES+R++ +KE++  I
Sbjct:  113 AQPAPT--VAKATVEESSPAQDIPKKKSLWTEHKAPDGRTYYYNSETKQSTWEKPDELKSKAEFLLSQCPWKEYKSDTGKSYYYNSQTKESRWTKPKDLDELEALIKQKEDVSAEQETQSAISSPSTAVSSDTEMTPTEEPAVAQPSIPEPVEASEVEAPQE-ETLQCQKDISNSEPLRIEDGVKVEPEKRSYNWSTKEEAKQFFKELLKDKGVPSNATWEQAMKMIINDPRYSALPKLSEKKQAFNAYKAQREKEEKEETRLRAKEAKEKLQRFLEQHEKMTSTTRYRKAEQMFGEQEVWSVVPERDRKEIYDDVLFFLAKKEKEQAKQLRKRNVQALKNILDNMTNVSFQTTWSEAQQYLMDNPMFAEDEELQNMDKEDALICFEEHIRALEKDEAEEKERTRLRERRQQRKNRESFQVFLDELHETGQLHSMSTWMELYPSISTDSRFANMLGQTGSTPLDLFKFYVEELKARFHDEKKIIKDIIKDRNFSVEVNTTFEDFAHIISFDKRAATLDAGNIKLTFNSLLEKAEARERERGKEEARKIRRKEAAFKSMLKQSVPPLETDSIWDEVRERFVGDPAFDQITVESERIRLFKEFVHAI 714          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Xenopus
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:NCBI gene;Acc:100493450])

HSP 1 Score: 486.108 bits (1250), Expect = 2.919e-158
Identity = 291/605 (48.10%), Postives = 402/605 (66.45%), Query Frame = 1
Query:  124 SYPVPTSYLPPTSVQNSLPT--LPEQA--WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINEN-----------NTTDKPKESSA-----IDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPI-PEKVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            + P PT  +   +V+ S P   +P++   WTEH A DGRTYYYN  TKQSTWEKPDELK+ AE +LS+CPWKE+KS+ GK YYYN+ T++S W KP +L E E L     D S  +  ++           +T   P E  A     I E ++A+    P   + +   KD S+ + +     + + PEK  Y   TKEE ++ ++ +LK+  VP NATWE A+KMI  DPRY  L K ++KKQ FN YK QR+K+E+EE RLR K+AKE L++FL  H K++S   YRKA+ +  +   W+ VPERDR+EIY+D L  + K+EKE+AK LRKRN++    ILD M N++F+TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEKD  EEKER + R +R QRKNRE+F VF+DELHE G+L S+S W +LY  IS D RF  ML Q GSTPLDLFKFYV ELK+RF  EK+I+K+I++DRNF+ + NT+ E F  +I  D+R  TLD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  FK MLK     +++   W+EV ++      F  + +ES+R++ +KE++  I
Sbjct:  121 AQPAPT--VAKATVEESSPAQDIPKKKSLWTEHKAPDGRTYYYNSETKQSTWEKPDELKSKAEFLLSQCPWKEYKSDTGKSYYYNSQTKESRWTKPKDLDELEALIKQKEDVSAEQETQSAISSPSTAVSSDTEMTPTEEPAVAQPSIPEPVEASEVEAPQE-ETLQCQKDISNSEPLRIEDGVKVEPEKRSYNWSTKEEAKQFFKELLKDKGVPSNATWEQAMKMIINDPRYSALPKLSEKKQAFNAYKAQREKEEKEETRLRAKEAKEKLQRFLEQHEKMTSTTRYRKAEQMFGEQEVWSVVPERDRKEIYDDVLFFLAKKEKEQAKQLRKRNVQALKNILDNMTNVSFQTTWSEAQQYLMDNPMFAEDEELQNMDKEDALICFEEHIRALEKDEAEEKERTRLRERRQQRKNRESFQVFLDELHETGQLHSMSTWMELYPSISTDSRFANMLGQTGSTPLDLFKFYVEELKARFHDEKKIIKDIIKDRNFSVEVNTTFEDFAHIISFDKRAATLDAGNIKLTFNSLLEKAEARERERGKEEARKIRRKEAAFKSMLKQSVPPLETDSIWDEVRERFVGDPAFDQITVESERIRLFKEFVHAI 722          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Xenopus
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:NCBI gene;Acc:100493450])

HSP 1 Score: 481.1 bits (1237), Expect = 5.138e-158
Identity = 289/611 (47.30%), Postives = 405/611 (66.28%), Query Frame = 1
Query:  106 LPPLTHSYPVPTSYLPPTSVQNSLPTLPE--------QAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAE-----------KLAYGNNDTSDNEINENNTTDKPKESS-AIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPI-PEKVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            +PPL     +PT  LP  +  ++  ++ +          WTEH A DGRTYYYN  TKQSTWEKPDELK+ AE +LS+CPWKE+KS+ GK YYYN+ T++S W KP +L E E           + A  +  T+ +   E   T++P  +  +I E ++A+    P   + +   KD S+ + +     + + PEK  Y   TKEE ++ ++ +LK+  VP NATWE A+KMI  DPRY  L K ++KKQ FN YK QR+K+E+EE RLR K+AKE L++FL  H K++S   YRKA+ +  +   W+ VPERDR+EIY+D L  + K+EKE+AK LRKRN++    ILD M N++F+TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEKD  EEKER + R +R QRKNRE+F VF+DELHE G+L S+S W +LY  IS D RF  ML Q GSTPLDLFKFYV ELK+RF  EK+I+K+I++DRNF+ + NT+ E F  +I  D+R  TLD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  FK MLK     +++   W+EV ++      F  + +ES+R++ +KE++  I
Sbjct:   63 VPPL-----MPTMMLPAVTSSSTTVSICDITSYSCFKSLWTEHKAPDGRTYYYNSETKQSTWEKPDELKSKAEFLLSQCPWKEYKSDTGKSYYYNSQTKESRWTKPKDLDELEGKGARLEEEKTQSAISSPSTAVSSDTEMTPTEEPAVAQPSIPEPVEASEVEAPQE-ETLQCQKDISNSEPLRIEDGVKVEPEKRSYNWSTKEEAKQFFKELLKDKGVPSNATWEQAMKMIINDPRYSALPKLSEKKQAFNAYKAQREKEEKEETRLRAKEAKEKLQRFLEQHEKMTSTTRYRKAEQMFGEQEVWSVVPERDRKEIYDDVLFFLAKKEKEQAKQLRKRNVQALKNILDNMTNVSFQTTWSEAQQYLMDNPMFAEDEELQNMDKEDALICFEEHIRALEKDEAEEKERTRLRERRQQRKNRESFQVFLDELHETGQLHSMSTWMELYPSISTDSRFANMLGQTGSTPLDLFKFYVEELKARFHDEKKIIKDIIKDRNFSVEVNTTFEDFAHIISFDKRAATLDAGNIKLTFNSLLEKAEARERERGKEEARKIRRKEAAFKSMLKQSVPPLETDSIWDEVRERFVGDPAFDQITVESERIRLFKEFVHAI 667          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Xenopus
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:NCBI gene;Acc:100493450])

HSP 1 Score: 484.182 bits (1245), Expect = 5.500e-157
Identity = 291/605 (48.10%), Postives = 402/605 (66.45%), Query Frame = 1
Query:  124 SYPVPTSYLPPTSVQNSLPT--LPEQA--WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINEN-----------NTTDKPKESSA-----IDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPI-PEKVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            + P PT  +   +V+ S P   +P++   WTEH A DGRTYYYN  TKQSTWEKPDELK+ AE +LS+CPWKE+KS+ GK YYYN+ T++S W KP +L E E L     D S  +  ++           +T   P E  A     I E ++A+    P   + +   KD S+ + +     + + PEK  Y   TKEE ++ ++ +LK+  VP NATWE A+KMI  DPRY  L K ++KKQ FN YK QR+K+E+EE RLR K+AKE L++FL  H K++S   YRKA+ +  +   W+ VPERDR+EIY+D L  + K+EKE+AK LRKRN++    ILD M N++F+TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEKD  EEKER + R +R QRKNRE+F VF+DELHE G+L S+S W +LY  IS D RF  ML Q GSTPLDLFKFYV ELK+RF  EK+I+K+I++DRNF+ + NT+ E F  +I  D+R  TLD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  FK MLK     +++   W+EV ++      F  + +ES+R++ +KE++  I
Sbjct:  161 AQPAPT--VAKATVEESSPAQDIPKKKSLWTEHKAPDGRTYYYNSETKQSTWEKPDELKSKAEFLLSQCPWKEYKSDTGKSYYYNSQTKESRWTKPKDLDELEALIKQKEDVSAEQETQSAISSPSTAVSSDTEMTPTEEPAVAQPSIPEPVEASEVEAPQE-ETLQCQKDISNSEPLRIEDGVKVEPEKRSYNWSTKEEAKQFFKELLKDKGVPSNATWEQAMKMIINDPRYSALPKLSEKKQAFNAYKAQREKEEKEETRLRAKEAKEKLQRFLEQHEKMTSTTRYRKAEQMFGEQEVWSVVPERDRKEIYDDVLFFLAKKEKEQAKQLRKRNVQALKNILDNMTNVSFQTTWSEAQQYLMDNPMFAEDEELQNMDKEDALICFEEHIRALEKDEAEEKERTRLRERRQQRKNRESFQVFLDELHETGQLHSMSTWMELYPSISTDSRFANMLGQTGSTPLDLFKFYVEELKARFHDEKKIIKDIIKDRNFSVEVNTTFEDFAHIISFDKRAATLDAGNIKLTFNSLLEKAEARERERGKEEARKIRRKEAAFKSMLKQSVPPLETDSIWDEVRERFVGDPAFDQITVESERIRLFKEFVHAI 762          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Xenopus
Match: PRPF40B (pre-mRNA processing factor 40 homolog B [Source:NCBI gene;Acc:100493450])

HSP 1 Score: 478.019 bits (1229), Expect = 7.200e-157
Identity = 286/578 (49.48%), Postives = 391/578 (67.65%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPEL---------AEAEKLAYGNNDTSDNEINENNTTDKPKESS-AIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPI---------PEKVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            WTEH A DGRTYYYN  TKQSTWEKPDELK+ AE +LS+CPWKE+KS+ GK YYYN+ T++S W KP +L          E EK A  +  T+ +   E   T++P  +  +I E ++A+    P   + +   KD S  +  +PA   P+         PEK  Y   TKEE ++ ++ +LK+  VP NATWE A+KMI  DPRY  L K ++KKQ FN YK QR+K+E+EE RLR K+AKE L++FL  H K++S   YRKA+ +  +   W+ VPERDR+EIY+D L  + K+EKE+AK LRKRN++    ILD M N++F+TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEKD  EEKER + R +R QRKNRE+F VF+DELHE G+L S+S W +LY  IS D RF  ML Q GSTPLDLFKFYV ELK+RF  EK+I+K+I++DRNF+ + NT+ E F  +I  D+R  TLD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  FK MLK     +++   W+EV ++      F  + +ES+R++ +KE++  I
Sbjct:   80 WTEHKAPDGRTYYYNSETKQSTWEKPDELKSKAEFLLSQCPWKEYKSDTGKSYYYNSQTKESRWTKPKDLDELEGKGARLEEEKSAISSPSTAVSSDTEMTPTEEPAVAQPSIPEPVEASEVEAPQE-ETLQCQKDIS--NRYHPATFEPLRIEDGVKVEPEKRSYNWSTKEEAKQFFKELLKDKGVPSNATWEQAMKMIINDPRYSALPKLSEKKQAFNAYKAQREKEEKEETRLRAKEAKEKLQRFLEQHEKMTSTTRYRKAEQMFGEQEVWSVVPERDRKEIYDDVLFFLAKKEKEQAKQLRKRNVQALKNILDNMTNVSFQTTWSEAQQYLMDNPMFAEDEELQNMDKEDALICFEEHIRALEKDEAEEKERTRLRERRQQRKNRESFQVFLDELHETGQLHSMSTWMELYPSISTDSRFANMLGQTGSTPLDLFKFYVEELKARFHDEKKIIKDIIKDRNFSVEVNTTFEDFAHIISFDKRAATLDAGNIKLTFNSLLEKAEARERERGKEEARKIRRKEAAFKSMLKQSVPPLETDSIWDEVRERFVGDPAFDQITVESERIRLFKEFVHAI 654          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Mouse
Match: Prpf40a (pre-mRNA processing factor 40A [Source:MGI Symbol;Acc:MGI:1860512])

HSP 1 Score: 373.629 bits (958), Expect = 1.706e-115
Identity = 214/448 (47.77%), Postives = 302/448 (67.41%), Query Frame = 1
Query:  517 IKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD--IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYL 1854
            I +  G  P+  + V+       E+E  PA          + TKEE ++ ++ +LKE  VP NA+WE A+KMI  DPRY  L K ++KKQ FN YK Q +K+E+EEAR + K+AKE  ++FL NH K++S   Y+KA+ +  +   W A+ ERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T+ TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F +F+DELHE G+L S+S W +LY  IS D RF  ML QPGST LDLFKFYV +LK+R+  EK+I+K+IL+D+ F  + NT+ E F+ +I   +R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK     I+    WE++ ++      F+ + LES+R + +K+++
Sbjct:  309 ISSNTGEEPAKQETVSDFTPKKEEEESQPAKKT-----YTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQATPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFM 751          

HSP 2 Score: 125.561 bits (314), Expect = 6.311e-29
Identity = 101/349 (28.94%), Postives = 175/349 (50.14%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENN--TTDKPKESSAIDEAIKATLGSMPSS----------------------SDKVNSHKDSSSEDEVNPAHNIPI---PEKV-VYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEAR----LRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLE 1146
            WTEH + DGRTYYYN  TKQSTWEKPD+LKTPAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E   Y N   +   I ++N     K +ESS  +E   A+   +P++                      +    +   ++S    N   ++P+   PE   +  T  + E    V  +E     N    TA++ +SGD       +   K++  + +  +++++E + A+       K+  +   K L+   ++ S   + +A  ++ + P ++A+ +  ++++ +    +Q  K EKEEA+   K   + F   L+    +T  T + +A+++  E
Sbjct:  104 WTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLE--GYQNTIVAGGLITKSNLHAMIKAEESSKQEECTTASTAPVPTTEIPTTMSTMAAAEAAAAVVAAAAAAAAAANANTSTTPTNTVGSVPVAPEPEVTSIVATAVDNENTVTVSTEEQAQLANT---TAIQDLSGDIS-SNTGEEPAKQETVSDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGE 446          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Mouse
Match: Prpf40a (pre-mRNA processing factor 40A [Source:MGI Symbol;Acc:MGI:1860512])

HSP 1 Score: 373.244 bits (957), Expect = 3.013e-115
Identity = 214/448 (47.77%), Postives = 303/448 (67.63%), Query Frame = 1
Query:  517 IKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYL 1854
            I +  G  P+  + V+       E+E  PA          + TKEE ++ ++ +LKE  VP NA+WE A+KMI  DPRY  L K ++KKQ FN YK Q +K+E+EEAR + K+AKE  ++FL NH K++S   Y+KA+ +  +   W A+ ERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T+ TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F +F+DELHE G+L S+S W +LY  IS D RF  ML QPGST LDLFKFYV +LK+R+  EK+I+K+IL+D+ F  + NT+ E F+ +I   +R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK  +  I+    WE++ ++      F+ + LES+R + +K+++
Sbjct:  324 ISSNTGEEPAKQETVSDFTPKKEEEESQPAKKT-----YTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQATPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFM 766          

HSP 2 Score: 125.561 bits (314), Expect = 6.447e-29
Identity = 101/349 (28.94%), Postives = 175/349 (50.14%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENN--TTDKPKESSAIDEAIKATLGSMPSS----------------------SDKVNSHKDSSSEDEVNPAHNIPI---PEKV-VYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEAR----LRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLE 1146
            WTEH + DGRTYYYN  TKQSTWEKPD+LKTPAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E   Y N   +   I ++N     K +ESS  +E   A+   +P++                      +    +   ++S    N   ++P+   PE   +  T  + E    V  +E     N    TA++ +SGD       +   K++  + +  +++++E + A+       K+  +   K L+   ++ S   + +A  ++ + P ++A+ +  ++++ +    +Q  K EKEEA+   K   + F   L+    +T  T + +A+++  E
Sbjct:  119 WTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLE--GYQNTIVAGGLITKSNLHAMIKAEESSKQEECTTASTAPVPTTEIPTTMSTMAAAEAAAAVVAAAAAAAAAANANTSTTPTNTVGSVPVAPEPEVTSIVATAVDNENTVTVSTEEQAQLANT---TAIQDLSGDIS-SNTGEEPAKQETVSDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGE 461          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Mouse
Match: Prpf40a (pre-mRNA processing factor 40A [Source:MGI Symbol;Acc:MGI:1860512])

HSP 1 Score: 373.629 bits (958), Expect = 4.363e-115
Identity = 214/451 (47.45%), Postives = 304/451 (67.41%), Query Frame = 1
Query:  517 IKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            I +  G  P+  + V+       E+E  PA          + TKEE ++ ++ +LKE  VP NA+WE A+KMI  DPRY  L K ++KKQ FN YK Q +K+E+EEAR + K+AKE  ++FL NH K++S   Y+KA+ +  +   W A+ ERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T+ TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F +F+DELHE G+L S+S W +LY  IS D RF  ML QPGST LDLFKFYV +LK+R+  EK+I+K+IL+D+ F  + NT+ E F+ +I   +R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK  +  I+    WE++ ++      F+ + LES+R + +K+++  +
Sbjct:  351 ISSNTGEEPAKQETVSDFTPKKEEEESQPAKKT-----YTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQATPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVL 796          

HSP 2 Score: 125.561 bits (314), Expect = 5.240e-29
Identity = 101/349 (28.94%), Postives = 175/349 (50.14%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENN--TTDKPKESSAIDEAIKATLGSMPSS----------------------SDKVNSHKDSSSEDEVNPAHNIPI---PEKV-VYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEAR----LRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLE 1146
            WTEH + DGRTYYYN  TKQSTWEKPD+LKTPAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E   Y N   +   I ++N     K +ESS  +E   A+   +P++                      +    +   ++S    N   ++P+   PE   +  T  + E    V  +E     N    TA++ +SGD       +   K++  + +  +++++E + A+       K+  +   K L+   ++ S   + +A  ++ + P ++A+ +  ++++ +    +Q  K EKEEA+   K   + F   L+    +T  T + +A+++  E
Sbjct:  146 WTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLE--GYQNTIVAGGLITKSNLHAMIKAEESSKQEECTTASTAPVPTTEIPTTMSTMAAAEAAAAVVAAAAAAAAAANANTSTTPTNTVGSVPVAPEPEVTSIVATAVDNENTVTVSTEEQAQLANT---TAIQDLSGDIS-SNTGEEPAKQETVSDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGE 488          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Mouse
Match: Prpf40b (pre-mRNA processing factor 40B [Source:MGI Symbol;Acc:MGI:1925583])

HSP 1 Score: 365.925 bits (938), Expect = 3.467e-113
Identity = 207/447 (46.31%), Postives = 304/447 (68.01%), Query Frame = 1
Query:  631 VVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYL---------LTIRSRSRSKFSQEIKRKRKHRSNSKES 1938
            + +  +E+ ++ ++ +L++  VP NA+WE A+KM+  DPRY  L K ++KKQ FN YK QR+K+E+EEARLR K+AK+ L+ FL  H +++S   YR+A+    D   W  VPER+R+E+Y+D L  + K+EKE+AK LR+RNI+    ILD M ++ F+TTW +AQ+ L++NP F +D+ LQ+MDKEDALICFEEHIR LE++ EEE+ER + R +R QRKNREAF  F+DELHE G+L S+S W +LY  +S D RF  ML QPGSTPLDLFKFYV ELK+RF  EK+I+K+IL+DR F  + NT+ E F  VI  D+R   LD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  F+ ML+     ++   +WEEV ++      F+ + LES+R++ ++E+L         L  + R   +  ++  RKR H  +  ES
Sbjct:  271 LSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRYRRAEQTFGDLEVWAVVPERERKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDQQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQSFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLETECQHLHTKGRKHGRKGKKHHRKRSHSPSGSES 717          

HSP 2 Score: 105.145 bits (261), Expect = 1.317e-22
Identity = 50/105 (47.62%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  112 PLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL 426
            P+T +   P +    ++V  + P  P   W+EH+A DGR YYYN   KQS WEKP  LK+ AE +LS+CPWKE+KS+ GK YYYN  +Q+S W +P +L + E L
Sbjct:   72 PVT-AATAPGADTASSAVAGTGP--PRALWSEHVAPDGRIYYYNADDKQSVWEKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSQESRWTRPKDLDDLEAL 173          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Mouse
Match: Prpf40b (pre-mRNA processing factor 40B [Source:MGI Symbol;Acc:MGI:1925583])

HSP 1 Score: 365.155 bits (936), Expect = 8.449e-113
Identity = 207/448 (46.21%), Postives = 304/448 (67.86%), Query Frame = 1
Query:  631 VVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYL----------LTIRSRSRSKFSQEIKRKRKHRSNSKES 1938
            + +  +E+ ++ ++ +L++  VP NA+WE A+KM+  DPRY  L K ++KKQ FN YK QR+K+E+EEARLR K+AK+ L+ FL  H +++S   YR+A+    D   W  VPER+R+E+Y+D L  + K+EKE+AK LR+RNI+    ILD M ++ F+TTW +AQ+ L++NP F +D+ LQ+MDKEDALICFEEHIR LE++ EEE+ER + R +R QRKNREAF  F+DELHE G+L S+S W +LY  +S D RF  ML QPGSTPLDLFKFYV ELK+RF  EK+I+K+IL+DR F  + NT+ E F  VI  D+R   LD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  F+ ML+     ++   +WEEV ++      F+ + LES+R++ ++E+L          L  + R   +  ++  RKR H  +  ES
Sbjct:  271 LSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRYRRAEQTFGDLEVWAVVPERERKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDQQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQSFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLEQTECQHLHTKGRKHGRKGKKHHRKRSHSPSGSES 718          

HSP 2 Score: 105.145 bits (261), Expect = 1.143e-22
Identity = 50/105 (47.62%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  112 PLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL 426
            P+T +   P +    ++V  + P  P   W+EH+A DGR YYYN   KQS WEKP  LK+ AE +LS+CPWKE+KS+ GK YYYN  +Q+S W +P +L + E L
Sbjct:   72 PVT-AATAPGADTASSAVAGTGP--PRALWSEHVAPDGRIYYYNADDKQSVWEKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSQESRWTRPKDLDDLEAL 173          
BLAST of Pre-mRNA-processing factor 40 vs. UniProt/SwissProt
Match: sp|P34600|YO61_CAEEL (WW domain-containing protein ZK1098.1 OS=Caenorhabditis elegans OX=6239 GN=ZK1098.1 PE=1 SV=2)

HSP 1 Score: 392.504 bits (1007), Expect = 6.792e-124
Identity = 242/616 (39.29%), Postives = 361/616 (58.60%), Query Frame = 1
Query:   91 NYQFTLPPLTHSYPVPTSYLPPTSV---QNSLPTLP--------------------EQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECP----WKEFKSEQGKIYYYNTVTQQSVWQKPP--ELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEY 1851
            N +F +PP+     VP   +P  SV     + PT P                    E  W+ H  + G  YY+N +TKQ++W KPD LKTP E+  S  P    WKEF S+ GK YYYNT+T+++ W KP   E+ + E+       T D  +       + K  S +D+A+KATL SMP+        ++ S  DEV          ++  R  E   E  R    +  +  N  W+ AVK I  DPR++ L K ++KKQ+FN +K QR K+ER+E RL IKK+KEDLEKFL  H K+  ++ Y+KA  + S  P W AV + DR+EI+ D +  + +R+KE+ +  RKR+I  F+ +L  M  +T+KTTW +AQRIL ENP+F E +DL  MDKEDAL  FE+HI+  EK+H+EEKE+E++RL+R QRK RE + + ++ LH++G+LTS+S+W  L+ IIS D RF  ML QPGS+PLDLFKF+V +LK ++++++R++KEIL ++       T    F   +   E+G  +D GN+++ Y SLIE+AES  K   KE L+++++ E  F+ +LK H++     W  +  K+   + +  +E + +R   +  Y
Sbjct:   25 NQRFGMPPVGSIAQVPLLQMPTHSVVAPHVAAPTRPSPMLVPPGMGIDESHSSPSVESDWSVHTNEKGTPYYHNRVTKQTSWIKPDVLKTPLERSTSGQPQQGQWKEFMSDDGKPYYYNTLTKKTQWVKPDGEEITKGEQKPAAKAATVDT-VALAAAVQQKKAESDLDKAMKATLASMPNVPLPSEKKEEESVNDEV----------ELKKRQSERFRELLRDKYNDGKITTNCNWDQAVKWIQNDPRFRILNKVSEKKQLFNAWKVQRGKEERDEKRLAIKKSKEDLEKFLQEHPKMKESLKYQKASDIFSKEPLWIAVNDEDRKEIFRDCIDFVARRDKEKKEEDRKRDIAAFSHVLQSMEQITYKTTWAQAQRILYENPQFAERKDLHFMDKEDALTVFEDHIKQAEKEHDEEKEQEEKRLRRQQRKVREEYRLLLESLHKRGELTSMSLWTSLFPIISTDTRFELMLFQPGSSPLDLFKFFVEDLKEQYTEDRRLIKEILTEKGCQVIATTEYREFSDWVVSHEKGGKVDHGNMKLCYNSLIEKAESKAKDEEKESLRRKRRLESEFRNLLKEHNVDKDSEWTVIKPKIEKDKAYLAMENDDERETAFNHY 629          
BLAST of Pre-mRNA-processing factor 40 vs. UniProt/SwissProt
Match: sp|Q9R1C7|PR40A_MOUSE (Pre-mRNA-processing factor 40 homolog A OS=Mus musculus OX=10090 GN=Prpf40a PE=1 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 3.052e-114
Identity = 214/451 (47.45%), Postives = 304/451 (67.41%), Query Frame = 1
Query:  517 IKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            I +  G  P+  + V+       E+E  PA          + TKEE ++ ++ +LKE  VP NA+WE A+KMI  DPRY  L K ++KKQ FN YK Q +K+E+EEAR + K+AKE  ++FL NH K++S   Y+KA+ +  +   W A+ ERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T+ TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F +F+DELHE G+L S+S W +LY  IS D RF  ML QPGST LDLFKFYV +LK+R+  EK+I+K+IL+D+ F  + NT+ E F+ +I   +R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK  +  I+    WE++ ++      F+ + LES+R + +K+++  +
Sbjct:  351 ISSNTGEEPAKQETVSDFTPKKEEEESQPAKKT-----YTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQATPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVL 796          

HSP 2 Score: 125.561 bits (314), Expect = 3.665e-28
Identity = 101/349 (28.94%), Postives = 175/349 (50.14%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENN--TTDKPKESSAIDEAIKATLGSMPSS----------------------SDKVNSHKDSSSEDEVNPAHNIPI---PEKV-VYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEAR----LRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLE 1146
            WTEH + DGRTYYYN  TKQSTWEKPD+LKTPAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E   Y N   +   I ++N     K +ESS  +E   A+   +P++                      +    +   ++S    N   ++P+   PE   +  T  + E    V  +E     N    TA++ +SGD       +   K++  + +  +++++E + A+       K+  +   K L+   ++ S   + +A  ++ + P ++A+ +  ++++ +    +Q  K EKEEA+   K   + F   L+    +T  T + +A+++  E
Sbjct:  146 WTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLE--GYQNTIVAGGLITKSNLHAMIKAEESSKQEECTTASTAPVPTTEIPTTMSTMAAAEAAAAVVAAAAAAAAAANANTSTTPTNTVGSVPVAPEPEVTSIVATAVDNENTVTVSTEEQAQLANT---TAIQDLSGDIS-SNTGEEPAKQETVSDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGE 488          
BLAST of Pre-mRNA-processing factor 40 vs. UniProt/SwissProt
Match: sp|Q80W14|PR40B_MOUSE (Pre-mRNA-processing factor 40 homolog B OS=Mus musculus OX=10090 GN=Prpf40b PE=1 SV=2)

HSP 1 Score: 370.163 bits (949), Expect = 9.835e-114
Identity = 207/448 (46.21%), Postives = 303/448 (67.63%), Query Frame = 1
Query:  631 VVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYL----------LTIRSRSRSKFSQEIKRKRKHRSNSKES 1938
            + +  +E+ ++ ++ +L++  VP NA+WE A+KM+  DPRY  L K ++KKQ FN YK QR+K+E+EEARLR K+AK+ L+ FL  H +++S   YR+A+    D   W  VPER+R+E+Y+D L  + K+EKE+AK LR+RNI+    ILD M ++ F+TTW +AQ+ L++NP F +D+ LQ+MDKEDALICFEEHIR LE++ EEE+ER + R +R QRKNREAF  F+DELHE G+L S+S W +LY  +S D RF  ML QPGSTPLDLFKFYV ELK+RF  EK+I+K+IL+DR F  + NT+ E F  VI  D+R   LD GN+++ + SL+E+AE+ E +R KE  ++ ++ E  F+ ML+     ++   +WEEV ++      F+ + LES+R++ ++E+L          L  + R   +  ++  RKR H  +  ES
Sbjct:  271 LSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRYRRAEQTFGDLEVWAVVPERERKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDQQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQSFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEARETEREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLEQTECQHLHTKGRKHGRKGKKHHRKRSHSPSGSES 718          

HSP 2 Score: 105.145 bits (261), Expect = 7.857e-22
Identity = 50/105 (47.62%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  112 PLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL 426
            P+T +   P +    ++V  + P  P   W+EH+A DGR YYYN   KQS WEKP  LK+ AE +LS+CPWKE+KS+ GK YYYN  +Q+S W +P +L + E L
Sbjct:   72 PVT-AATAPGADTASSAVAGTGP--PRALWSEHVAPDGRIYYYNADDKQSVWEKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSQESRWTRPKDLDDLEAL 173          
BLAST of Pre-mRNA-processing factor 40 vs. UniProt/SwissProt
Match: sp|O75400|PR40A_HUMAN (Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=2)

HSP 1 Score: 370.548 bits (950), Expect = 3.557e-113
Identity = 207/418 (49.52%), Postives = 293/418 (70.10%), Query Frame = 1
Query:  616 PIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            P  +   + TKEE ++ ++ +LKE  VP NA+WE A+KMI  DPRY  L K ++KKQ FN YK Q +K+E+EEAR + K+AKE  ++FL NH K++S   Y+KA+ +  +   W A+ ERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T+ TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F +F+DELHE G+L S+S W +LY  IS D RF  ML QPGST LDLFKFYV +LK+R+  EK+I+K+IL+D+ F  + NT+ E F+ +I   +R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK  +  I+    WE++ ++      F+ + LES+R + +K+++  +
Sbjct:  383 PAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVL 800          

HSP 2 Score: 122.865 bits (307), Expect = 3.217e-27
Identity = 73/168 (43.45%), Postives = 101/168 (60.12%), Query Frame = 1
Query:   58 ILNGIEIS-MSN-NYQFTLPPLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENN--TTDKPKESSAIDEAIKATLGSMPSS 549
            ++ G+ +S MS  + Q  LPP  +S  V        S   S+       WTEH + DGRTYYYN  TKQSTWEKPD+LKTPAE++LS+CPWKE+KS+ GK YYYN+ T++S W KP EL + E   Y N   + + I ++N     K +ESS  +E    +   +P++
Sbjct:  107 VMPGMMMSHMSQASMQPALPPGVNSMDVAAGT---ASGAKSM-------WTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLE--GYQNTIVAGSLITKSNLHAMIKAEESSKQEECTTTSTAPVPTT 262          
BLAST of Pre-mRNA-processing factor 40 vs. UniProt/SwissProt
Match: sp|Q6NWY9|PR40B_HUMAN (Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens OX=9606 GN=PRPF40B PE=1 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.246e-110
Identity = 205/444 (46.17%), Postives = 302/444 (68.02%), Query Frame = 1
Query:  631 VVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSH--DIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSSREH 1956
            + +  +E+ ++ ++ +L++  VP NA+WE A+KM+  DPRY  L K ++KKQ FN YK QR+K+E+EEARLR K+AK+ L+ FL  H +++S   YR+A+    +   W  VPERDR+E+Y+D L  + K+EKE+AK LR+RNI+    ILD M ++ F+TTW +AQ+ L++NP F +D  LQ+MDKEDALICFEEHIR LE++ EEE+ER + R +R QRKNREAF  F+DELHE G+L S+S W +LY  +S D RF  ML QPGSTPLDLFKFYV ELK+RF  EK+I+K+IL+DR F  + NT+ E F  VI  D+R   LD GN+++ + SL+E+AE+ E++R KE  ++ ++ E  F+ ML+     ++   +WEEV ++      F+ + LES+R++ ++E+L  +    +++      + RKH    K+    R H
Sbjct:  271 LSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRYRRAEQTFGELEVWAVVPERDRKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVL---EQTECQHLHTKGRKHGRKGKKHHHKRSH 711          

HSP 2 Score: 102.834 bits (255), Expect = 4.813e-21
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  112 PLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKL 426
            P+T +   P +    ++V  + P  P   W+EH+A DGR YYYN   KQS WEKP  LK+ AE +LS+CPWKE+KS+ GK YYYN  +++S W +P +L + E L
Sbjct:   72 PVT-AATAPGADTASSAVAGTGP--PRALWSEHVAPDGRIYYYNADDKQSVWEKPSVLKSKAELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDDLEVL 173          
BLAST of Pre-mRNA-processing factor 40 vs. TrEMBL
Match: A0A4Z2DGA9 (Pre-mRNA-processing factor 40 OS=Schistosoma japonicum OX=6182 GN=EWB00_001260 PE=4 SV=1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 327/651 (50.23%), Postives = 437/651 (67.13%), Query Frame = 1
Query:  109 PPLTHSYPVPTSYL-PPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNE----------------INENNTTDKPKESSAIDEAIKATLGS------------MPSSSDKV-NSHKDSSSEDEVNPAHNIP--------IPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD-IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVS 1944
            P   H+  VPTS   P TSV           W EH + DGR YYYN  T+Q+TWEKP ELKT  EKIL  CPWKEFKSE GK YY+N  T+QSVW KP EL EAE  A     T +                      +   KP E S I+ A+KATL S            +P   +KV +S KD S +++  P  N+         +PE   Y+T+ E+ EG R + ++ NVPG ATWE A+K+ISGDPRY  L+ +N+KKQIFN YKTQR K+EREE R+RIK+AKEDLEK+L+  +KL S + YR+ D LLSD  EWT VP+RDRREI++D + ++GKRE+EEAK+LRKRNI++FNEIL  M +LT++TTW EAQ++LL+N RF  D DLQ++DKEDAL+CFEEHI +LE++H+E+KERE+RR KR QRKNREAF V +DELHE+  LTS+S+WKDLY II++D+RF+KML+Q GSTPLDLFKFYV  LK+RF  EK+I+KEIL+  + + D + S E F  +I  DER + +D GN+RM Y SL+E+A+  E++R ++  ++ +K E +F +ML +   I+S+ SWEEV +KL +   FK + LES+R++ +KEY+++I +       +   RK KHR     SV+
Sbjct:   16 PGYAHATFVPTSIPNPVTSVTQLSAAQVNAGWVEHHSHDGRKYYYNTFTQQTTWEKPQELKTQREKILCNCPWKEFKSENGKPYYFNENTKQSVWVKPQELIEAENQAAACTPTLNTAVPEPPPIIPPVTPCTPATPKDDISKPPEPSEIERAMKATLASFETSDTGPSSMSIPLPPEKVYDSDKDESEDEKPTPNVNVTTFSPNTQTVPE---YKTRGEMAEGLRRLFRDCNVPGGATWEQALKLISGDPRYSILRTFNEKKQIFNVYKTQRLKEEREEQRIRIKRAKEDLEKYLLKCNKLHSTMSYRRVDQLLSDTKEWTDVPDRDRREIFDDVMQEVGKREREEAKILRKRNIRVFNEILGEMLDLTYRTTWSEAQQMLLDNTRFTGDVDLQNLDKEDALVCFEEHICMLEQEHDEDKERERRRQKREQRKNREAFIVLLDELHEQKLLTSMSLWKDLYHIINKDDRFHKMLAQRGSTPLDLFKFYVEALKARFPAEKKIIKEILKYSSTSIDLSVSYEDFCSIISADERSKGIDSGNMRMTYDSLLEKAQGRERERQRDDARRMRKLEQHFCEMLATSSFIQSNTSWEEVREKLSDHPAFKGMSLESERIRLFKEYIMSIDNSLNEDAHR--SRKDKHRRERSPSVN 661          
BLAST of Pre-mRNA-processing factor 40 vs. TrEMBL
Match: A0A504YY66 (Pre-mRNA-processing factor A OS=Fasciola gigantica OX=46835 GN=FGIG_08405 PE=4 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 321/657 (48.86%), Postives = 435/657 (66.21%), Query Frame = 1
Query:  109 PPLTHSYPVPTSYLP----PTSVQNSLPTLPEQA-WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYG---------------NNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNS--------------------HKDSSSEDEVNPAHNIPIPEKVV---YRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD-IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSS 1947
            P  T ++  P  Y P    P  VQ ++P       W EH + DGR YYYN +T+Q+TWEKP ELK+  E ILS CPWKEFKSE GK YY+N  T+QSVW KP EL EAE+ A                   +T            KP E SAI++A+ ATL S   SS K +S                     K  S +   N +     P  +V   Y+T+ E+ EG R + ++ NVPG +TWE AVK+IS DPRY  LK + +KKQIFN YKTQR K+EREE RLR K+AKEDLE+FL+ H K+ S + YR+ D LLSD  EW  VP++DRRE+++D + ++ KRE+EEAKVLRKRNIK+FNEIL  MP LT++TTW EAQ++LL+N RF  D +LQS+DKEDAL+CFEEHI +LE++H+EEKERE+R+ KR+QRKNREAF V +DELHE+  L+S SMWKDLY IISRDERF+KML+Q GSTPLDLFKFYV  LK+R+  EK+++KEIL+D  F  D +TS E F  VI  DER + +D GN+RM + SL+E+A+  E++R ++  ++ +K E NF  ML S + I+   SW+EV +K  +   F+ + LES+R++ +K+Y++++ S +++  S++ +R RK +   ++S S+
Sbjct:    5 PAFTGAHTFPHPYAPMAYLPAGVQAAIPVAATAGSWAEHTSHDGRKYYYNTLTQQTTWEKPPELKSTRELILSSCPWKEFKSENGKPYYFNEQTRQSVWVKPQELMEAEQQAEALAPMPSPAQEKHTPLQLNTPCTPATPKEEFGKPPEPSAIEKAMLATLASYDISSSKTDSIPIPPPPPNEMPTEAKSEQLEKTDSEDKSSNVSRRTGSPAPLVMHEYKTRGEMAEGLRRLFRDCNVPGGSTWEQAVKLISADPRYNLLKSFTEKKQIFNVYKTQRLKEEREEQRLRAKQAKEDLERFLLRHPKVHSTMSYRRVDQLLSDAQEWKVVPDKDRRELFDDVMQEISKREREEAKVLRKRNIKVFNEILSDMPKLTYRTTWSEAQQMLLDNSRFTGDVELQSLDKEDALVCFEEHICMLEQEHDEEKERERRKQKRIQRKNREAFIVLLDELHEQKLLSSTSMWKDLYSIISRDERFHKMLAQRGSTPLDLFKFYVEALKTRYPAEKKLIKEILKDIGFNVDLSTSFEDFCTVIGRDERSKGVDDGNLRMTFDSLLEKAKGRERERQRDDARRLRKLEQNFCGMLSSANFIRPDTSWDEVREKFNDHPAFRALSLESERIRVFKDYIISMDSAAQAD-SEKSRRNRKDKRRQEDSESA 660          
BLAST of Pre-mRNA-processing factor 40 vs. TrEMBL
Match: A0A4E0R113 (Pre-mRNA-processing factor A OS=Fasciola hepatica OX=6192 GN=D915_008082 PE=4 SV=1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 318/654 (48.62%), Postives = 433/654 (66.21%), Query Frame = 1
Query:  109 PPLTHSYPVPTSYLP----PTSVQNSLPTLPEQA-WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYG---------------NNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNS--------------------HKDSSSEDEVNPAHNIPIPEKVV---YRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD-IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKES 1938
            P  T ++  P  Y P    P  VQ ++P       W EH + DGR YYYN +T+Q+TWEKP ELK+  E ILS CPWKEFKSE GK YY+N  T+QSVW KP EL EAE+ A                   +T            KP E SAI++A+ ATL S   SS K +S                     K  S +   N +     P  +V   Y+T+ E+ EG R + ++ NVPG +TWE AVK+IS DPRY  LK + +KKQIFN YKTQR K+EREE RLR K+AKEDLE+FL+ H K+ S + YR+ D LLSD  EW  VP++DRRE+++D + ++ KRE+EEAKVLRKRNIK+FNEIL  MP LT++TTW EAQ++LL+N RF  D +LQS+DKEDAL+CFEEHI +LE++H+EEKERE+R+ KR+QRKNREAF V +DELHE+  L+S SMWKDLY IISRD+RF+KML+Q GSTPLDLFKFYV  LK+R+  EK+++KEIL+D  F  D +TS E F  VI  DER + +D GN+RM + SL+E+A+  E++R ++  ++ +K E NF  ML S + I+   SW+EV ++  +   F+ + LES+R++ +K+Y++++ S +++  S++ +R RK +   ++S
Sbjct:    5 PAFTGAHTFPHPYAPMAYLPAGVQAAIPVAATAGGWAEHTSHDGRKYYYNTLTQQTTWEKPPELKSTRELILSSCPWKEFKSENGKPYYFNEQTRQSVWVKPQELMEAEQQAEALAPMPSPAQEKHTPLQLNTPCTPATPKEEFGKPPEPSAIEKAMLATLASYDISSSKTDSIPIPPPPPNEMSTEAKSEQLEKTDSEDKSSNVSRRTGSPAPLVMHEYKTRGEMAEGLRRLFRDCNVPGGSTWEQAVKLISADPRYNLLKSFTEKKQIFNVYKTQRLKEEREEQRLRAKQAKEDLERFLLRHPKVHSTMSYRRVDQLLSDAQEWKVVPDKDRRELFDDVMQEISKREREEAKVLRKRNIKVFNEILSDMPKLTYRTTWSEAQQMLLDNSRFTGDVELQSLDKEDALVCFEEHICMLEQEHDEEKERERRKQKRIQRKNREAFIVLLDELHEQKLLSSTSMWKDLYSIISRDDRFHKMLAQRGSTPLDLFKFYVEALKTRYPAEKKLIKEILKDIGFNVDLSTSFEDFCTVIGRDERSKGVDDGNLRMTFDSLLEKAKGRERERQRDDARRLRKLEQNFCGMLSSANFIRPDTSWDEVRERFNDHPAFRALSLESERIRVFKDYIISMDSAAQAD-SEKSRRNRKDKRRQEDS 657          
BLAST of Pre-mRNA-processing factor 40 vs. TrEMBL
Match: H2KUZ3 (Pre-mRNA-processing factor 40 OS=Clonorchis sinensis OX=79923 GN=CLF_110840 PE=4 SV=1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 323/661 (48.87%), Postives = 441/661 (66.72%), Query Frame = 1
Query:  109 PPLTHSYPVP---TSYLPPTSVQNSLPTL-PEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDT--SDNEINENNTTD-------------KPKESSAIDEAIKATLGS--MPSSSD---------------KVNSHKDSSSEDEVNPAHNI------PIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD-IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRS---KFSQEIKRKRKHRSNSKESVSSRE 1953
            PP T ++  P    +YLP      ++PT+ P   W EH + DGR YYYN  T+Q+TW+KP ELKT  E ILS CPWKEFKSE G++YY+N  T+QSVW KP EL +AE  A   + T  SD ++  ++                KP E SAI++A+ ATL S  +P+++D                 N + D +S D    A         P P +  Y+T+ E+ EG R + ++ NVPG+ATWE A+K+IS DPRY  LK + +KKQIFN YKTQR K+EREE RLR K+AKEDLE+FL+ H KL S + YRK + LLSD  EWT+VP+RDRRE++ED +  + KRE++EAKV+RKRNIK+F+EIL  MPNLTF+TTW EAQ++LL+NP+F  D +LQS+DKEDALICFEEHI +LE++H+EEKER++RR KR QRKNREAF V +DELHE   LT+ S+WKDLY II+RDERF+KML+Q GSTPLDLFKFYV  LK+R+  E++++KEI++D     D +TS E F+ ++  DER + +D GN+RM Y S +E+A+  E++R ++  ++ +K E NF +ML S   I  + +WEEV         F  + LES+R++ +KEYL+++ S + +   K  +  K K +H+    ESV  RE
Sbjct:    5 PPYTATFHHPYAQVAYLPA-----AVPTIAPVSQWIEHTSHDGRKYYYNTATQQTTWDKPQELKTTRELILSSCPWKEFKSENGRLYYFNEQTKQSVWVKPQELIDAENQAESASSTAVSDKKVPASSVLGTPCTPATPKDEPSKPPEPSAIEKAMMATLSSYDLPTTTDSIPIPPPPPTEAPAETPNEYVDRTSADNAGRAGTAGSSGGSPAPHQE-YKTRGEMAEGLRRLFRDCNVPGSATWEQALKLISADPRYSLLKTFTEKKQIFNVYKTQRLKEEREEQRLRAKQAKEDLERFLLRHPKLHSTMSYRKVEQLLSDAREWTSVPDRDRRELFEDVMQLISKRERDEAKVVRKRNIKVFHEILSGMPNLTFRTTWSEAQQMLLDNPKFTGDIELQSLDKEDALICFEEHICMLEQEHDEEKERDRRRQKRQQRKNREAFIVLLDELHENKLLTATSLWKDLYSIINRDERFHKMLAQRGSTPLDLFKFYVEALKARYPAERKLIKEIIKDNGLNIDLSTSFEDFVDLVSKDERSKGIDDGNMRMTYESFLEKAQGRERERQRDDARRMRKLEQNFCEMLCSAKFIGHNTTWEEVRDHFSGHPAFCALTLESERIRLFKEYLISLESAALAESEKSRKGHKEKHRHKREVSESVDKRE 659          
BLAST of Pre-mRNA-processing factor 40 vs. TrEMBL
Match: A0A4S2MFX1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000233 PE=4 SV=1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 322/660 (48.79%), Postives = 441/660 (66.82%), Query Frame = 1
Query:  109 PPLTHSYPVP---TSYLPPTSVQNSLPTL-PEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDT--SDNEI------------NENNTTDKPKESSAIDEAIKATLGS--MPSSSDKV---------------NSHKDSSSEDEVN------PAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD-IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRS---KFSQEIKRKRKHRSNSKESVSSRE 1953
            PP T ++  P    +YLP      ++PT+ P   W EH + DGR YYYN  T+Q+TWEKP ELKT  E ILS CPWKEFKSE G++YY+N  T+QSVW KP EL +AE  A   + T  SD ++               +   KP E SAI++A+ ATL S  +P+++D +               N + D ++ D          +   P P +  Y+T+ E+ EG R + ++ NVPG+ATWE A+K+IS DPRY  LK + +KKQIFN YKTQR K+EREE RLR K+AKEDLE+FL+ H KL S + YRK + LLSD  EWT+VP+RDRRE++ED +  + KRE++EAKV+RKRNIK+F+EIL  MPNLTF+TTW EAQ++LL+NP+F  D +LQS+DKEDALICFEEHI +LE++H+EEKER++RR KR QRKNREAF V +DELHE   LT+ S+WKDLY II+RDERF+KML+Q GSTPLDLFKFYV  LK+R+  E++++KEI++D     D +TS E F+ ++  DER + +D GN+RM Y S +E+A+  E++R ++  ++ +K E NF +ML S   I  + +WEEV         F  + LES+R++ +KEYL+++ S + +   K  +  K K +H+    ESV  RE
Sbjct:    5 PPYTATFHHPYAQVAYLPA-----AVPTIAPVSQWIEHTSHDGRKYYYNTATQQTTWEKPQELKTTRELILSSCPWKEFKSENGRLYYFNEQTKQSVWVKPQELIDAESQAESASSTTVSDKKVPTSVLGTPCTPATPKDEPSKPPEPSAIEKAMMATLSSYDLPTTTDSIPIPPPPPAEAPAETQNEYVDRTNADNAGRVGTASSSGGSPAPHQE-YKTRGEMAEGLRRLFRDCNVPGSATWEQALKLISADPRYSLLKTFTEKKQIFNVYKTQRLKEEREEQRLRAKQAKEDLERFLLRHPKLHSTMSYRKVEQLLSDAREWTSVPDRDRRELFEDVMQLISKRERDEAKVVRKRNIKVFHEILSGMPNLTFRTTWSEAQQMLLDNPKFTGDIELQSLDKEDALICFEEHICMLEQEHDEEKERDRRRQKRQQRKNREAFIVLLDELHENKLLTATSLWKDLYSIINRDERFHKMLAQRGSTPLDLFKFYVEALKARYPAERKLIKEIIKDNGLNIDLSTSFEDFVALVSKDERSKGIDDGNMRMTYESFLEKAQGRERERQRDDARRMRKLEQNFCEMLCSAKFIGHNTTWEEVRDHFSGHPAFCALTLESERIRLFKEYLISLESAALAESEKSRKGHKEKHRHKREVSESVDKRE 658          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Cavefish
Match: prpf40a (PRP40 pre-mRNA processing factor 40 homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-274])

HSP 1 Score: 393.66 bits (1010), Expect = 7.008e-125
Identity = 252/573 (43.98%), Postives = 350/573 (61.08%), Query Frame = 1
Query:  322 WKEFKSEQGKIYYYNTVTQQSVWQKPPEL-AEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKA--------------------------------------------TLGSMPSSSDKVNSHKDSSSEDEV----NPAHNIPIPE------KVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD--IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            W E KS  GK YYYNT T+QS W+KP EL + AE++    +     E N+ +   KPKE   ++  IKA                                             L  MP    +V+S    +S ++      PA N    E      K VY+  TKEE ++ ++ +LKE  V  NA+WE A+K+I  DPRY  L K ++KKQ FN YK Q +K+E+EEAR++ K++KE  ++FL NH K++S   Y+KA+ +  D   W+ VPERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T++TTW EAQ+ LL+NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F  F+DELH+ G+L S+S W ++Y  IS D RF  ML QPGSTPLDLFKFYV +LK+R+  EKRI+K+IL+D+ F  + +TS E F  VI  D+R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK     ++   SWE V ++      F+ + LES+R + +K+++  +
Sbjct:   32 WTEHKSLDGKTYYYNTETKQSTWEKPDELKSPAEQML---SKCPWKEYNKESRWTKPKELEDLEAMIKAEENGNTDVVAPGTAPPLAAQTDTAVAMAAGAEADATIATAAAEEQLSQMPMQGAEVSSDATMTSTEDTPVIETPASNDSSKEERPELVKKVYKWNTKEEAKQAFKELLKEKGVSSNASWEQAMKLIINDPRYSALPKLSEKKQAFNAYKVQTEKEEKEEARIKYKESKETFQRFLENHEKMTSTTRYKKAEQMFGDQEVWSCVPERDRLEIYEDVLFYLAKKEKEQAKQLRKRNWEALKNILDNMANVTYRTTWSEAQQYLLDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQKFLDELHDHGQLHSMSAWMEMYPTISADIRFASMLGQPGSTPLDLFKFYVEDLKARYHDEKRIIKDILKDKGFLVEISTSFEDFGSVISSDKRATTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKEAAFKSMLKQATPPLEPEASWEGVRERFLKEAAFEDITLESERKRIFKDFMHVL 601          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Cavefish
Match: prpf40a (PRP40 pre-mRNA processing factor 40 homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-274])

HSP 1 Score: 393.66 bits (1010), Expect = 1.916e-124
Identity = 252/573 (43.98%), Postives = 350/573 (61.08%), Query Frame = 1
Query:  322 WKEFKSEQGKIYYYNTVTQQSVWQKPPEL-AEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKA--------------------------------------------TLGSMPSSSDKVNSHKDSSSEDEV----NPAHNIPIPE------KVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHD--IKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            W E KS  GK YYYNT T+QS W+KP EL + AE++    +     E N+ +   KPKE   ++  IKA                                             L  MP    +V+S    +S ++      PA N    E      K VY+  TKEE ++ ++ +LKE  V  NA+WE A+K+I  DPRY  L K ++KKQ FN YK Q +K+E+EEAR++ K++KE  ++FL NH K++S   Y+KA+ +  D   W+ VPERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T++TTW EAQ+ LL+NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F  F+DELH+ G+L S+S W ++Y  IS D RF  ML QPGSTPLDLFKFYV +LK+R+  EKRI+K+IL+D+ F  + +TS E F  VI  D+R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK     ++   SWE V ++      F+ + LES+R + +K+++  +
Sbjct:   62 WTEHKSLDGKTYYYNTETKQSTWEKPDELKSPAEQML---SKCPWKEYNKESRWTKPKELEDLEAMIKAEENGNTDVVAPGTAPPLAAQTDTAVAMAAGAEADATIATAAAEEQLSQMPMQGAEVSSDATMTSTEDTPVIETPASNDSSKEERPELVKKVYKWNTKEEAKQAFKELLKEKGVSSNASWEQAMKLIINDPRYSALPKLSEKKQAFNAYKVQTEKEEKEEARIKYKESKETFQRFLENHEKMTSTTRYKKAEQMFGDQEVWSCVPERDRLEIYEDVLFYLAKKEKEQAKQLRKRNWEALKNILDNMANVTYRTTWSEAQQYLLDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQKFLDELHDHGQLHSMSAWMEMYPTISADIRFASMLGQPGSTPLDLFKFYVEDLKARYHDEKRIIKDILKDKGFLVEISTSFEDFGSVISSDKRATTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKEAAFKSMLKQATPPLEPEASWEGVRERFLKEAAFEDITLESERKRIFKDFMHVL 631          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Cavefish
Match: ENSAMXT00000053110.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002066.1:1764:7823:-1 gene:ENSAMXG00000037413.1 transcript:ENSAMXT00000053110.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 9.675e-27
Identity = 49/75 (65.33%), Postives = 62/75 (82.67%), Query Frame = 1
Query:  196 AWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAE 420
             WTEH + DG+TYYYN  TKQSTWEKPDELK+PAE++LS+CPWKE+KS+ GK YYYN+ +++S W KP EL + E
Sbjct:   79 VWTEHKSLDGKTYYYNTETKQSTWEKPDELKSPAEQMLSKCPWKEYKSDTGKPYYYNSQSKESRWTKPKELEDLE 153          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Cavefish
Match: tcerg1a (transcription elongation regulator 1 [Source:NCBI gene;Acc:103038555])

HSP 1 Score: 69.3218 bits (168), Expect = 1.398e-11
Identity = 71/298 (23.83%), Postives = 134/298 (44.97%), Query Frame = 1
Query:  316 CPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSM---PSSSD-------------KVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRF 1158
             PW    +   ++++YN  T+ S+W++P EL        G  D  D  I E      P     +D   K   G +   P++++             KV   KDS SE E      +    +     +E     ++ +L E  V   +TWE  +  I  DPRY  L    ++KQ+F+ Y   R ++ER+E R +I +AK+D  K +M  ++L     + +  +  +    + A+ + +DR  I+ + +  + K+EK+ +K   ++  + F E+L    ++  +  W + +  +  +PR+
Sbjct:  467 TPWCVVWTGDERVFFYNPTTRMSMWERPEELV-------GRADV-DKSIQE------PPHKKGLDNGPKLVFGKLEQEPAATEDTSEDEPSRAKKRKVEERKDSDSEKEAAMEAELRAARERAVVPQETRMSQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNP-KERKQVFDQYVKTRAEEERKEKRNKIMQAKDDFRK-MMEEARLGVRTTFSEFAAKHARDSRFKAIDKMKDREAIFIEFMTSLRKKEKDNSKNRGEKVKQDFFELLSDY-HVDGQQRWSKVKEKMETDPRY 747          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Cavefish
Match: tcerg1a (transcription elongation regulator 1 [Source:NCBI gene;Acc:103038555])

HSP 1 Score: 69.3218 bits (168), Expect = 1.460e-11
Identity = 71/298 (23.83%), Postives = 134/298 (44.97%), Query Frame = 1
Query:  316 CPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSM---PSSSD-------------KVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRF 1158
             PW    +   ++++YN  T+ S+W++P EL        G  D  D  I E      P     +D   K   G +   P++++             KV   KDS SE E      +    +     +E     ++ +L E  V   +TWE  +  I  DPRY  L    ++KQ+F+ Y   R ++ER+E R +I +AK+D  K +M  ++L     + +  +  +    + A+ + +DR  I+ + +  + K+EK+ +K   ++  + F E+L    ++  +  W + +  +  +PR+
Sbjct:  446 TPWCVVWTGDERVFFYNPTTRMSMWERPEELV-------GRADV-DKSIQE------PPHKKGLDNGPKLVFGKLEQEPAATEDTSEDEPSRAKKRKVEERKDSDSEKEAAMEAELRAARERAVVPQETRMSQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNP-KERKQVFDQYVKTRAEEERKEKRNKIMQAKDDFRK-MMEEARLGVRTTFSEFAAKHARDSRFKAIDKMKDREAIFIEFMTSLRKKEKDNSKNRGEKVKQDFFELLSDY-HVDGQQRWSKVKEKMETDPRY 726          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Sea Lamprey
Match: prpf40a (PRP40 pre-mRNA processing factor 40 homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-274])

HSP 1 Score: 471.085 bits (1211), Expect = 1.044e-153
Identity = 282/613 (46.00%), Postives = 386/613 (62.97%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNND---TSDNEINENNTTDKPKESSAID-EAIKATLGSMPSSSDKVNSHKDSSS---------------EDEV--------------------NPAHNIPI-----------PEKVVY--RTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKS------HDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            WTEH + DGRTY+YN  TKQSTWEKP ELK+P E +++ CPWKE+KS+ GK Y+YN  T++S W KP EL + E +   + D   T ++ +      + P  ++    +A   T GS  +SS   N    S++               +D V                    N    +P             EK VY   TKEE  + ++ +LK+  VP +A+WE A+KMI  DPRY  L K ++KKQ +N YKTQR K+E+EEARLR K+AK+ L++FL  H KL+S + YRKA+ +      W  V ERDR EIYED +  + K+EKEEAK LRKRNI+    ILD M ++TF+TTW EAQ+ L++NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EE+KE+ + R +RMQRKNRE F +F+DELH  GKL S+S W DLY  +S D RF +ML QPGSTPLDLFKFYV +LK+R+ +EK+I+K++L+D+NF  +  T+ E F  +I  D+R  TLD GNV++A+ SLIE+AE+ EK+R KE  ++QK+ E  F+ MLK       HD K    W++V  +  N   F  + +ES+R++ +KEY+  +
Sbjct:  114 WTEHKSPDGRTYFYNSDTKQSTWEKPLELKSPGEMLVASCPWKEYKSDTGKPYFYNAQTKESRWTKPKELEDLENMIKAHEDSGSTGESCLRHRGQMELPVPAAVTTVQAASGTPGSTGTSSPVENGASPSAAGTTSALPPSADGTPQQDGVSLAAGGAVTATASANAVAMGNATATVPPVIVVKEDGRKKKEKKVYTWNTKEEARQAFKDLLKDKKVPASASWEQAMKMIINDPRYSALPKLSEKKQAYNAYKTQRDKEEKEEARLRAKEAKDRLQRFLETHEKLNSYVKYRKAEQMFGSMEVWNNVQERDRNEIYEDVIFFLAKKEKEEAKRLRKRNIQALKSILDSMTSVTFRTTWSEAQQHLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEDKEKGRLRERRMQRKNRELFQLFLDELHNNGKLHSMSTWMDLYPAVSADIRFSRMLGQPGSTPLDLFKFYVEDLKARYHEEKKIIKDVLKDKNFMVEVKTTFEEFASLISSDKRAVTLDAGNVKLAFNSLIEKAEAREKEREKEEARKQKRKEAAFRNMLKQATPPLEHDSK----WDDVRDRFVNDSAFDQITVESERIRLFKEYVGAL 722          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007694.1 (pep scaffold:Pmarinus_7.0:GL498339:535:2562:-1 gene:ENSPMAG00000006952.1 transcript:ENSPMAT00000007694.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.200e-7
Identity = 22/34 (64.71%), Postives = 25/34 (73.53%), Query Frame = 1
Query:  187 PEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELK 288
            P   WTEH   DGRTYYYN+ T +STWEKP EL+
Sbjct:  314 PSAEWTEHKTADGRTYYYNIRTLESTWEKPAELR 347          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Sea Lamprey
Match: tcerg1a (transcription elongation regulator 1a (CA150) [Source:ZFIN;Acc:ZDB-GENE-030131-1791])

HSP 1 Score: 49.2914 bits (116), Expect = 3.053e-6
Identity = 53/190 (27.89%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  676 ILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYK---TQRQKDERE---------EARLR-----IKKAKEDLEKFL---MNHSKLSSAIGYRKADSLLSDCPEWTAVPERD-RREIYED------TLIQMGKREK---EEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPR 1155
            +L E ++ G + W  A + + GD R+Q ++   Q+++ F  +    TQ    ERE         EA LR     ++KA+ +  + +       K   AI + KA  LLSD    + V   D RR + +D      +L+   ++EK   E    L KR  + F ++LD    +T  +TW E ++++ E+PR
Sbjct:  302 LLMEQHLDGQSRWTKARERMEGDTRFQAVESSGQREEWFRQHVEKLTQAGDSERERELERQARTEASLREREREVQKARSEQTREIDREREQHKREEAIQHFKA--LLSDMVRSSEVNWDDTRRSLRKDHRWELASLLDRSEKEKLFKEHVDALSKRKKEQFKQLLDETSEITLTSTWREVRKLIKEDPR 489          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Sea Lamprey
Match: tcerg1a (transcription elongation regulator 1a (CA150) [Source:ZFIN;Acc:ZDB-GENE-030131-1791])

HSP 1 Score: 49.2914 bits (116), Expect = 3.170e-6
Identity = 53/190 (27.89%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  676 ILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYK---TQRQKDERE---------EARLR-----IKKAKEDLEKFL---MNHSKLSSAIGYRKADSLLSDCPEWTAVPERD-RREIYED------TLIQMGKREK---EEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPR 1155
            +L E ++ G + W  A + + GD R+Q ++   Q+++ F  +    TQ    ERE         EA LR     ++KA+ +  + +       K   AI + KA  LLSD    + V   D RR + +D      +L+   ++EK   E    L KR  + F ++LD    +T  +TW E ++++ E+PR
Sbjct:  295 LLMEQHLDGQSRWTKARERMEGDTRFQAVESSGQREEWFRQHVEKLTQAGDSERERELERQARTEASLREREREVQKARSEQTREIDREREQHKREEAIQHFKA--LLSDMVRSSEVNWDDTRRSLRKDHRWELASLLDRSEKEKLFKEHVDALSKRKKEQFKQLLDETSEITLTSTWREVRKLIKEDPR 482          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Yeast
Match: PRP40 (U1 snRNP protein involved in splicing; interacts with the branchpoint-binding protein during the formation of the second commitment complex [Source:SGD;Acc:S000001495])

HSP 1 Score: 142.895 bits (359), Expect = 3.637e-36
Identity = 148/521 (28.41%), Postives = 251/521 (48.18%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDT-SDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMIS----GDPRYQELKKYN-QKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEW--TAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILL-----ENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLE----SFLKVIEIDERGRTLDPGNVRMAYTSLI-ERAESIEK--QRLKEVLKQQK 1701
            W E     GR YYYN +TK+STWEKP EL +  E +L E  WK  K+  GK+YYYN  T+++ W  P    + E +A   +DT S  ++N N               I  T G        +N       E+E   A+N  +   V  RTKEE E+ +  +LKE  V  ++TW  + ++IS     DPRY  +      KK++F  Y + R  D+  +      K KE  +K L N+S +     +  A  L++D P +  + V E+ +R+ ++D +  +   +KE  K L+ + +K   E L+ +   +   T+   Q++L      ++ R++ +   + +  ED L  + + +  +E D + +    + R     R  R+ F   + E+    K+ + + W D+Y  I  D RF  ML + GS+ LDLF  +V E +     ++ I ++ L D+NF ++   S E    +  KV+E D +   +D  ++ +    LI +R E I++  Q  + +L+Q+K
Sbjct:    4 WKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKKVEPIAEQKHDTVSHAQVNGNR--------------IALTAGEKQEPGRTIN-------EEESQYANNSKLL-NVRRRTKEEAEKEFITMLKENQV--DSTWSFS-RIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNRSADQLLKEHNETSKFKEAFQKMLQNNSHIKYYTRWPTAKRLIADEPIYKHSVVNEKTKRQTFQDYIDTLIDTQKESKKKLKTQALKELREYLNGIITTSSSETFITWQQLLNHYVFDKSKRYMANRHFKVLTHEDVLNEYLKIVNTIENDLQNKLNELRLRNYTRDRIARDNFKSLLREV--PIKIKANTRWSDIYPHIKSDPRFLHMLGRNGSSCLDLFLDFVDEQRMYIFAQRSIAQQTLIDQNFEWNDADSDEITKQNIEKVLENDRKFDKVDKEDISLIVDGLIKQRNEKIQQKLQNERRILEQKK 497          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Nematostella
Match: EDO30814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZQ3])

HSP 1 Score: 95.1301 bits (235), Expect = 9.705e-24
Identity = 43/71 (60.56%), Postives = 56/71 (78.87%), Query Frame = 1
Query:  202 TEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAE 414
            TEH A DGRTY+YN  +K STW+KPDELKTP+E IL   PWKE K++ G++YY+NT T++S+W +P EL E
Sbjct:    2 TEHKAPDGRTYFYNNDSKVSTWQKPDELKTPSEIILDSFPWKEHKADSGRVYYHNTETKESIWTEPKELTE 72          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Nematostella
Match: EDO30257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A4])

HSP 1 Score: 83.5741 bits (205), Expect = 3.780e-17
Identity = 48/116 (41.38%), Postives = 79/116 (68.10%), Query Frame = 1
Query: 1522 DRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            D N T D ++S   F ++++ D+R  TLDPGN++MA+  LIE+AE+ EK+R K+  K+Q++ E  FKQMLK  S  ++++ SWEEV ++      F  + LE+DR++ ++EYL ++
Sbjct:    1 DCNITVDTDSSFSDFSELVQCDKRSATLDPGNIKMAFNHLIEKAEAREKERQKKEEKEQRRKESAFKQMLKAFSPALEATSSWEEVRERCEADSSFSAITLEADRIRIFQEYLASL 116          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Nematostella
Match: EDO30813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZQ2])

HSP 1 Score: 68.5514 bits (166), Expect = 1.523e-14
Identity = 32/65 (49.23%), Postives = 47/65 (72.31%), Query Frame = 1
Query:  634 VYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDER 828
            +Y TK+E ++ ++ +LKE  V   A+W+TA+++I  DPRY  LKK N+KKQ FN YKTQR  +E+
Sbjct:    5 IYATKDEAKQAFKELLKEKEVSPAASWDTAMRLIVNDPRYGALKKMNEKKQAFNEYKTQRANEEK 69          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Nematostella
Match: EDO43130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN2])

HSP 1 Score: 61.2326 bits (147), Expect = 1.410e-9
Identity = 79/340 (23.24%), Postives = 154/340 (45.29%), Query Frame = 1
Query:  277 DELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESS----AIDEAIKATLGSM----------PSSSDKVNSHKDSSSEDEVNPAHNIPI---PEKVVYRTK----EELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRRE-IYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVM--PNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHI 1224
            D  K  A +++    W    +  GK +++N  T+ SVW+KP EL + +K+         +EI EN    + ++S     ++D+A +    S           P S+      KD    + + PA +       EK     K    +E  + +R ++ E  V   +TWE  +  I  DPRY  L +  ++KQ F  +   R  +ER+E + ++K+ K+   K ++   K++    + +          +  + +   RE I+ + + ++ K+EKE +K+   +N KL ++  +++   NL     W + +  + ++PR+   E + +  KED  + F E +
Sbjct:  255 DRSKPVASELVPGTTWCVVWTGTGKAFFFNPATRLSVWEKPEELKDNDKV---------DEIIENGPPSREEKSKSRKLSLDDADEHQAASKRPRRESRDEPPQSTSSDVEMKDEPLREPLPPAKHTKAHRKEEKAARDRKMLPLDERMKQFREMMLERGVSAFSTWEKELPKIVFDPRYLLLNQ-KERKQCFEKFVRTRADEERQERKNKMKEKKDSF-KAMLQEMKVTVKTSFSEFAMKHGKEERFKQIEKMKERETIFLEYISELKKKEKETSKI---KNTKLHDDFFELLEEQNLEAGANWRKVKSKIEDDPRYKAVESVST--KEDYFMQFMEEL 578          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Medaka
Match: prpf40a (pre-mRNA processing factor 40 homolog A [Source:NCBI gene;Acc:101172539])

HSP 1 Score: 449.129 bits (1154), Expect = 8.316e-145
Identity = 265/597 (44.39%), Postives = 381/597 (63.82%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGN-NDTSDNEINENNTTDKP----------------------------KESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPI-------PE--KVVYR--TKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLK--SHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTI 1863
            WTEH + DG+TYYYN  TKQSTWEKPD+LK+PAE++LS+C WKE+KS+ GK YYYN+ T++S W KP EL + E +     N T++       T   P                              ++ + E + + +   P++  K       S+E      +   +       PE  K  Y+  TKEE ++ ++ +LKE  V  N++WE A+K+I  DPRY  L K ++KKQ FN YK Q +K+E+EEAR++ K++KE  ++FL NH K++S   Y+KA+ +  +   W+ VPERDR EIYED L  + K+EKE+AK LRKRN +    ILD M N+T++TTW EAQ+ LL+NP F EDE+LQ+MDKEDALICFEEHIR LEK+ EEEK++   R +R QRKNRE+F  F+DELH+ G+L S+S W ++Y  +S D RF  ML QPGSTPLDLFKFYV +LK+R+  EKRI+K+IL+D++F  + NTS + F  +I  D+R  TLD GN+++A+ SL+E+AE+ E++R KE  ++ K+ E  FK MLK  +  ++    WE V ++      F+ + LES+R + +K+++  +
Sbjct:  117 WTEHKSLDGKTYYYNTETKQSTWEKPDDLKSPAEQLLSKCHWKEYKSDTGKPYYYNSQTKESRWTKPKELEDLEAMIKAEENGTAETAAVTPGTAATPTVQADNTATLAAVTEVETTTAVATAAAAAAAAVVSEELPSQVSVHPAAEVKTTDAPVVSTESSAVTENTASVKVTKEEPPEIQKKTYKWNTKEEAKQAFKELLKEKGVSSNSSWEQAMKLIINDPRYSALPKLSEKKQAFNAYKVQTEKEEKEEARIKYKESKETFQRFLENHEKMTSTTRYKKAEQMFGELEVWSCVPERDRLEIYEDVLFFLAKKEKEQAKQLRKRNWEALKNILDNMANVTYRTTWSEAQQYLLDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQKFLDELHDHGQLHSMSSWMEMYPALSSDMRFANMLGQPGSTPLDLFKFYVEDLKARYHDEKRIIKDILKDKSFMVEVNTSFDDFGSIISSDKRAATLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKEAAFKTMLKQATPPLEPEALWEGVRERFVKEAAFEDITLESERKRIFKDFMHVL 713          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Medaka
Match: ENSORLT00000004049.2 (WW domain binding protein 4 [Source:NCBI gene;Acc:101161956])

HSP 1 Score: 57.7658 bits (138), Expect = 2.826e-8
Identity = 30/80 (37.50%), Postives = 41/80 (51.25%), Query Frame = 1
Query:  199 WTEHIAQDGRTYYYNLITKQSTWEKPDELK------TPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAE 420
            W E  A++G  YYYN IT +S WEKP +         P E+  S   W    S +G  YYYN  T +S W+KP + +  +
Sbjct:  139 WVEGFAENGHMYYYNTITGESQWEKPADPPGEPSTFVPPERSFSSA-WMPAVSPEGFTYYYNPETGESSWEKPADFSSGD 217          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Medaka
Match: TCERG1 (transcription elongation regulator 1 [Source:NCBI gene;Acc:101160257])

HSP 1 Score: 54.6842 bits (130), Expect = 3.754e-7
Identity = 78/335 (23.28%), Postives = 148/335 (44.18%), Query Frame = 1
Query:  169 NSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDEL--KTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPN--LTFKTTWYEAQRILLENPRF 1158
            N +P  P   W      D R ++YN  T+ S W++P+EL  +   +K + E P K    E GK        +  V ++ P+L+         N T D                 +DE              + ++ K+++ E E+  A      E+ +   +  + + +R +L E  V   +TW+  +  I  DPRY  L    ++KQ+F+ Y   R ++ER+E + ++ +AK++  K +M  +KL+    + +        P +  + + +DR  I+ + +  M KREKE++K    R  K+  +  D++ +  +     W + +  L  +PR+
Sbjct:  446 NPIPGTP---WCVVWTGDDRVFFYNPTTRLSMWDRPEELVGRADVDKHIQEPPHKR-GVEDGK--------KTGVIKEEPDLS---------NATED----------------ILDEEPSKAKKRKKEEQKESDTEKEAAMEAELKAAR-----ERAIVPLESRMTQ-FREMLLERGVSAFSTWDKELHKIVFDPRYLLLNP-KERKQVFDQYVKTRAEEERKEKKNKLMQAKDEFRK-MMEDAKLTPRTTFSEFALKHGRDPRFKTIEKMKDREAIFIEFMTAMRKREKEDSK---SRGEKVRQDFFDLLSDQHIDGNHRWSKVKERLETDPRY 732          

HSP 2 Score: 51.6026 bits (122), Expect = 3.834e-6
Identity = 31/77 (40.26%), Postives = 41/77 (53.25%), Query Frame = 1
Query:   49 FGIILNGIEISMSNNYQFTLPPL-THSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKP 276
            F + L G+ I +        PP+ +  +P       P S+  SL  LPE  WTE+   DG+TYYYN  T +STWEKP
Sbjct:  309 FRVPLPGMHIPLPGMLPGMGPPIVSMMHPQLALSAAPASMAGSL-HLPE--WTEYKTADGKTYYYNNRTLESTWEKP 382          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Medaka
Match: TCERG1 (transcription elongation regulator 1 [Source:NCBI gene;Acc:101160257])

HSP 1 Score: 54.6842 bits (130), Expect = 4.590e-7
Identity = 78/335 (23.28%), Postives = 148/335 (44.18%), Query Frame = 1
Query:  169 NSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDEL--KTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPN--LTFKTTWYEAQRILLENPRF 1158
            N +P  P   W      D R ++YN  T+ S W++P+EL  +   +K + E P K    E GK        +  V ++ P+L+         N T D                 +DE              + ++ K+++ E E+  A      E+ +   +  + + +R +L E  V   +TW+  +  I  DPRY  L    ++KQ+F+ Y   R ++ER+E + ++ +AK++  K +M  +KL+    + +        P +  + + +DR  I+ + +  M KREKE++K    R  K+  +  D++ +  +     W + +  L  +PR+
Sbjct:  466 NPIPGTP---WCVVWTGDDRVFFYNPTTRLSMWDRPEELVGRADVDKHIQEPPHKR-GVEDGK--------KTGVIKEEPDLS---------NATED----------------ILDEEPSKAKKRKKEEQKESDTEKEAAMEAELKAAR-----ERAIVPLESRMTQ-FREMLLERGVSAFSTWDKELHKIVFDPRYLLLNP-KERKQVFDQYVKTRAEEERKEKKNKLMQAKDEFRK-MMEDAKLTPRTTFSEFALKHGRDPRFKTIEKMKDREAIFIEFMTAMRKREKEDSK---SRGEKVRQDFFDLLSDQHIDGNHRWSKVKERLETDPRY 752          
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Medaka
Match: TCERG1 (transcription elongation regulator 1 [Source:NCBI gene;Acc:101160257])

HSP 1 Score: 54.6842 bits (130), Expect = 4.608e-7
Identity = 78/335 (23.28%), Postives = 148/335 (44.18%), Query Frame = 1
Query:  169 NSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDEL--KTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPE-RDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPN--LTFKTTWYEAQRILLENPRF 1158
            N +P  P   W      D R ++YN  T+ S W++P+EL  +   +K + E P K    E GK        +  V ++ P+L+         N T D                 +DE              + ++ K+++ E E+  A      E+ +   +  + + +R +L E  V   +TW+  +  I  DPRY  L    ++KQ+F+ Y   R ++ER+E + ++ +AK++  K +M  +KL+    + +        P +  + + +DR  I+ + +  M KREKE++K    R  K+  +  D++ +  +     W + +  L  +PR+
Sbjct:  482 NPIPGTP---WCVVWTGDDRVFFYNPTTRLSMWDRPEELVGRADVDKHIQEPPHKR-GVEDGK--------KTGVIKEEPDLS---------NATED----------------ILDEEPSKAKKRKKEEQKESDTEKEAAMEAELKAAR-----ERAIVPLESRMTQ-FREMLLERGVSAFSTWDKELHKIVFDPRYLLLNP-KERKQVFDQYVKTRAEEERKEKKNKLMQAKDEFRK-MMEDAKLTPRTTFSEFALKHGRDPRFKTIEKMKDREAIFIEFMTAMRKREKEDSK---SRGEKVRQDFFDLLSDQHIDGNHRWSKVKERLETDPRY 768          
BLAST of Pre-mRNA-processing factor 40 vs. Planmine SMEST
Match: SMESG000044274.1 (SMESG000044274.1)

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 732/734 (99.73%), Postives = 732/734 (99.73%), Query Frame = 1
Query:   82 MSNNYQFTLPPLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIXXXXXXXXXXXXXXXXXXXXXXXXNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSSREHKTNXXXXXXXXXXXXXXXXXXXXXXNNGTEDDSXXXXXXXXXXXXXXXXXXHNRQDSSSDEMGPTATVGQKPVDARQPSEGEVIDEDEPEPRQALNHPKAIVSSSAEMS 2283
            MSNNYQFTLPPLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIRLLEKDHEEEKEREKRRLKRMQRKNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHDIKSSVSWEEVCQKLGNLEDFK VELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSSREHKTNRDKPKRKKKKHSRDSSADSKDKNNGTEDDSKGKYKLHKKSKKKKKKRKHNRQDSSSDEMGPTATVGQKPVDARQPSEGEVIDEDEPEPRQ LNHPKAIVSSSAEMS
Sbjct:    1 MSNNYQFTLPPLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVILKELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDEREEARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDRREIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQRILLENPRFVEDEDLQSMDKEDALICFEEHIRLLEKDHEEEKEREKRRLKRMQRKNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPGSTPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIEIDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQMLKSHDIKSSVSWEEVCQKLGNLEDFKSVELESDRMKYYKEYLLTIRSRSRSKFSQEIKRKRKHRSNSKESVSSREHKTNRDKPKRKKKKHSRDSSADSKDKNNGTEDDSKGKYKLHKKSKKKKKKRKHNRQDSSSDEMGPTATVGQKPVDARQPSEGEVIDEDEPEPRQVLNHPKAIVSSSAEMS 734          
BLAST of Pre-mRNA-processing factor 40 vs. Planmine SMEST
Match: SMESG000011919.1 (SMESG000011919.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.107e-7
Identity = 59/212 (27.83%), Postives = 83/212 (39.15%), Query Frame = 1
Query:  109 PPLTHSYPVPTSYLPPTSVQN-------------SLPTLPEQ-AWTEHIAQDGRTYYYNLITKQSTWEKPDEL--------------KTPAEKILSECP--------------------WKEFKSEQGKIYYYNTVTQQSVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATLGSMPSSSDKVNSHKDSSSEDEVN 600
            PP  H  P      PP  +               +L TL EQ  W ++   DGR YYY   T+Q+TW++P  +              K PA   +S  P                    W E+K+  G+ Y++N  T  + W+KP  L + E           N+IN      KP E + I E  K+   S+    +KV+  KD SS DE N
Sbjct:  377 PPFAHMPPPMMGQAPPLPMHPDPNFGGNKVDKPLTLATLNEQDVWVQNPTSDGRIYYYQWKTRQTTWDRPQGVKIIIQSELDNILANKNPA--TISSAPVQLLIPNIAPQPTKPPEVVEWNEYKAPDGRPYFHNRRTAVTTWEKPQVLIDWE-----------NKIN----GVKPAEPAPIPE--KSISKSVEIEENKVDDSKDESS-DESN 568          
BLAST of Pre-mRNA-processing factor 40 vs. Planmine SMEST
Match: SMESG000013095.1 (SMESG000013095.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.917e-6
Identity = 37/138 (26.81%), Postives = 62/138 (44.93%), Query Frame = 1
Query:  166 QNSLPTLPEQAWTEHIAQDGRTYYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQSVWQKPPELA---EAEKLAYGNNDTSDNEINENNTT-DKPKESSAIDEAIKATLGSMPSSSDKVNS 567
            +NS   +    W E + Q+GR YY +  +K++ WEKP   + P         W+E     G++YY +   Q++ W+ P   +   +  KLA  N   ++N ++    +  +P  SS +D A         S  D V S
Sbjct:  203 ENSTAEVLANGWEERVDQNGRIYYVDHKSKRTQWEKPTNAQLPEG-------WEERADLSGRVYYVDHANQKTQWEHPASKSAPQKVNKLAKINMPAANNPLSVRAVSPTRPGPSSDVDAATMFLRRRQISHEDTVAS 333          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPF40A3.928e-11449.88pre-mRNA processing factor 40 homolog A [Source:HG... [more]
PRPF40B1.170e-11146.17pre-mRNA processing factor 40 homolog B [Source:HG... [more]
PRPF40B2.596e-11146.17pre-mRNA processing factor 40 homolog B [Source:HG... [more]
PRPF40B5.475e-10645.50pre-mRNA processing factor 40 homolog B [Source:HG... [more]
PRPF40A4.820e-2855.67pre-mRNA processing factor 40 homolog A [Source:HG... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZK1098.15.339e-12539.29WW domain-containing protein ZK1098.1 [Source:Uni... [more]
ZK1098.15.097e-6642.58WW domain-containing protein ZK1098.1 [Source:Uni... [more]
tcer-11.546e-1225.41TransCription Elongation Regulator homolog [Sourc... [more]
tcer-11.546e-1225.41TransCription Elongation Regulator homolog [Sourc... [more]
tcer-11.546e-1225.41TransCription Elongation Regulator homolog [Sourc... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG35422.749e-14644.58gene:FBgn0031492 transcript:FBtr0077648[more]
CG427241.522e-1022.63gene:FBgn0261641 transcript:FBtr0334545[more]
CG427241.522e-1022.63gene:FBgn0261641 transcript:FBtr0303013[more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prpf40a1.644e-15347.69PRP40 pre-mRNA processing factor 40 homolog A [Sou... [more]
CU929230.14.828e-1424.69transcription elongation regulator 1b (CA150) [Sou... [more]
TCERG1L6.994e-822.61transcription elongation regulator 1 like [Source:... [more]
arhgap12a6.786e-636.62Rho GTPase activating protein 12a [Source:ZFIN;Acc... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPF40B1.267e-15848.10pre-mRNA processing factor 40 homolog B [Source:NC... [more]
PRPF40B2.919e-15848.10pre-mRNA processing factor 40 homolog B [Source:NC... [more]
PRPF40B5.138e-15847.30pre-mRNA processing factor 40 homolog B [Source:NC... [more]
PRPF40B5.500e-15748.10pre-mRNA processing factor 40 homolog B [Source:NC... [more]
PRPF40B7.200e-15749.48pre-mRNA processing factor 40 homolog B [Source:NC... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prpf40a1.706e-11547.77pre-mRNA processing factor 40A [Source:MGI Symbol;... [more]
Prpf40a3.013e-11547.77pre-mRNA processing factor 40A [Source:MGI Symbol;... [more]
Prpf40a4.363e-11547.45pre-mRNA processing factor 40A [Source:MGI Symbol;... [more]
Prpf40b3.467e-11346.31pre-mRNA processing factor 40B [Source:MGI Symbol;... [more]
Prpf40b8.449e-11346.21pre-mRNA processing factor 40B [Source:MGI Symbol;... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34600|YO61_CAEEL6.792e-12439.29WW domain-containing protein ZK1098.1 OS=Caenorhab... [more]
sp|Q9R1C7|PR40A_MOUSE3.052e-11447.45Pre-mRNA-processing factor 40 homolog A OS=Mus mus... [more]
sp|Q80W14|PR40B_MOUSE9.835e-11446.21Pre-mRNA-processing factor 40 homolog B OS=Mus mus... [more]
sp|O75400|PR40A_HUMAN3.557e-11349.52Pre-mRNA-processing factor 40 homolog A OS=Homo sa... [more]
sp|Q6NWY9|PR40B_HUMAN1.246e-11046.17Pre-mRNA-processing factor 40 homolog B OS=Homo sa... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DGA90.000e+050.23Pre-mRNA-processing factor 40 OS=Schistosoma japon... [more]
A0A504YY660.000e+048.86Pre-mRNA-processing factor A OS=Fasciola gigantica... [more]
A0A4E0R1130.000e+048.62Pre-mRNA-processing factor A OS=Fasciola hepatica ... [more]
H2KUZ30.000e+048.87Pre-mRNA-processing factor 40 OS=Clonorchis sinens... [more]
A0A4S2MFX10.000e+048.79Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpf40a7.008e-12543.98PRP40 pre-mRNA processing factor 40 homolog A [Sou... [more]
prpf40a1.916e-12443.98PRP40 pre-mRNA processing factor 40 homolog A [Sou... [more]
ENSAMXT00000053110.19.675e-2765.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tcerg1a1.398e-1123.83transcription elongation regulator 1 [Source:NCBI ... [more]
tcerg1a1.460e-1123.83transcription elongation regulator 1 [Source:NCBI ... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prpf40a1.044e-15346.00PRP40 pre-mRNA processing factor 40 homolog A [Sou... [more]
ENSPMAT00000007694.11.200e-764.71pep scaffold:Pmarinus_7.0:GL498339:535:2562:-1 gen... [more]
tcerg1a3.053e-627.89transcription elongation regulator 1a (CA150) [Sou... [more]
tcerg1a3.170e-627.89transcription elongation regulator 1a (CA150) [Sou... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PRP403.637e-3628.41U1 snRNP protein involved in splicing; interacts w... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO308149.705e-2460.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302573.780e-1741.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308131.523e-1449.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431301.410e-923.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpf40a8.316e-14544.39pre-mRNA processing factor 40 homolog A [Source:NC... [more]
ENSORLT00000004049.22.826e-837.50WW domain binding protein 4 [Source:NCBI gene;Acc:... [more]
TCERG13.754e-723.28transcription elongation regulator 1 [Source:NCBI ... [more]
TCERG14.590e-723.28transcription elongation regulator 1 [Source:NCBI ... [more]
TCERG14.608e-723.28transcription elongation regulator 1 [Source:NCBI ... [more]
back to top
BLAST of Pre-mRNA-processing factor 40 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000044274.10.000e+099.73SMESG000044274.1[more]
SMESG000011919.11.107e-727.83SMESG000011919.1[more]
SMESG000013095.11.917e-626.81SMESG000013095.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029911 ID=SMED30029911|Name=Pre-mRNA-processing factor 40|organism=Schmidtea mediterranea sexual|type=transcript|length=2474bp
TAATACTAATAATTAAATGTCTTAAATTATTTGTTTTAAAAAACGATATT
TGGTATCATTTTGAATGGTATAGAAATATCTATGTCAAATAATTATCAGT
TTACTCTTCCTCCATTAACTCATAGCTATCCAGTACCTACAAGTTATTTA
CCTCCAACAAGTGTTCAGAATTCTTTGCCGACACTTCCAGAACAAGCATG
GACTGAACATATTGCACAAGATGGAAGGACTTATTACTATAATTTAATTA
CTAAACAATCAACATGGGAAAAACCAGATGAATTAAAAACTCCCGCTGAA
AAAATTTTATCTGAATGTCCTTGGAAAGAGTTCAAATCAGAACAAGGAAA
AATATATTATTATAACACAGTTACTCAGCAATCCGTTTGGCAGAAGCCCC
CAGAGCTTGCGGAAGCTGAGAAATTAGCCTATGGAAATAATGATACTTCA
GATAATGAAATTAATGAAAACAATACGACAGATAAACCAAAAGAATCGTC
TGCCATAGACGAAGCAATTAAAGCGACTTTGGGTTCAATGCCTTCATCAT
CTGATAAAGTAAATTCTCATAAAGACTCAAGTTCTGAAGATGAAGTTAAT
CCAGCTCACAATATCCCGATTCCAGAAAAAGTGGTATATAGGACTAAAGA
GGAACTCGAGGAAGGTTGGCGAGTTATTCTTAAAGAGTTAAATGTACCTG
GAAATGCCACTTGGGAAACCGCAGTTAAAATGATATCTGGTGATCCCAGA
TATCAAGAATTGAAGAAATATAATCAAAAGAAGCAGATTTTTAATACATA
CAAAACTCAGAGACAAAAGGATGAGCGAGAAGAAGCCAGATTAAGAATTA
AAAAGGCTAAAGAAGATTTAGAAAAATTCTTAATGAATCATTCAAAACTA
TCGTCAGCGATCGGATACAGGAAAGCTGATTCACTTTTGAGTGATTGTCC
CGAATGGACGGCGGTTCCTGAAAGAGATAGACGTGAAATATATGAGGATA
CTTTGATTCAAATGGGAAAACGCGAGAAAGAAGAAGCAAAAGTATTAAGA
AAAAGAAATATTAAATTATTTAATGAAATACTTGATGTTATGCCAAATTT
AACTTTTAAAACAACTTGGTATGAAGCTCAACGAATTTTATTGGAAAATC
CACGATTTGTTGAGGATGAAGACTTGCAAAGTATGGATAAAGAAGACGCT
TTAATATGTTTTGAAGAACATATACGTTTATTGGAAAAAGATCACGAAGA
AGAAAAAGAAAGAGAAAAAAGGCGTCTTAAACGAATGCAACGAAAAAACC
GAGAAGCGTTTGCAGTTTTCATGGATGAATTACACGAAAAAGGCAAACTG
ACATCTCTGTCCATGTGGAAAGATTTATACGAAATCATTAGCAGGGATGA
ACGATTTTATAAGATGCTGTCACAGCCAGGTTCCACACCTTTGGATTTGT
TTAAATTCTATGTTCTCGAATTGAAGTCCCGTTTCTCCAAAGAAAAACGA
ATTGTTAAAGAAATCCTTGAAGACAGAAATTTCACTTTCGATTTTAACAC
ATCTCTGGAATCTTTCTTGAAAGTTATTGAAATCGATGAAAGAGGTCGAA
CTTTGGATCCGGGAAACGTTCGAATGGCATACACTAGTCTCATTGAACGG
GCAGAATCTATCGAAAAGCAACGATTAAAAGAAGTACTAAAACAACAGAA
GAAATCAGAATTCAATTTCAAGCAAATGCTGAAGTCTCACGACATTAAGA
GTTCTGTCAGTTGGGAAGAAGTCTGCCAGAAATTGGGGAATCTAGAAGAT
TTCAAATTCGTCGAACTGGAATCCGATAGAATGAAATATTACAAAGAATA
TCTCCTAACTATTCGCAGCCGGTCTAGGAGCAAGTTTTCCCAGGAAATCA
AACGGAAACGAAAGCACAGATCGAATTCAAAAGAAAGCGTTTCGAGTAGA
GAACACAAAACAAATCGTGACAAACCGAAGAGAAAGAAGAAAAAGCACAG
TCGAGACAGCTCAGCGGATTCGAAAGACAAAAATAACGGAACCGAGGATG
ATTCGAAAGGCAAATATAAACTCCATAAGAAATCGAAAAAGAAAAAGAAG
AAGCGAAAGCATAATCGACAGGATTCTTCATCCGATGAAATGGGACCGAC
TGCAACAGTTGGTCAAAAGCCGGTGGATGCTAGACAACCGTCAGAGGGAG
AAGTGATCGATGAGGATGAGCCGGAACCGAGGCAGGCATTGAATCATCCG
AAAGCAATTGTTTCATCATCAGCAGAAATGAGTGAGAATGAACTCGAAGC
AGAAAAGAACAAATTGTTGGCGGAATTGCAAAATTAATGTAAATTTACTG
TAATAATAATAATAATAATAATCCGTTTGTAAATGTGGTTTTCGCATTTA
ATACGTTTTTCAATAAAAAAACATTTCAGTCTGTATGCGTGTTTGTTTCT
AATGGAATAAATGATCTTTGAGGC
back to top

protein sequence of SMED30029911-orf-1

>SMED30029911-orf-1 ID=SMED30029911-orf-1|Name=SMED30029911-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=752bp
MSNNYQFTLPPLTHSYPVPTSYLPPTSVQNSLPTLPEQAWTEHIAQDGRT
YYYNLITKQSTWEKPDELKTPAEKILSECPWKEFKSEQGKIYYYNTVTQQ
SVWQKPPELAEAEKLAYGNNDTSDNEINENNTTDKPKESSAIDEAIKATL
GSMPSSSDKVNSHKDSSSEDEVNPAHNIPIPEKVVYRTKEELEEGWRVIL
KELNVPGNATWETAVKMISGDPRYQELKKYNQKKQIFNTYKTQRQKDERE
EARLRIKKAKEDLEKFLMNHSKLSSAIGYRKADSLLSDCPEWTAVPERDR
REIYEDTLIQMGKREKEEAKVLRKRNIKLFNEILDVMPNLTFKTTWYEAQ
RILLENPRFVEDEDLQSMDKEDALICFEEHIRLLEKDHEEEKEREKRRLK
RMQRKNREAFAVFMDELHEKGKLTSLSMWKDLYEIISRDERFYKMLSQPG
STPLDLFKFYVLELKSRFSKEKRIVKEILEDRNFTFDFNTSLESFLKVIE
IDERGRTLDPGNVRMAYTSLIERAESIEKQRLKEVLKQQKKSEFNFKQML
KSHDIKSSVSWEEVCQKLGNLEDFKFVELESDRMKYYKEYLLTIRSRSRS
KFSQEIKRKRKHRSNSKESVSSREHKTNRDKPKRKKKKHSRDSSADSKDK
NNGTEDDSKGKYKLHKKSKKKKKKRKHNRQDSSSDEMGPTATVGQKPVDA
RQPSEGEVIDEDEPEPRQALNHPKAIVSSSAEMSENELEAEKNKLLAELQ
N*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0045292mRNA cis splicing, via spliceosome
GO:0006400tRNA modification
GO:0006537glutamate biosynthetic process
GO:0006561proline biosynthetic process
GO:0008152metabolic process
GO:0009451RNA modification
GO:0043412macromolecule modification
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036517FF_domain_sf
IPR039726Prp40-like
IPR036020WW_dom_sf
IPR002713FF_domain
IPR001202WW_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
GO:00038421-pyrroline-5-carboxylate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016740transferase activity
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 242..269
NoneNo IPR availableCOILSCoilCoilcoord: 731..751
NoneNo IPR availableCOILSCoilCoilcoord: 374..412
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 26..73
e-value: 1.6E-15
score: 58.3
coord: 74..126
e-value: 2.3E-13
score: 51.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 599..740
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..142
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 118..176
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 642..662
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 602..616
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 663..678
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 703..719
NoneNo IPR availablePANTHERPTHR11864:SF20PRE-MRNA-PROCESSING FACTOR 40 HOMOLOG Acoord: 38..156
coord: 156..744
IPR001202WW domainSMARTSM00456ww_5coord: 35..67
e-value: 1.3E-10
score: 51.2
coord: 76..108
e-value: 2.1E-9
score: 47.3
IPR001202WW domainPFAMPF00397WWcoord: 79..106
e-value: 8.6E-9
score: 35.3
coord: 39..65
e-value: 8.0E-10
score: 38.6
IPR001202WW domainPROSITEPS01159WW_DOMAIN_1coord: 40..65
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 34..67
score: 13.339
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 80..108
score: 12.157
IPR001202WW domainCDDcd00201WWcoord: 40..67
e-value: 4.87373E-10
score: 52.9154
IPR001202WW domainCDDcd00201WWcoord: 79..108
e-value: 7.39226E-9
score: 49.4486
IPR002713FF domainSMARTSM00441FF_2coord: 189..243
e-value: 2.7E-5
score: 33.6
coord: 403..463
e-value: 2.0
score: 15.9
coord: 539..593
e-value: 0.063
score: 22.4
coord: 323..383
e-value: 7.6E-6
score: 35.4
IPR002713FF domainPFAMPF01846FFcoord: 327..380
e-value: 1.8E-4
score: 21.6
coord: 199..240
e-value: 1.2E-6
score: 28.6
coord: 405..460
e-value: 1.5E-7
score: 31.5
coord: 545..590
e-value: 5.6E-7
score: 29.7
IPR002713FF domainPROSITEPS51676FFcoord: 255..310
score: 7.563
IPR002713FF domainPROSITEPS51676FFcoord: 323..383
score: 9.451
IPR002713FF domainPROSITEPS51676FFcoord: 403..463
score: 9.56
IPR002713FF domainPROSITEPS51676FFcoord: 539..593
score: 10.299
IPR002713FF domainPROSITEPS51676FFcoord: 187..243
score: 8.487
IPR002713FF domainPROSITEPS51676FFcoord: 467..534
score: 6.995
IPR036517FF domain superfamilyGENE3DG3DSA:1.10.10.440coord: 392..473
e-value: 4.4E-11
score: 44.9
coord: 244..314
e-value: 9.8E-7
score: 31.0
coord: 315..391
e-value: 2.2E-12
score: 49.1
IPR036517FF domain superfamilyGENE3DG3DSA:1.10.10.440coord: 177..243
e-value: 1.6E-19
score: 71.5
IPR036517FF domain superfamilyGENE3DG3DSA:1.10.10.440coord: 535..603
e-value: 3.1E-11
score: 45.1
IPR036517FF domain superfamilySUPERFAMILYSSF81698FF domaincoord: 184..244
IPR036517FF domain superfamilySUPERFAMILYSSF81698FF domaincoord: 534..596
IPR036517FF domain superfamilySUPERFAMILYSSF81698FF domaincoord: 250..317
IPR036517FF domain superfamilySUPERFAMILYSSF81698FF domaincoord: 315..390
IPR036517FF domain superfamilySUPERFAMILYSSF81698FF domaincoord: 395..467
IPR039726Pre-mRNA-processing factor Prp40PANTHERPTHR11864PRE-MRNA-PROCESSING PROTEIN PRP40coord: 38..156
coord: 156..744
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 80..113
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 39..73