Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30029902
Length (bp)2323
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30029902) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30029902) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30029902) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30029902) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029902

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029902SMESG000074941.1 SmedASXL_017766SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029902SMESG000074943.1 SMESG000074941.1 dd_Smed_v4_6760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029902SMESG000074943.1 SMESG000074941.1 dd_Smed_v4_6760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30029902SMESG000074943.1 SMESG000074941.1 dd_Smed_v4_6760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029902SMESG000074943.1 SMESG000074941.1 dd_Smed_v4_6760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029902SMESG000074943.1 SMESG000074941.1 dd_Smed_v4_6760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: PRKCQ (protein kinase C theta [Source:HGNC Symbol;Acc:HGNC:9410])

HSP 1 Score: 90.8929 bits (224), Expect = 2.568e-18
Identity = 61/230 (26.52%), Postives = 112/230 (48.70%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     +   +Q  +N++  ME ++ G L  ++      D+     ++ +I+ GL++LH   IV RDL    IL+D++  IK+  F + K          +K++ F G +  Y APE+ L + YN   D WSFGV+L ++   + PF     +E+    R+D   Y R+    +E   KD++ K   ++ E+
Sbjct:  284 KALKKDVVLMDDDV---------ECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGD----AKTNTFCG-TPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW----LEKEAKDLLVKLFVREPEK 495          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: PRKCQ (protein kinase C theta [Source:HGNC Symbol;Acc:HGNC:9410])

HSP 1 Score: 90.5077 bits (223), Expect = 4.395e-18
Identity = 61/230 (26.52%), Postives = 112/230 (48.70%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     +   +Q  +N++  ME ++ G L  ++      D+     ++ +I+ GL++LH   IV RDL    IL+D++  IK+  F + K          +K++ F G +  Y APE+ L + YN   D WSFGV+L ++   + PF     +E+    R+D   Y R+    +E   KD++ K   ++ E+
Sbjct:  373 KALKKDVVLMDDDV---------ECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGD----AKTNTFCG-TPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW----LEKEAKDLLVKLFVREPEK 584          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: PRKCQ (protein kinase C theta [Source:HGNC Symbol;Acc:HGNC:9410])

HSP 1 Score: 90.5077 bits (223), Expect = 5.326e-18
Identity = 61/230 (26.52%), Postives = 112/230 (48.70%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     +   +Q  +N++  ME ++ G L  ++      D+     ++ +I+ GL++LH   IV RDL    IL+D++  IK+  F + K          +K++ F G +  Y APE+ L + YN   D WSFGV+L ++   + PF     +E+    R+D   Y R+    +E   KD++ K   ++ E+
Sbjct:  409 KALKKDVVLMDDDV---------ECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGD----AKTNTFCG-TPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW----LEKEAKDLLVKLFVREPEK 620          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: FGFR2 (fibroblast growth factor receptor 2 [Source:HGNC Symbol;Acc:HGNC:3689])

HSP 1 Score: 87.0409 bits (214), Expect = 1.243e-17
Identity = 63/251 (25.10%), Postives = 118/251 (47.01%), Query Frame = 2
Query: 1457 GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFREN-EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD----------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQFPYN 2134
            G  LG   +  ++       DK   KE + +   ++ ++   ++   +V E+ + ++   ++  + LL    +D  +YV +E  S+G L+ YL    P  ++  +D                 + ++  G+EYL   K + RDL    +LV EN  +K+  F L++     +YY  +T  +      L V++ APE   +  Y  + D+WSFGV++ +I T    P+P +  +E+ K+    HR+D+ P N
Sbjct:   76 GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGR------LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK-PAN 319          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 87.4261 bits (215), Expect = 4.017e-17
Identity = 67/265 (25.28%), Postives = 124/265 (46.79%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAKD-----KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDERTSLILLKENFQT 2245
            LG   +  ++   LK +      KA KK+++L+  ++         E  + E R+  +   N     L+  +Q   +++  ME ++ G L  ++      ++     ++ +I+CGL++LH   I+ RDL    +L+D +  IK+  F + K   +      S++  F G +  Y APE+     Y    D WSFGV+L ++   + PF     DE+ +  R+D   Y R+ T+  +  L+ + E+  TK+   T  I +   F+T
Sbjct:  355 LGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDV---------ECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGE----SRASTFCG-TPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKT 605          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 82.0333 bits (201), Expect = 1.451e-16
Identity = 62/240 (25.83%), Postives = 119/240 (49.58%), Query Frame = 2
Query: 1442 LQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF----PDLSRDEIVKMHRLDQFPYNRYSTE 2149
            LQR++   LG+  +  +  EL+++    T    ++ + +I+   + ++  H+V E RI  +   N+  V++   Y+  + +Y+ ME    G +   L K    D  +   +    +  LEYLH+  IV RDL P  +L+D N   KL  F  +K  +        ++  F G +  Y APE+ LN+ ++   D+W+ G+ + ++ T   PF    P ++ + I+K   L+++ + R+ T+
Sbjct:   37 LQRVS--TLGMGGFGRV--ELVRSASSRTYALKIMNKAHIV---ETKQESHVVSERRIL-MQCDNDYIVRMYKTYRDSEKIYMLMEPCLGGEIWTILRKKGRFDNDLTRFYCAGAMEALEYLHRKNIVYRDLKPENMLLDRNGWPKLVDFGFAKKLK-----NGGRTWTFCG-TAEYVAPEIVLNKGHDLSVDIWALGIFMCELLTGSPPFSSTDPMVTYNAILK--GLEKWAWPRFVTK 260          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 82.0333 bits (201), Expect = 1.451e-16
Identity = 62/240 (25.83%), Postives = 119/240 (49.58%), Query Frame = 2
Query: 1442 LQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF----PDLSRDEIVKMHRLDQFPYNRYSTE 2149
            LQR++   LG+  +  +  EL+++    T    ++ + +I+   + ++  H+V E RI  +   N+  V++   Y+  + +Y+ ME    G +   L K    D  +   +    +  LEYLH+  IV RDL P  +L+D N   KL  F  +K  +        ++  F G +  Y APE+ LN+ ++   D+W+ G+ + ++ T   PF    P ++ + I+K   L+++ + R+ T+
Sbjct:   37 LQRVS--TLGMGGFGRV--ELVRSASSRTYALKIMNKAHIV---ETKQESHVVSERRIL-MQCDNDYIVRMYKTYRDSEKIYMLMEPCLGGEIWTILRKKGRFDNDLTRFYCAGAMEALEYLHRKNIVYRDLKPENMLLDRNGWPKLVDFGFAKKLK-----NGGRTWTFCG-TAEYVAPEIVLNKGHDLSVDIWALGIFMCELLTGSPPFSSTDPMVTYNAILK--GLEKWAWPRFVTK 260          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 82.0333 bits (201), Expect = 1.451e-16
Identity = 62/240 (25.83%), Postives = 119/240 (49.58%), Query Frame = 2
Query: 1442 LQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF----PDLSRDEIVKMHRLDQFPYNRYSTE 2149
            LQR++   LG+  +  +  EL+++    T    ++ + +I+   + ++  H+V E RI  +   N+  V++   Y+  + +Y+ ME    G +   L K    D  +   +    +  LEYLH+  IV RDL P  +L+D N   KL  F  +K  +        ++  F G +  Y APE+ LN+ ++   D+W+ G+ + ++ T   PF    P ++ + I+K   L+++ + R+ T+
Sbjct:   37 LQRVS--TLGMGGFGRV--ELVRSASSRTYALKIMNKAHIV---ETKQESHVVSERRIL-MQCDNDYIVRMYKTYRDSEKIYMLMEPCLGGEIWTILRKKGRFDNDLTRFYCAGAMEALEYLHRKNIVYRDLKPENMLLDRNGWPKLVDFGFAKKLK-----NGGRTWTFCG-TAEYVAPEIVLNKGHDLSVDIWALGIFMCELLTGSPPFSSTDPMVTYNAILK--GLEKWAWPRFVTK 260          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 82.4185 bits (202), Expect = 4.931e-16
Identity = 62/240 (25.83%), Postives = 119/240 (49.58%), Query Frame = 2
Query: 1442 LQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF----PDLSRDEIVKMHRLDQFPYNRYSTE 2149
            LQR++   LG+  +  +  EL+++    T    ++ + +I+   + ++  H+V E RI  +   N+  V++   Y+  + +Y+ ME    G +   L K    D  +   +    +  LEYLH+  IV RDL P  +L+D N   KL  F  +K  +        ++  F G +  Y APE+ LN+ ++   D+W+ G+ + ++ T   PF    P ++ + I+K   L+++ + R+ T+
Sbjct:  274 LQRVS--TLGMGGFGRV--ELVRSASSRTYALKIMNKAHIV---ETKQESHVVSERRIL-MQCDNDYIVRMYKTYRDSEKIYMLMEPCLGGEIWTILRKKGRFDNDLTRFYCAGAMEALEYLHRKNIVYRDLKPENMLLDRNGWPKLVDFGFAKKLK-----NGGRTWTFCG-TAEYVAPEIVLNKGHDLSVDIWALGIFMCELLTGSPPFSSTDPMVTYNAILKG--LEKWAWPRFVTK 497          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 82.4185 bits (202), Expect = 5.665e-16
Identity = 62/240 (25.83%), Postives = 119/240 (49.58%), Query Frame = 2
Query: 1442 LQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF----PDLSRDEIVKMHRLDQFPYNRYSTE 2149
            LQR++   LG+  +  +  EL+++    T    ++ + +I+   + ++  H+V E RI  +   N+  V++   Y+  + +Y+ ME    G +   L K    D  +   +    +  LEYLH+  IV RDL P  +L+D N   KL  F  +K  +        ++  F G +  Y APE+ LN+ ++   D+W+ G+ + ++ T   PF    P ++ + I+K   L+++ + R+ T+
Sbjct:  310 LQRVS--TLGMGGFGRV--ELVRSASSRTYALKIMNKAHIV---ETKQESHVVSERRIL-MQCDNDYIVRMYKTYRDSEKIYMLMEPCLGGEIWTILRKKGRFDNDLTRFYCAGAMEALEYLHRKNIVYRDLKPENMLLDRNGWPKLVDFGFAKKLK-----NGGRTWTFCG-TAEYVAPEIVLNKGHDLSVDIWALGIFMCELLTGSPPFSSTDPMVTYNAILK--GLEKWAWPRFVTK 533          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG14305 (gene:FBgn0038630 transcript:FBtr0083636)

HSP 1 Score: 81.2629 bits (199), Expect = 2.593e-16
Identity = 67/247 (27.13%), Postives = 111/247 (44.94%), Query Frame = 2
Query: 1457 GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRE---NEHIVKELRIF-QITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEK-CDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIE 2182
            G  +G  + +G    ++ A         + L C II + K      N+   +EL I  +I  SN   +++ +I Q+   +++ M     G L  ++ +  PID K    W  ++   L+YLH   I  RDL    IL+ +  +IKL  F  ++Y    +     KS+ + G S  Y APE+     Y+ K  D WS GV+L  +   K PF D +  ++++  R  +F + R   E I    K  + 
Sbjct:   27 GYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSN--IIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREM-KSETYCG-SAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVS 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG14305 (gene:FBgn0038630 transcript:FBtr0083634)

HSP 1 Score: 81.2629 bits (199), Expect = 2.593e-16
Identity = 67/247 (27.13%), Postives = 111/247 (44.94%), Query Frame = 2
Query: 1457 GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRE---NEHIVKELRIF-QITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEK-CDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIE 2182
            G  +G  + +G    ++ A         + L C II + K      N+   +EL I  +I  SN   +++ +I Q+   +++ M     G L  ++ +  PID K    W  ++   L+YLH   I  RDL    IL+ +  +IKL  F  ++Y    +     KS+ + G S  Y APE+     Y+ K  D WS GV+L  +   K PF D +  ++++  R  +F + R   E I    K  + 
Sbjct:   27 GYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSN--IIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREM-KSETYCG-SAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVS 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG14305 (gene:FBgn0038630 transcript:FBtr0305956)

HSP 1 Score: 81.2629 bits (199), Expect = 2.593e-16
Identity = 67/247 (27.13%), Postives = 111/247 (44.94%), Query Frame = 2
Query: 1457 GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRE---NEHIVKELRIF-QITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEK-CDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIE 2182
            G  +G  + +G    ++ A         + L C II + K      N+   +EL I  +I  SN   +++ +I Q+   +++ M     G L  ++ +  PID K    W  ++   L+YLH   I  RDL    IL+ +  +IKL  F  ++Y    +     KS+ + G S  Y APE+     Y+ K  D WS GV+L  +   K PF D +  ++++  R  +F + R   E I    K  + 
Sbjct:   27 GYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSN--IIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREM-KSETYCG-SAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVS 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: tor (gene:FBgn0003733 transcript:FBtr0088938)

HSP 1 Score: 79.337 bits (194), Expect = 9.438e-15
Identity = 40/124 (32.26%), Postives = 72/124 (58.06%), Query Frame = 2
Query: 1745 PIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITT-KKKPFPDLSRDEIVKMHR 2113
            P+    + D + ++  G+E+L QNK+V RDL    +L+  +R IK+  F LS+  + Y  + + KS     L +++ A E   ++ Y  + D+WSFGV+L +ITT    P+P +S  +++++ R
Sbjct:  712 PLKYADLLDIAQQVAVGMEFLAQNKVVHRDLAARNVLISVDRSIKIADFGLSR--DVYHENVYRKSGGSGKLPIKWLALESLTHQVYTSQSDVWSFGVLLYEITTLGGMPYPSVSPSDLLQLLR 833          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: tor (gene:FBgn0003733 transcript:FBtr0339117)

HSP 1 Score: 78.9518 bits (193), Expect = 9.992e-15
Identity = 40/124 (32.26%), Postives = 72/124 (58.06%), Query Frame = 2
Query: 1745 PIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITT-KKKPFPDLSRDEIVKMHR 2113
            P+    + D + ++  G+E+L QNK+V RDL    +L+  +R IK+  F LS+  + Y  + + KS     L +++ A E   ++ Y  + D+WSFGV+L +ITT    P+P +S  +++++ R
Sbjct:  707 PLKYADLLDIAQQVAVGMEFLAQNKVVHRDLAARNVLISVDRSIKIADFGLSR--DVYHENVYRKSGGSGKLPIKWLALESLTHQVYTSQSDVWSFGVLLYEITTLGGMPYPSVSPSDLLQLLR 828          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: prkcq (protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-041210-195])

HSP 1 Score: 94.3597 bits (233), Expect = 1.805e-19
Identity = 88/364 (24.18%), Postives = 159/364 (43.68%), Query Frame = 2
Query: 1199 LRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIV--------------------KKHMADTFSADADRFVLFLRNHSLDENKFMYQY--KIENEYSINYCCLQRLNGVELGISLYKGIIYELLKAKD-----KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            L +IES +++   S   D +T  R   +  D  G++                    K+H   ++ + AD      R  SL+E + +Y    K  ++++I+   L ++    LG   +  +    LK        KA KK+++L+  ++         E  + E R+  +   +     L   +Q  +N++  ME ++ G L  ++      D+     ++ +I+CGL++LH   IV RDL    IL+D +  IK+  F + K          +++  F G +  Y APE+ L + Y    D WSFGV+L ++   + PF     +E+ +  R D   Y R+ T       +DI+ K   ++ ER
Sbjct:  288 LAMIESTQQQARSSR--DTETVGREGPVSADQPGVIREPSGRLAISPLTPAPPLPRKEHQGISWDSPADG-----RRPSLEEPEPLYATPRKEHHKFTIDSFILHKM----LGKGSFGKVFLAELKGSGQFFAVKALKKDVVLMDDDV---------ECTMVERRVLSLAWDHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQTCHRFDLPRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDTDGHIKIADFGMCKENIIGE----ARTCTFCG-TPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTR----DARDILVKLFVREPER 622          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: prkcq (protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-041210-195])

HSP 1 Score: 94.3597 bits (233), Expect = 2.162e-19
Identity = 88/364 (24.18%), Postives = 159/364 (43.68%), Query Frame = 2
Query: 1199 LRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIV--------------------KKHMADTFSADADRFVLFLRNHSLDENKFMYQY--KIENEYSINYCCLQRLNGVELGISLYKGIIYELLKAKD-----KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            L +IES +++   S   D +T  R   +  D  G++                    K+H   ++ + AD      R  SL+E + +Y    K  ++++I+   L ++    LG   +  +    LK        KA KK+++L+  ++         E  + E R+  +   +     L   +Q  +N++  ME ++ G L  ++      D+     ++ +I+CGL++LH   IV RDL    IL+D +  IK+  F + K          +++  F G +  Y APE+ L + Y    D WSFGV+L ++   + PF     +E+ +  R D   Y R+ T       +DI+ K   ++ ER
Sbjct:  292 LAMIESTQQQARSSR--DTETVGREGPVSADQPGVIREPSGRLAISPLTPAPPLPRKEHQGISWDSPADG-----RRPSLEEPEPLYATPRKEHHKFTIDSFILHKM----LGKGSFGKVFLAELKGSGQFFAVKALKKDVVLMDDDV---------ECTMVERRVLSLAWDHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQTCHRFDLPRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDTDGHIKIADFGMCKENIIGE----ARTCTFCG-TPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTR----DARDILVKLFVREPER 626          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: BX005175.1 (protein kinase C, delta b [Source:NCBI gene;Acc:100150844])

HSP 1 Score: 92.0485 bits (227), Expect = 8.221e-19
Identity = 67/253 (26.48%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAKD-----KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            LG   +  ++   LK K      KA KK+++L+  ++         E  + E R+  +   N     L   +Q  ++++  ME ++ G L  ++      D+     ++ +I+CGL+YLH   IV RDL    +++D++  IK+  F + K          +++  F G +  Y APE+ L + Y+   D WSFGV+L ++   + PF     DE+    R+D   Y R+ T+      KD++EK   +   R
Sbjct:  349 LGKGSFGKVMLAELKGKGQYFAIKALKKDVVLMDDDV---------ECTMVEKRVLALAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLYRATFYAAEIICGLQYLHSKGIVYRDLKLDNVMLDKDGHIKIADFGMCKENMIGE----NRATTFCG-TPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLIGQSPFQGDDEDELFDSIRMDVPHYPRWITK----EAKDLLEKLFERDPTR 583          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: prkcq (protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-041210-195])

HSP 1 Score: 88.5817 bits (218), Expect = 8.890e-19
Identity = 57/207 (27.54%), Postives = 98/207 (47.34%), Query Frame = 2
Query: 1589 EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            E  + E R+  +   +     L   +Q  +N++  ME ++ G L  ++      D+     ++ +I+CGL++LH   IV RDL    IL+D +  IK+  F + K          +++  F G +  Y APE+ L + Y    D WSFGV+L ++   + PF     +E+ +  R D   Y R+ T       +DI+ K   ++ ER
Sbjct:    6 ECTMVERRVLSLAWDHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQTCHRFDLPRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDTDGHIKIADFGMCKENIIGE----ARTCTFCG-TPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTR----DARDILVKLFVREPER 203          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: prkcdb (protein kinase C, delta b [Source:ZFIN;Acc:ZDB-GENE-111129-1])

HSP 1 Score: 92.0485 bits (227), Expect = 1.042e-18
Identity = 67/253 (26.48%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAKD-----KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            LG   +  ++   LK K      KA KK+++L+  ++         E  + E R+  +   N     L   +Q  ++++  ME ++ G L  ++      D+     ++ +I+CGL+YLH   IV RDL    +++D++  IK+  F + K          +++  F G +  Y APE+ L + Y+   D WSFGV+L ++   + PF     DE+    R+D   Y R+ T+      KD++EK   +   R
Sbjct:  364 LGKGSFGKVMLAELKGKGQYFAIKALKKDVVLMDDDV---------ECTMVEKRVLALAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLYRATFYAAEIICGLQYLHSKGIVYRDLKLDNVMLDKDGHIKIADFGMCKENMIGE----NRATTFCG-TPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLIGQSPFQGDDEDELFDSIRMDVPHYPRWITK----EAKDLLEKLFERDPTR 598          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: u2af1 (U2 small nuclear RNA auxiliary factor 1 [Source:Xenbase;Acc:XB-GENE-877053])

HSP 1 Score: 97.0561 bits (240), Expect = 1.194e-21
Identity = 45/162 (27.78%), Postives = 85/162 (52.47%), Query Frame = 2
Query: 1589 EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF 2074
            E+I++E R+ ++   +    +    +Q     + +ME  S G+L++ + K   + ++ V  +S +I+CGL+YLH + I+ RD+ P  I++     IK+  F L+    Y   +T  +   F      Y APE+   ++Y+   D WS+G+ L ++ T + PF
Sbjct:    2 EYILREARVLRVAAGHPYLCRAYAAFQTQTRAFFTMEYASGGSLELEIRKRKHLKMRKVIFYSAEIICGLQYLHSHGIIHRDIKPGNIMLSSEGHIKILDFGLAAEGVYGDSTTNGRFGTFA-----YMAPEVHREKEYSAAVDWWSYGITLCQMATGQYPF 158          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045672.1 (protein kinase C delta type-like [Source:NCBI gene;Acc:101734050])

HSP 1 Score: 95.1301 bits (235), Expect = 6.461e-21
Identity = 47/171 (27.49%), Postives = 87/171 (50.88%), Query Frame = 2
Query: 1568 ENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPD 2080
            +++    E I++E R+ ++   +     +   +Q     +++ME  S G+LK  L K   +  + V  +S +++CGL+YLH   I+  DL P  ILV     IK+  F L+    + + +           +++Y APE+  ++ YN   D W+FG++L ++ T + PF D
Sbjct:   40 KSRMVNRESILREARVLRVAAGHPYLCHMHAAFQTQNYAFIAMEFASRGSLKDLLTKKHHLKTRQVIFYSAEMVCGLQYLHSRGIIHSDLKPDNILVSSEGHIKIADFGLAAENIFGNDTICVHRG-----TMKYMAPEVLEDQQYNAAVDWWAFGIILCQMATGRYPFND 205          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: tsen15 (tRNA splicing endonuclease subunit 15 [Source:Xenbase;Acc:XB-GENE-983821])

HSP 1 Score: 90.5077 bits (223), Expect = 3.269e-18
Identity = 57/203 (28.08%), Postives = 99/203 (48.77%), Query Frame = 2
Query: 1604 ELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRY-STEVIEPPLKDIIEKCLTKQDER 2209
            E R+  +   +     L   +Q  ++++  ME ++ G L  ++      D+     ++ +I+CGL++LH   +V RDL    IL+D    IK+  F + K +        +K+  F G +  Y APE+ L + YN   D WSFGV+L ++   + PF  +  +E+ +  R+D   Y R+ S E      KDI+     ++ ER
Sbjct:  276 EKRVLSLAWEHPFLTHLYCTFQTKEHLFFVMEYLNGGDLMFHIQSCHKFDLPRATFYAAEIVCGLQFLHSKGVVYRDLKLDNILLDMEGHIKIADFGMCKESMLGD----AKTSTFCG-TPDYIAPEILLGQKYNYSVDWWSFGVLLYEMLIGQSPFHGIDEEELFQSIRMDNPMYPRFLSMEA-----KDILIMLFVREPER 468          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: c1orf84 (chromosome 1 open reading frame 84 [Source:Xenbase;Acc:XB-GENE-6041758])

HSP 1 Score: 90.8929 bits (224), Expect = 3.575e-18
Identity = 65/258 (25.19%), Postives = 122/258 (47.29%), Query Frame = 2
Query: 1427 INYCCLQRLN-GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFREN-EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD----------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQ 2122
            ++ C   RL  G  LG   +  ++       DK   KE + +   ++ ++   ++   +V E+ + +I   ++  + LL    +   +YV +E  ++G L+ YL    P++++  FD                 + +I  G+EYL   K + RDL    +LV EN  +K+  F L++     +YY  +T  +      L V++ APE   +  Y  + D+WSFGV++ +I T    P+P +  +E+ K+    HR+D+
Sbjct:  347 MSLCFSPRLTLGKPLGEGCFGQVVMAEALGIDKDRPKESVTVAVKMLKDDATEKDLADLVSEMEMMKIIGKHKNIINLLGACTQGGTLYVIVEYAAKGNLRQYLRARRPLEMEYSFDVTRVPDEQMTFKDLVSCTYQIARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDVNNIDYYKKTTNGR------LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK 598          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: c1orf84 (chromosome 1 open reading frame 84 [Source:Xenbase;Acc:XB-GENE-6041758])

HSP 1 Score: 90.1225 bits (222), Expect = 5.665e-18
Identity = 64/248 (25.81%), Postives = 121/248 (48.79%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAK----DKATKKEMLLLRCNIIAENKFREN-EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD----------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQ 2122
            LG  L +G   +++ A+    DK   KE + +   ++ ++   ++   +V E+ + +I   ++  + LL    +   +YV +E  ++G L+ YL    P++++  FD                 + +I  G+EYL   K + RDL    +LV EN  +K+  F L++     +YY  +T  +      L V++ APE   +  Y  + D+WSFGV++ +I T    P+P +  +E+ K+    HR+D+
Sbjct:  380 LGKPLGEGCFGQVVMAEALGIDKDRPKESVTVAVKMLKDDATEKDLADLVSEMEMMKIIGKHKNIINLLGACTQGGTLYVIVEYAAKGNLRQYLRARRPLEMEYSFDVTRVPDEQMTFKDLVSCTYQIARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDVNNIDYYKKTTNGR------LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Prkcq (protein kinase C, theta [Source:MGI Symbol;Acc:MGI:97601])

HSP 1 Score: 88.1965 bits (217), Expect = 1.540e-17
Identity = 59/230 (25.65%), Postives = 111/230 (48.26%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     +   +Q  +N++  ME ++ G L  ++      D+     ++ +++ GL++LH   IV RDL    IL+D +  IK+  F + K          +K++ F G +  Y APE+ L + YN   D WSFGV++ ++   + PF     +E+    R+D   Y R+    +E   KD++ K   ++ E+
Sbjct:  409 KALKKDVVLMDDDV---------ECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGD----AKTNTFCG-TPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW----LEREAKDLLVKLFVREPEK 620          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 86.6557 bits (213), Expect = 2.521e-17
Identity = 67/258 (25.97%), Postives = 123/258 (47.67%), Query Frame = 2
Query: 1445 QRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNER--------FVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSP-STFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCL 2191
            +R    + G  L +G    ++ A++ AT +E  +         K  E  HI+KE ++  +T+  +         FVKL   +Q D+ +Y  +     G L  Y+ K    D      ++ +I+  LEYLH   I+ RDL P  IL++E+  I++  F  +K     SP S  +++++F G + +Y +PEL   +   +  DLW+ G ++ ++     PF   + +E +   ++ +  Y  +  E   P  +D++EK L
Sbjct:   80 KRPEDFKFGKILGEGSFSTVVLARELATSREYAI---------KILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAK---VLSPESKQARANSFVG-TAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPF--RAGNEYLIFQKIIKLEY--HFPEKFFPKARDLVEKLL 320          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Fgfr2 (fibroblast growth factor receptor 2 [Source:MGI Symbol;Acc:MGI:95523])

HSP 1 Score: 87.0409 bits (214), Expect = 3.097e-17
Identity = 61/247 (24.70%), Postives = 116/247 (46.96%), Query Frame = 2
Query: 1457 GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFREN-EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD----------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQ 2122
            G  LG   +  ++       DK   KE + +   ++ ++   ++   +V E+ + ++   ++  + LL    +D  +YV +E  S+G L+ YL    P  ++  +D                 + ++  G+EYL   K + RDL    +LV EN  +K+  F L++     +YY  +T  +      L V++ APE   +  Y  + D+WSFGV++ +I T    P+P +  +E+ K+    HR+D+
Sbjct:  271 GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGR------LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK 511          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Fgfr2 (fibroblast growth factor receptor 2 [Source:MGI Symbol;Acc:MGI:95523])

HSP 1 Score: 87.0409 bits (214), Expect = 3.299e-17
Identity = 61/247 (24.70%), Postives = 116/247 (46.96%), Query Frame = 2
Query: 1457 GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFREN-EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD----------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQ 2122
            G  LG   +  ++       DK   KE + +   ++ ++   ++   +V E+ + ++   ++  + LL    +D  +YV +E  S+G L+ YL    P  ++  +D                 + ++  G+EYL   K + RDL    +LV EN  +K+  F L++     +YY  +T  +      L V++ APE   +  Y  + D+WSFGV++ +I T    P+P +  +E+ K+    HR+D+
Sbjct:  272 GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGR------LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK 512          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Fgfr2 (fibroblast growth factor receptor 2 [Source:MGI Symbol;Acc:MGI:95523])

HSP 1 Score: 87.0409 bits (214), Expect = 3.983e-17
Identity = 61/247 (24.70%), Postives = 116/247 (46.96%), Query Frame = 2
Query: 1457 GVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFREN-EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD----------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQ 2122
            G  LG   +  ++       DK   KE + +   ++ ++   ++   +V E+ + ++   ++  + LL    +D  +YV +E  S+G L+ YL    P  ++  +D                 + ++  G+EYL   K + RDL    +LV EN  +K+  F L++     +YY  +T  +      L V++ APE   +  Y  + D+WSFGV++ +I T    P+P +  +E+ K+    HR+D+
Sbjct:  394 GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGR------LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK 634          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|A6QGC0|PRKC_STAAE (Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) OX=426430 GN=prkC PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 9.974e-18
Identity = 46/166 (27.71%), Postives = 95/166 (57.23%), Query Frame = 2
Query: 1631 SNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFP 2128
            S++  V ++++ ++D   Y+ ME +   TL  Y++ + P+ +    +++ +IL G+++ H  +IV RD+ P  IL+D N+ +K++ F ++K     S ++ +++++  G +V+YF+PE    E  +E  D++S G+VL ++   + PF   +   I   H  D  P
Sbjct:   66 SHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDGIKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAK---ALSETSLTQTNHVLG-TVQYFSPEQAKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVP 227          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q04759|KPCT_HUMAN (Protein kinase C theta type OS=Homo sapiens OX=9606 GN=PRKCQ PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 2.558e-17
Identity = 61/230 (26.52%), Postives = 112/230 (48.70%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     +   +Q  +N++  ME ++ G L  ++      D+     ++ +I+ GL++LH   IV RDL    IL+D++  IK+  F + K          +K++ F G +  Y APE+ L + YN   D WSFGV+L ++   + PF     +E+    R+D   Y R+    +E   KD++ K   ++ E+
Sbjct:  409 KALKKDVVLMDDDV---------ECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGD----AKTNTFCG-TPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW----LEKEAKDLLVKLFVREPEK 620          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9WTQ0|KPCT_RAT (Protein kinase C theta type OS=Rattus norvegicus OX=10116 GN=Prkcq PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.344e-17
Identity = 60/230 (26.09%), Postives = 111/230 (48.26%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     +   +Q  +N++  ME ++ G L  ++      D+     ++ +++ GL++LH   IV RDL    IL+D +  IK+  F + K          +K++ F G +  Y APE+ L + YN   D WSFGV+L ++   + PF     +E+    R+D   Y R+    +E   KD++ K   ++ E+
Sbjct:  409 KALKKDVVLMDDDV---------ECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGD----AKTNTFCG-TPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW----LEREAKDLLVKLFVREPEK 620          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q03364|FGFR2_XENLA (Fibroblast growth factor receptor 2 OS=Xenopus laevis OX=8355 GN=fgfr2 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.674e-17
Identity = 63/248 (25.40%), Postives = 121/248 (48.79%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAK----DKATKKEMLLLRCNIIAENKFREN-EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD----------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQ 2122
            LG  L +G   +++ A+    DK   KE + +   ++ +N   ++   +V E+ + ++   ++  + LL    +   +YV +E  ++G L+ YL    P++++  FD                 + +I  G+EYL   K + RDL    +LV EN  +K+  F L++     +YY  ++  +      L V++ APE   +  Y  + D+WSFGV++ +I T    P+P +  +E+ K+    HR+D+
Sbjct:  473 LGKPLGEGCFGQVVMAEALGIDKERPKESVTVAVKMLKDNATEKDLADLVSEMEMMKMIGKHKNIINLLGACTQGGTLYVIVEYAAKGNLRQYLRARRPLEMEYSFDVTRVPDEQMTFKDLVSCTYQIARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDVNNIDYYKKTSNGR------LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK 714          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q02111|KPCT_MOUSE (Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.077e-16
Identity = 59/230 (25.65%), Postives = 111/230 (48.26%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     +   +Q  +N++  ME ++ G L  ++      D+     ++ +++ GL++LH   IV RDL    IL+D +  IK+  F + K          +K++ F G +  Y APE+ L + YN   D WSFGV++ ++   + PF     +E+    R+D   Y R+    +E   KD++ K   ++ E+
Sbjct:  409 KALKKDVVLMDDDV---------ECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGD----AKTNTFCG-TPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW----LEREAKDLLVKLFVREPEK 620          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1L8G767 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18026548mg PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.261e-20
Identity = 58/173 (33.53%), Postives = 93/173 (53.76%), Query Frame = 2
Query: 1559 IIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFP 2077
            I+ +   R +E I++E ++ QI+K +         +Q   + ++ ME++S G+L+  L+ Y  +DI  V   S +++CGLE+LH   IV RD+ P  I+VD     K+  F L+K    +  +T +    F G    Y APE+   + YN   D W+FGV + K+ T K PFP
Sbjct:  114 ILKKRSGRISESILREAKVLQISKESPFLGLGFAAFQTQWHAFLVMEHLSGGSLQDELNSYGSLDIARVRFHSAEVICGLEFLHSRGIVHRDIKPGNIMVDAEGHTKIIDFGLAKMN-VFGDNTIT---GFAGTGG-YMAPEIRELKAYNAAVDWWAFGVTVCKMATNKSPFP 281          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A9TWT1 (Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens OX=3218 GN=PHYPADRAFT_151978 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.575e-20
Identity = 73/270 (27.04%), Postives = 138/270 (51.11%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFREN--EHIVKELRIFQITKSNERFVKLLNIYQKDQ--NVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGL--SVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER--TSLILLKENFQTKI 2251
            LG   Y  ++Y  L  +D      +  L+ NI AE + R+     + +E+ +++I + ++  V  +++ Q  +  ++YV +E +S G+++  L+++      +V  ++ ++L GLEYLH  KIV RD+    +LVD +  IKL  F  SK   ++ P   +++D F  +  SV + APE+   + Y  + D+WS G  +V++ T + P+P++        H + +        E +   +KD + +C   +  R  TS  LL+  F  +I
Sbjct:    9 LGEGAYGKVVYAGLN-QDTGELMAVKQLKLNIAAEGQERQFYLAALEREIALYKIMR-HKHIVGYIDMEQDTETGSLYVFLEYVSGGSIQSMLERFGRFSEPLVRVYTRQLLLGLEYLHGKKIVHRDIKGGNVLVDADGVIKLADFGASK--AFHDP---TQTDGFKSIRGSVFWMAPEVIKGDGYGRRADIWSVGCTVVEMLTAEHPWPEMDNTWTAIFH-IAKASSGPPIPEGVSDVVKDFLSQCFQLEARRRPTSTELLQHPFVAEI 270          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0R3RIB6 (Protein kinase domain-containing protein OS=Elaeophora elaphi OX=1147741 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 3.241e-19
Identity = 66/215 (30.70%), Postives = 112/215 (52.09%), Query Frame = 2
Query: 1469 GISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVK---ELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNE-DYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIV 2101
            G  +  G   ++    D  T KE+ L R NI   +K   N HI++   E+ +   T  + R V+ L   Q + ++ + +E M+ G++K Y+  Y P+   +   ++ ++L GLEYLH+N+I+ RD+ P+ IL D N ++K+  F  +K  +        ++  F G +  Y APE+ L    +  K D+WS G  LV++ T K P+ DL    I+
Sbjct:  222 GKCIGSGAFGKVYVCVDVDTGKEVALKRFNICRADKHLTN-HIIQLGNEINLLS-TIQHARIVQYLGAQQIEDSICIFIEYMTGGSVKDYIATYGPLSSTVAGKYTYQVLQGLEYLHRNEIIHRDIKPANILRDSNGNVKIGDFGSAKRLQTICS---QQAATFIG-TPNYMAPEVVLGHTTHGRKADIWSVGCTLVEMLTTKPPWDDLEPMAII 430          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I7VS83 (STE/STE11/MEKK2 protein kinase OS=Loa loa OX=7209 GN=LOAG_05805 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 7.679e-19
Identity = 66/215 (30.70%), Postives = 112/215 (52.09%), Query Frame = 2
Query: 1469 GISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVK---ELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNED-YNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIV 2101
            G  +  G   ++    D  T KE+ L R NI   +K  +N HI++   E+ +   T  + R V+ L   Q D ++ + +E M+ G++K  +  Y P+   +   ++ ++L GLEYLH+N+I+ RD+ P+ IL D N ++K+  F  +K  +        ++  F G +  Y APE+ L    +  K D+WS G  LV++ T K P+ DL    I+
Sbjct:  223 GKCIGSGAFGKVYVCVDVDTGKEVALKRFNICRGDKHLKN-HIIQLGNEINLLS-TIQHGRIVQYLGAQQIDDSICIFIEYMTGGSVKDCIATYGPLSSAVAGKYTYQVLQGLEYLHRNEIIHRDIKPANILRDSNGNVKIGDFGSAKRLQTICS---QQASTFIG-TPNYMAPEVVLGRTKHGRKADIWSVGCTLVEMLTTKPPWDDLEPMAII 431          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A261BJT0 (Uncharacterized protein (Fragment) OS=Caenorhabditis latens OX=1503980 GN=FL83_14672 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 8.780e-19
Identity = 55/165 (33.33%), Postives = 93/165 (56.36%), Query Frame = 2
Query: 1583 ENEHIVKELRIFQITKSNERFV-KLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF 2074
            E +H+  E+RI +  KS  RF+ K+ N ++  Q VY+++E +  G L   +++   +       +  +I  GLEYLH N ++ RDL P+ +++D++ ++KL  F +SK+     P   +K+  F G S+ Y APE+   +DY    DLW+ GV+L  + T   PF
Sbjct:   51 EKQHLQDEIRILETIKS--RFLCKMYNTFETPQKVYMALEFLPGGELFALMERVQFLSENSARFYIAQITLGLEYLHNNHVLYRDLKPANVMIDKDGNVKLVDFGMSKFN---FPKG-NKTSTFCG-SMEYMAPEMITEKDYGHAVDLWALGVLLFDLVTGSPPF 208          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pdpk1b (3-phosphoinositide-dependent protein kinase 1 [Source:NCBI gene;Acc:103033547])

HSP 1 Score: 89.7373 bits (221), Expect = 2.592e-18
Identity = 61/213 (28.64%), Postives = 108/213 (50.70%), Query Frame = 2
Query: 1445 QRLNGVELGISLYKGIIYELLKAKDKATKKEM---LLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF 2074
            +R    + G  L +G    ++ AK+ +T KE    +L + +I+ ENK    +++ +E  +  I   +  FVKL   +Q ++ +Y  +     G L  Y+ K    D      +S +I+C LEYLHQ  I+ RDL P  IL+ E   I++  F  +K  +  S S  +++++F G + +Y +PEL   +   +  DLW+ G ++ ++     PF
Sbjct:   55 KRPEDFKFGKILGEGSFSTVVLAKEHSTGKEYAIKILEKRHIMKENK---AQYVKRERDVMSIL-DHPFFVKLYFTFQDEEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHQKGIIHRDLKPENILLSEEMHIQITDFGTAK--QLSSDSRQARANSFVG-TAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPF 260          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pdpk1a (3-phosphoinositide-dependent protein kinase 1 [Source:NCBI gene;Acc:103022926])

HSP 1 Score: 87.8113 bits (216), Expect = 1.105e-17
Identity = 69/252 (27.38%), Postives = 123/252 (48.81%), Query Frame = 2
Query: 1445 QRLNGVELGISLYKGIIYELLKAKDKATKKEM---LLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCL 2191
            +R    + G  L +G    ++ AK+ +T KE    +L + +I  ENK     H VK  R    +  N  FVKL   +Q  + +Y  +     G L  Y+ K    D      ++ +++  L+YLH   I+ RDL P  IL++E   I++  F  +K  ++ S ST +++++F G + +Y +PEL   +   +  DLW+ G ++ ++     PF   + +E +   ++ +  Y+    E   P  KD++EK L
Sbjct:   61 KRAEDFKFGKILGEGSFSTVVLAKELSTGKEYAIKILEKTHIRKENK----AHYVKRERDILSSLDNPFFVKLYFTFQDAEKLYFGLSYAKNGELLRYIRKIGSFDETCTRFYTAELVSALQYLHSVGIIHRDLKPENILLNEEMHIQITDFGTAK--QFSSDSTQTRANSFVG-TAQYVSPELLTKKSACKSSDLWALGCIVYQLVAGLPPF--RAANEYLIFQKIIKLEYD--FPEKFFPKAKDLVEKLL 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:103036366])

HSP 1 Score: 88.1965 bits (217), Expect = 1.407e-17
Identity = 63/253 (24.90%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAKD-----KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            LG   +  ++   LK +      KA KK+++L+  ++         E  + E R+  +   N     L   +Q  ++++  ME ++ G L  ++      D+     +S +I+CGL++LH   ++ RDL    +++D++  IK+  F + K          +++  F G +  Y APE+ L + Y    D WSFGV++ ++   + PF     DE+ +  R+D   Y R+ T+      KD++EK   +   R
Sbjct:  332 LGKGSFGKVLLAELKGRGEYFAVKALKKDVVLMDDDV---------ECTMVEKRVLSLAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLFRATFYSAEIICGLQFLHSKGVIYRDLKLDNVMLDKDGHIKIADFGMCKENMIGE----NRATTFCG-TPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIGQSPFQGDDEDELFESIRMDVPHYPRWITK----ESKDLLEKLFERDPTR 566          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:103036366])

HSP 1 Score: 87.4261 bits (215), Expect = 1.994e-17
Identity = 63/253 (24.90%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAKD-----KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            LG   +  ++   LK +      KA KK+++L+  ++         E  + E R+  +   N     L   +Q  ++++  ME ++ G L  ++      D+     +S +I+CGL++LH   ++ RDL    +++D++  IK+  F + K          +++  F G +  Y APE+ L + Y    D WSFGV++ ++   + PF     DE+ +  R+D   Y R+ T+      KD++EK   +   R
Sbjct:  368 LGKGSFGKVLLAELKGRGEYFAVKALKKDVVLMDDDV---------ECTMVEKRVLSLAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLFRATFYSAEIICGLQFLHSKGVIYRDLKLDNVMLDKDGHIKIADFGMCKENMIGE----NRATTFCG-TPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIGQSPFQGDDEDELFESIRMDVPHYPRWITK----ESKDLLEKLFERDPTR 602          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: prkcq (protein kinase C theta [Source:NCBI gene;Acc:103040891])

HSP 1 Score: 86.6557 bits (213), Expect = 3.830e-17
Identity = 62/230 (26.96%), Postives = 108/230 (46.96%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDER 2209
            KA KK+++L+  ++         E  + E R+  +   +     L   +Q  +N++  ME ++ G L  ++      D+     ++ +I+CGL++LH   IV RDL    IL+D +  IK+  F + K           ++  F G +  Y APE+ L + Y    D WSFGV+L ++   + PF     +E+ +  R D   Y R+ T       +DI+ K   ++ ER
Sbjct:  423 KALKKDVVLMDDDV---------ECTMVERRVLSLAWEHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQSCHRFDLVRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDFDGHIKIADFGMCKENMLGD----VRTSTFCG-TPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTR----DARDILIKLFVREPER 634          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 88.5817 bits (218), Expect = 1.776e-18
Identity = 57/207 (27.54%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 1580 RENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFD------------------WSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSK---YTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKI-TTKKKPFPDLSRDEIVKM----HRLDQ 2122
            +E   +V E+ + ++   ++  + LL    +D  +YV +E  S+G L+ YL    P  +   FD                   + ++  G+EYL   K + RDL    +LV E+  +K+  F L++     +YY  +T  +      L V++ APE   +  Y  +CD+WSFGV+L +I T    P+P +  +E+ K+    HR+D+
Sbjct:  377 KELSDLVSEMEVMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGVGYSFDPIGYSDPSEQLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGR------LPVKWMAPEALFDRVYTHQCDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK 577          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1820])

HSP 1 Score: 84.3445 bits (207), Expect = 2.851e-17
Identity = 70/261 (26.82%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 1445 QRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNER--------FVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF--PD--LSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCL 2191
            +R    + G  L +G    ++ AK+ AT KE  +         K  E  HI+KE ++  + +  E         FVKL   +Q ++ +Y  +     G +  Y+ K+   D      +S +I+  LE+LH   I+ RDL P  IL++E+  I++  F  +K       S  +++++F G + +Y +PEL   +   +  DLW+ G ++ ++     PF  P+  L   +I+K+    +FP      E   P  KD++EK L
Sbjct:   19 KRPEDFKFGKILGEGSFSTVVLAKEVATGKEYAI---------KILEKRHIIKEKKVPYVNREKEVLSRLNHPFFVKLFFTFQDEEKLYFGLSYAKNGEMLKYIRKHRSFDENCTRFYSAQIVSSLEHLHSLGIIHRDLKPENILLNEDMHIQITDFGTAKILS--DNSKHARANSFVG-TAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAPNEYLIFQKIIKLEY--EFP------EKFFPKAKDLVEKLL 259          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006402.1 (pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 gene:ENSPMAG00000005783.1 transcript:ENSPMAT00000006402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 5.486e-17
Identity = 56/259 (21.62%), Postives = 118/259 (45.56%), Query Frame = 2
Query: 1451 LNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELR--IFQITK-SNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNK----IVLRDLNPSTILVDE-NRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF-PDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQ 2200
            L G ++G+    G      +A+D  T   M + +   +  N   E + +V+ LR  I  +++  +   +++L    +  N  + +E M+ G++   L+KY P   ++V  +  ++L GL YLH N+    ++ RD+  + +LVD   + +++  F  +                  G ++ + APE+     Y   CD+WS G V+++++  K P+  +   + +  + ++            + P L+D+  +CL  Q
Sbjct:   25 LRGQQIGL----GAFSSCFQAQDIGTGTLMAVKQVTYV-RNTASEQDEVVQTLREEIRMMSRLDHPNIIRMLGATCEKSNYNLFIEWMAGGSVANLLNKYGPFHERVVISYVEQLLRGLAYLHSNQHSNQLIHRDIKGANLLVDSMGQRLRIADFGAAARLASKGTGAGEFQGQLLG-TIAFMAPEVLRGLQYGRSCDIWSVGCVIIEMSCAKPPWNAEKHSNHLALIFKIASTTTAPTVPPTLCPGLRDVALRCLELQ 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 4.390e-16
Identity = 47/136 (34.56%), Postives = 74/136 (54.41%), Query Frame = 2
Query: 1694 MENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIV 2101
            ME  ++G L   L     I  +++  W+  I  G+ YLH +KI+ RDL    +L+  + ++K+  F  SK  E    ST     +F G +V + APE+  NE  +EK D+WSFGVVL ++ T + P+ D+    I+
Sbjct:   79 MEYCAQGQLYEVLRAGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSK--EMREKST---RMSFAG-TVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDSSAII 208          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002088.1 (pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 gene:ENSPMAG00000001892.1 transcript:ENSPMAT00000002088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 4.580e-16
Identity = 47/136 (34.56%), Postives = 74/136 (54.41%), Query Frame = 2
Query: 1694 MENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIV 2101
            ME  ++G L   L     I  ++++ W+  I  G+ YLH +KI+ RDL    +L+  +  +K+  F  SK  E    ST     +F G +V + APE+  NE  +EK D+WSFGVVL ++ T + P+ D+    I+
Sbjct:   14 MEYCAQGQLYEVLRAGRKITPELLYRWTTGIASGMNYLHLHKIIHRDLKSPNVLITHDDLVKISDFGTSK--ELMDKST---KMSFAG-TVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDSSAII 143          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 80.8777 bits (198), Expect = 1.134e-16
Identity = 49/167 (29.34%), Postives = 80/167 (47.90%), Query Frame = 2
Query: 1574 KFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF 2074
            K ++ EH   E R+  I  S+   +++   +Q  Q V++ M+ +  G L   L K       +   ++ ++   LEYLH   I+ RDL P  IL+D+N  IK+  F  +KY    + +     D        Y APE+   + YN+  D WSFGV++ ++     PF
Sbjct:  126 KLKQVEHTNDERRMLSIV-SHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPD--------YIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPF 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 81.6481 bits (200), Expect = 1.220e-16
Identity = 63/209 (30.14%), Postives = 105/209 (50.24%), Query Frame = 2
Query: 1466 LGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQN--VYVSMENMS----EGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF 2074
            LGI L +G    + K + K  KK   L   N +  +     + I +EL+  +  KS +  V+   ++  +Q+  +Y++ME M     E T K  L +   I  +++   +  +L GL YLH+ K++ RD+ P  IL++E  +IKL  F +S        +  S +  FTG S  Y APE    + Y+  CD+WS G+ L+++   + PF
Sbjct:  217 LGI-LGEGAGGSVAKCRLKNGKKVFALKTINTMNTDP-EYQKQIFRELQFNKSFKS-DYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS------GEAVNSLAMTFTGTSF-YMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPF 415          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 79.7221 bits (195), Expect = 6.688e-16
Identity = 44/156 (28.21%), Postives = 83/156 (53.21%), Query Frame = 2
Query: 1634 NERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIV 2101
            +E  V      Q+  N+ + +E +  G++   L+ Y P +  ++ +++ +IL G+ YLH+  I+ RD+  + IL+D    +K+  F +SK     +    +K  +  G SV + +PE+        K D+WS G V++++ T K PFPD S+ + +
Sbjct:  513 HENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQ-NKRASLQG-SVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAI 666          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 77.411 bits (189), Expect = 1.274e-15
Identity = 45/171 (26.32%), Postives = 84/171 (49.12%), Query Frame = 2
Query: 1574 KFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLS 2086
            K ++ EH   E R+ ++ + +   +++   +Q  +N+++ M+ +  G L   L K       +   ++ +++  LEYLH + I+ RDL P  IL+D N  IK+  F  +K  +  + +     D        Y APE+   + YN+  D WS GV++ ++     PF D +
Sbjct:  108 KMKQVEHTNDERRMLKLVE-HPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPD--------YIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTT 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 77.7962 bits (190), Expect = 3.112e-15
Identity = 65/204 (31.86%), Postives = 97/204 (47.55%), Query Frame = 2
Query: 1478 LYKGIIYELLKAKDKATKK--EMLLLRCNIIAENKFRENEHIVKELRIFQIT--KSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNE-DYNEKCDLWSFGVVLVKITTKKKPF 2074
            L KG   ++ + K K T++   M +L   +I   K  E  H + E  I   T  KS+   V L   +Q   ++Y+  + MS G L  +L K           +  +++  LE+LH N IV RDL P  IL+D N +I L  F LSK           +++ F G +  Y APEL L+E  Y +  D WS GV++ ++     PF
Sbjct:  418 LGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIV--KKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKA------DLKDRTNTFCG-TTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPF 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 90.8929 bits (224), Expect = 3.489e-20
Identity = 49/164 (29.88%), Postives = 86/164 (52.44%), Query Frame = 2
Query: 1595 IVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDE-NRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGL---SVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF 2074
            I+ E+ I    K +   +K L   +   +  + +E M+ G++ M L KY P +  I+  +  +IL G+ YLH+N++V RD+  + ILVD   +DI++  F  +        +  + +  F G    ++ + APE+   E Y   CD+WS G VL+++ T K P+
Sbjct:   87 IMDEIAILARLK-HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARL----ATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPW 245          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 93.9745 bits (232), Expect = 1.012e-19
Identity = 63/257 (24.51%), Postives = 124/257 (48.25%), Query Frame = 2
Query: 1478 LYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFREN---EHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDE-NRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGL---SVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF-PDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCL-TKQDERTSLI 2221
            L  G       A+D  T   M + + +    +K  ++   + I+ E+ I    K +   +K L   +   +  + +E M+ G++ M L KY P +  I+  +  +IL G+ YLH+N++V RD+  + ILVD   +DI++  F  +        +  + +  F G    ++ + APE+   E Y   CD+WS G VL+++ T K P+      + +  + ++          E + P ++D++ +CL +K ++R + +
Sbjct:  583 LGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQDKVCQTIMDEIAILARLK-HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLA----TQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAV 834          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 88.1965 bits (217), Expect = 2.679e-19
Identity = 61/212 (28.77%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 1451 LNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRI-FQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDL 2083
            +N    G  L  G   ++    D  T +E+ + +      N   +NE    E  I F     NER V+   I   D ++Y+ ME +  G++  ++ ++  ++  +   +S +IL G+ YLH N+IV RD+  + IL D   ++KL  F  SK  +     T  +S + T     + APE+   E Y  K D+WS G  +V++ T K P+ D 
Sbjct:    1 MNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVHGTPY---WMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADF 209          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 79.7221 bits (195), Expect = 2.839e-16
Identity = 61/230 (26.52%), Postives = 119/230 (51.74%), Query Frame = 2
Query: 1487 GIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWP--IDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNED-YNEKCDLWSFGVVLVKITTKKKPFP-DLSRDEIVKMHRLDQFPYNRYSTEVIEPP 2164
            G++Y   KA+DK T + + L +  +  E++   +  I +E+ + +   ++   V LL++    +++Y+  E +S+  LK Y+D   P  I   ++  +  ++L G+ Y H ++++ RDL P  +L+D+N  IKL  F L++   +  P    +S     +++ Y APE+ L    Y    D+WS G +  ++ T++  FP D   D++ ++ R    P ++    V E P
Sbjct:   16 GVVY---KARDKTTGRMVALKKIRLDTESEGVPSTAI-REISLLK-ELNHPNVVSLLDVVHNQKSLYLVFEFLSQ-DLKKYMDCLPPSGISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLAR--AFGVP---VRSYTHEVVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGTPDDKVWPGVSELP 234          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSF4])

HSP 1 Score: 79.337 bits (194), Expect = 6.650e-16
Identity = 52/173 (30.06%), Postives = 86/173 (49.71%), Query Frame = 2
Query: 1592 HIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQ-NKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKM 2107
             I++EL++     S    V     +  D  + + ME+M  G+L + L K   I   I+   S+ +L GL YL + ++I+ RD+ PS ILV+   +IK+  F +S           S +++F G +  Y +PE      Y  + D+WSFG+ LV++   + P P     EI K+
Sbjct:   81 QIIRELKVLHDCNS-PYIVGFFGAFYSDGEISICMEHMDGGSLDLILKKAGRIPEDILGKISIAVLKGLCYLREIHQIIHRDVKPSNILVNSRGEIKMCDFGVSGQL------IDSMANSFVG-TRSYMSPERLQGNQYTIQSDIWSFGLSLVEMAIGRYPIPPPDPQEIEKV 245          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 91.6633 bits (226), Expect = 8.775e-19
Identity = 60/227 (26.43%), Postives = 112/227 (49.34%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQ 2200
            KA KKE++L+  ++         E  + E R+  +   N     L + +Q  ++++  ME ++ G L  ++ +    D+     +S +I+CGLE+LH   I+ RDL    ++++    IK+  F + K   +      +++  F G +  Y APE+ L + Y+   D WSFGV+L ++   + PF     DE+ +  R+D   Y R+    I    KD++E+   ++
Sbjct:  348 KALKKEVVLMDDDV---------ECTMVEKRVLALAWENPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLNRATFYSAEIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGD----NRATTFCG-TPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVGQSPFHGDDEDELFESIRMDTPHYPRW----INKEAKDLLEQLFDRE 556          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 91.6633 bits (226), Expect = 1.157e-18
Identity = 60/222 (27.03%), Postives = 110/222 (49.55%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEK 2185
            KA KKE++L+  ++         E  + E R+  +   N     L + +Q  ++++  ME ++ G L  ++ +    D+     +S +I+CGLE+LH   I+ RDL    ++++    IK+  F + K   +      +++  F G +  Y APE+ L + Y+   D WSFGV+L ++   + PF     DE+ +  R+D   Y R+    I    KD++E+
Sbjct:  411 KALKKEVVLMDDDV---------ECTMVEKRVLALAWENPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLNRATFYSAEIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGD----NRATTFCG-TPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVGQSPFHGDDEDELFESIRMDTPHYPRW----INKEAKDLLEQ 614          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 91.2781 bits (225), Expect = 1.350e-18
Identity = 60/227 (26.43%), Postives = 112/227 (49.34%), Query Frame = 2
Query: 1520 KATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQ 2200
            KA KKE++L+  ++         E  + E R+  +   N     L + +Q  ++++  ME ++ G L  ++ +    D+     +S +I+CGLE+LH   I+ RDL    ++++    IK+  F + K   +      +++  F G +  Y APE+ L + Y+   D WSFGV+L ++   + PF     DE+ +  R+D   Y R+    I    KD++E+   ++
Sbjct:  411 KALKKEVVLMDDDV---------ECTMVEKRVLALAWENPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLNRATFYSAEIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGD----NRATTFCG-TPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVGQSPFHGDDEDELFESIRMDTPHYPRW----INKEAKDLLEQLFDRE 619          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1 [Source:NCBI gene;Acc:101164682])

HSP 1 Score: 90.5077 bits (223), Expect = 1.901e-18
Identity = 69/247 (27.94%), Postives = 122/247 (49.39%), Query Frame = 2
Query: 1463 ELGISLYKGIIYELLKAKDKATKKEM---LLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLT 2194
            + G  L +G    ++ A++ AT KE    +L + +I+ ENK +     VK  R    +  +  FVKL   +Q D+ +Y  +     G L  Y+ K    D      +S +I+C LEYLH   I+ RDL P  IL+ E+  I++  F  +K  +  S S  +++++F G + +Y +PEL   +   +  DLW+ G ++ ++     PF   + +E +   ++ +  Y     E   P  KD++E+ L+
Sbjct:   66 KFGKILGEGSFSTVVLAREHATGKEFAIKILEKRHIMKENKVQ----YVKRERDLMSSLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHIKGIIHRDLKPENILLSEDMHIQITDFGTAK--QLSSDSKQARANSFVG-TAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPF--RAGNEYLIFQKIIKLEYE--FPEKFFPKAKDLVEQLLS 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1 [Source:NCBI gene;Acc:101164682])

HSP 1 Score: 90.1225 bits (222), Expect = 2.194e-18
Identity = 69/247 (27.94%), Postives = 122/247 (49.39%), Query Frame = 2
Query: 1463 ELGISLYKGIIYELLKAKDKATKKEM---LLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLT 2194
            + G  L +G    ++ A++ AT KE    +L + +I+ ENK +     VK  R    +  +  FVKL   +Q D+ +Y  +     G L  Y+ K    D      +S +I+C LEYLH   I+ RDL P  IL+ E+  I++  F  +K  +  S S  +++++F G + +Y +PEL   +   +  DLW+ G ++ ++     PF   + +E +   ++ +  Y     E   P  KD++E+ L+
Sbjct:   96 KFGKILGEGSFSTVVLAREHATGKEFAIKILEKRHIMKENKVQ----YVKRERDLMSSLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHIKGIIHRDLKPENILLSEDMHIQITDFGTAK--QLSSDSKQARANSFVG-TAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPF--RAGNEYLIFQKIIKLEYE--FPEKFFPKAKDLVEQLLS 331          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074941.1 (SMESG000074941.1)

HSP 1 Score: 1218.37 bits (3151), Expect = 0.000e+0
Identity = 628/646 (97.21%), Postives = 633/646 (97.99%), Query Frame = 2
Query:  167 QSLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQXXXXXXXXXXXXXXXXXXXXXXXFEVRFKLFTKICRKHQKSKNRYEILKSRKQEYLKDLIHENESKSIESIRSSLEETIDRKLNELMEKMESLLDQNNLPIKFKVDNKVLEVAVTENDTAVKIKRDICQRLPLRNSDSFKRMIMIYYGSLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKSGNILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIVK 2104
            QSLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQIKKIFTLLWILIFIIAIILVLIV EVRFKLFTKICRKHQKSK+RYEILKSRK EYLKDLI  NESKSIE IRSSLEETIDRKLNELM KMESLLDQNNLPIKFKVD++VLEVAVTENDTAVKIKRDICQRLP RNSDSFKRMIM Y+  LIDDNEYLLKRLET NKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKS NILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELG SLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRD+IVK
Sbjct:   15 QSLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQIKKIFTLLWILIFIIAIILVLIVVEVRFKLFTKICRKHQKSKSRYEILKSRKHEYLKDLILANESKSIERIRSSLEETIDRKLNELMAKMESLLDQNNLPIKFKVDSQVLEVAVTENDTAVKIKRDICQRLPGRNSDSFKRMIMKYHRCLIDDNEYLLKRLETRNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKSENILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGTSLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDQIVK 660          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074941.1 (SMESG000074941.1)

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 498/533 (93.43%), Postives = 510/533 (95.68%), Query Frame = 2
Query:  167 QSLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQXXXXXXXXXXXXXXXXXXXXXXXFEVRFKLFTKICRKHQKSKNRYEILKSRKQEYLKDLIHENESKSIESIRSSLEETIDRKLNELMEKMESLLDQNNLPIKFKVDNKVLEVAVTENDTAVKIKRDICQRLPLRNSDSFKRMIMIYYGSLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKSGNILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIV 1765
            QSLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQIKKIFTLLWILIFIIAIILVLIV EVRFKLFTKICRKHQKSK+RYEILKSRK EYLKDLI  NESKSIE IRSSLEETIDRKLNELM KMESLLDQNNLPIKFKVD++VLEVAVTENDTAVKIKRDICQRLP RNSDSFKRMIM Y+  LIDDNEYLLKRLET NKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKS NILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELG SLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSE + ++    +    ++++
Sbjct:   15 QSLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQIKKIFTLLWILIFIIAIILVLIVVEVRFKLFTKICRKHQKSKSRYEILKSRKHEYLKDLILANESKSIERIRSSLEETIDRKLNELMAKMESLLDQNNLPIKFKVDSQVLEVAVTENDTAVKIKRDICQRLPGRNSDSFKRMIMKYHRCLIDDNEYLLKRLETRNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKSENILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGTSLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEVSFELIFCNFHSSQVQLM 547          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074943.1 (SMESG000074943.1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 395/528 (74.81%), Postives = 448/528 (84.85%), Query Frame = 2
Query:  176 HEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQXXXXXXXXXXXXXXXXXXXXXXXFEVRFKLFTKICRKHQKSKNRYEILKSRKQEYLKDLIHENESKSIESIRSSLEETIDRKLNELMEKMESLLDQNNLPIKFKVDNKVLEVAVTENDTAVKIKRDICQRLPLRNSDSFKRMIMIYYGSLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKSGNILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIK 1759
            +E P+  C + + FKT++  C  F+  C+K  D++C+NFQ +C QCPPSNYS+LM +DL+ VK EL +TK QLEA+K QS++ +N+ S +L KQN QI  ++T  WI+I ++  + ++   +VRF+  T  CRK++K                +D I+ N++KSIESIRS++E TIDRK NE M KME+  DQNNLPIKFKVD++VLEVAVTENDTAVKIKRDICQRLP R+SDSFKRMIM YY SLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRK+ NILDLQKIIKAHFNNPSDLIILKDGLKLEG QTFEGWLDDTCLRVI SNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKG I +L KA DKATKKEMLLL+ N++A+N   +NEHI+KELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPI+IK
Sbjct:   19 NEDPKFSC-VKNLFKTQNASCAGFHNFCMKNEDVDCINFQNVCNQCPPSNYSILMLIDLINVKTELNQTKHQLEAIKVQSQIYENQISESLKKQNLQINNLYTFFWIIIILLIFLALIS-VDVRFRFLTNFCRKNRK----------------RDSIYANKNKSIESIRSTVEVTIDRKFNEFMSKMETSFDQNNLPIKFKVDSQVLEVAVTENDTAVKIKRDICQRLPWRDSDSFKRMIMKYYESLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKAENILDLQKIIKAHFNNPSDLIILKDGLKLEGSQTFEGWLDDTCLRVIASNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKGKISQLYKAIDKATKKEMLLLKYNLVAKNNLPKNEHIMKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIEIK 528          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074943.1 (SMESG000074943.1)

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 392/528 (74.24%), Postives = 440/528 (83.33%), Query Frame = 2
Query:  176 HEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQXXXXXXXXXXXXXXXXXXXXXXXFEVRFKLFTKICRKHQKSKNRYEILKSRKQEYLKDLIHENESKSIESIRSSLEETIDRKLNELMEKMESLLDQNNLPIKFKVDNKVLEVAVTENDTAVKIKRDICQRLPLRNSDSFKRMIMIYYGSLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKSGNILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFEGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIK 1759
            +E P+  C + + FKT++  C  F+  C+K  D++C+NFQ +C QCPPSNYS+LM +DL+ VK EL +TK QLEA+K QS++ +N+ S +L KQN QI  +   L ++             +VRF+  T  CRK++K                +D I+ N++KSIESIRS++E TIDRK NE M KME+  DQNNLPIKFKVD++VLEVAVTENDTAVKIKRDICQRLP R+SDSFKRMIM YY SLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRK+ NILDLQKIIKAHFNNPSDLIILKDGLKLEG QTFEGWLDDTCLRVI SNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKG I +L KA DKATKKEMLLL+ N++A+N   +NEHI+KELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPI+IK
Sbjct:   19 NEDPKFSC-VKNLFKTQNASCAGFHNFCMKNEDVDCINFQNVCNQCPPSNYSILMLIDLINVKTELNQTKHQLEAIKVQSQIYENQISESLKKQNLQIIILLIFLALIS-----------VDVRFRFLTNFCRKNRK----------------RDSIYANKNKSIESIRSTVEVTIDRKFNEFMSKMETSFDQNNLPIKFKVDSQVLEVAVTENDTAVKIKRDICQRLPWRDSDSFKRMIMKYYESLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKAENILDLQKIIKAHFNNPSDLIILKDGLKLEGSQTFEGWLDDTCLRVIASNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGISLYKGKISQLYKAIDKATKKEMLLLKYNLVAKNNLPKNEHIMKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIEIK 518          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074921.1 (SMESG000074921.1)

HSP 1 Score: 327.405 bits (838), Expect = 5.552e-101
Identity = 230/710 (32.39%), Postives = 388/710 (54.65%), Query Frame = 2
Query:  170 SLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQXXXXXXXXXXXXXXXXXXXXXXXFEVRFKLFTKI--CRKHQKSKNRYEILKSRKQEYLK-DLIHENESKSIESIRSSLEETIDRKLNELMEKMESLLDQNNLPI-KFKVD--NKVLEVAVTENDTAVKIKRDICQRLPLRNSDSFKRMIMIYYGSLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNIEMEHFPGKFIKIRKSGNILDLQKIIKAHFNNPSDLII--LKDGLKLEGPQTFEGW--LDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVEL-GISLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDEIV----KMHRLD-QFPYNRYSTEVIEPPLKDIIEKCLTKQDER--TSLILLKENFQT 2245
            S  E+P S C I  PFKT +N C +F +VCVK  D EC NFQ +C+QCP  NYS+  F+D+ T+ + + K +D++                    QN  I     L++ ++F+I +ILV++  EVRFKL TKI  C   ++++  Y+ILKSRK  YL+ D +    ++  + +   +E+ ID ++N +   +E LL    + I KF+V   +K +E+ V  N+  ++IKR IC R P    DS+K+M +I  G  +DDN YLL ++ +    + C  D+ INP+DF+V+++          +++K+  + +++ +I +     SD +I  + +G  L    T E +   DD  +++I     +LTI ++FD+K    ++Y   DS+  +K++ A     D+   VLFL    L   KF+Y Y I+ + S+++C L+R +G+ + G ++ K   ++LL  +   T++++L+ + ++++E      + I+KE+ +FQI++ +E+FVKLL IY  +  +Y  ME +   ++  ++ K  P+    +  W  +IL GL YLH N ++  ++ P+ I+VD    +KL  FN+S    Y +   F    N++    RY APE+F +E      D+WSFG VL+ I T  +P+  LS  E+V    K HR+   FP +  S E     LK  ++ CL    E+  T+  LL+  F T
Sbjct:   18 SREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSKIEDKM-----------------FQNQNIIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRK--YLENDNLFSKWNEVCQDMSRKMED-IDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAKMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNIS-VNIYETDGLFI---NYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDE-----LKAFLQNCLIYNPEKRPTAQQLLENEFIT 698          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCQ2.568e-1826.52protein kinase C theta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCQ4.395e-1826.52protein kinase C theta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCQ5.326e-1826.52protein kinase C theta [Source:HGNC Symbol;Acc:HGN... [more]
FGFR21.243e-1725.10fibroblast growth factor receptor 2 [Source:HGNC S... [more]
PRKCD4.017e-1725.28protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkg-21.451e-1625.83Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
pkg-21.451e-1625.83Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
pkg-21.451e-1625.83Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
pkg-24.931e-1625.83Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
pkg-25.665e-1625.83Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG143052.593e-1627.13gene:FBgn0038630 transcript:FBtr0083636[more]
CG143052.593e-1627.13gene:FBgn0038630 transcript:FBtr0083634[more]
CG143052.593e-1627.13gene:FBgn0038630 transcript:FBtr0305956[more]
tor9.438e-1532.26gene:FBgn0003733 transcript:FBtr0088938[more]
tor9.992e-1532.26gene:FBgn0003733 transcript:FBtr0339117[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcq1.805e-1924.18protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-... [more]
prkcq2.162e-1924.18protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-... [more]
BX005175.18.221e-1926.48protein kinase C, delta b [Source:NCBI gene;Acc:10... [more]
prkcq8.890e-1927.54protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-... [more]
prkcdb1.042e-1826.48protein kinase C, delta b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af11.194e-2127.78U2 small nuclear RNA auxiliary factor 1 [Source:Xe... [more]
ENSXETT00000045672.16.461e-2127.49protein kinase C delta type-like [Source:NCBI gene... [more]
tsen153.269e-1828.08tRNA splicing endonuclease subunit 15 [Source:Xenb... [more]
c1orf843.575e-1825.19chromosome 1 open reading frame 84 [Source:Xenbase... [more]
c1orf845.665e-1825.81chromosome 1 open reading frame 84 [Source:Xenbase... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkcq1.540e-1725.65protein kinase C, theta [Source:MGI Symbol;Acc:MGI... [more]
Pdpk12.521e-1725.973-phosphoinositide dependent protein kinase 1 [Sou... [more]
Fgfr23.097e-1724.70fibroblast growth factor receptor 2 [Source:MGI Sy... [more]
Fgfr23.299e-1724.70fibroblast growth factor receptor 2 [Source:MGI Sy... [more]
Fgfr23.983e-1724.70fibroblast growth factor receptor 2 [Source:MGI Sy... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QGC0|PRKC_STAAE9.974e-1827.71Serine/threonine-protein kinase PrkC OS=Staphyloco... [more]
sp|Q04759|KPCT_HUMAN2.558e-1726.52Protein kinase C theta type OS=Homo sapiens OX=960... [more]
sp|Q9WTQ0|KPCT_RAT4.344e-1726.09Protein kinase C theta type OS=Rattus norvegicus O... [more]
sp|Q03364|FGFR2_XENLA4.674e-1725.40Fibroblast growth factor receptor 2 OS=Xenopus lae... [more]
sp|Q02111|KPCT_MOUSE1.077e-1625.65Protein kinase C theta type OS=Mus musculus OX=100... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8G7671.261e-2033.53Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A9TWT19.575e-2027.04Predicted protein (Fragment) OS=Physcomitrella pat... [more]
A0A0R3RIB63.241e-1930.70Protein kinase domain-containing protein OS=Elaeop... [more]
A0A1I7VS837.679e-1930.70STE/STE11/MEKK2 protein kinase OS=Loa loa OX=7209 ... [more]
A0A261BJT08.780e-1933.33Uncharacterized protein (Fragment) OS=Caenorhabdit... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdpk1b2.592e-1828.643-phosphoinositide-dependent protein kinase 1 [Sou... [more]
pdpk1a1.105e-1727.383-phosphoinositide-dependent protein kinase 1 [Sou... [more]
prkcdb1.407e-1724.90protein kinase C delta type [Source:NCBI gene;Acc:... [more]
prkcdb1.994e-1724.90protein kinase C delta type [Source:NCBI gene;Acc:... [more]
prkcq3.830e-1726.96protein kinase C theta [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr21.776e-1827.54fibroblast growth factor receptor 2 [Source:NCBI g... [more]
pdpk1b2.851e-1726.823-phosphoinositide dependent protein kinase 1b [So... [more]
ENSPMAT00000006402.15.486e-1721.62pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 ... [more]
ENSPMAT00000008193.14.390e-1634.56pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
ENSPMAT00000002088.14.580e-1634.56pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 ge... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK31.134e-1629.34cAMP-dependent protein kinase catalytic subunit; p... [more]
MKK21.220e-1630.14MAPKK involved in the protein kinase C signaling p... [more]
STE116.688e-1628.21Signal transducing MEK kinase; involved in pheromo... [more]
TPK21.274e-1526.32cAMP-dependent protein kinase catalytic subunit; p... [more]
SCH93.112e-1531.86AGC family protein kinase; functional ortholog of ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO279763.489e-2029.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361501.012e-1924.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414102.679e-1928.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414032.839e-1626.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455536.650e-1630.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcda8.775e-1926.43protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
prkcda1.157e-1827.03protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
prkcda1.350e-1826.43protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
pdpk1b1.901e-1827.943-phosphoinositide dependent protein kinase 1 [Sou... [more]
pdpk1b2.194e-1827.943-phosphoinositide dependent protein kinase 1 [Sou... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074941.10.000e+097.21SMESG000074941.1[more]
SMESG000074941.10.000e+093.43SMESG000074941.1[more]
SMESG000074943.10.000e+074.81SMESG000074943.1[more]
SMESG000074943.10.000e+074.24SMESG000074943.1[more]
SMESG000074921.15.552e-10132.39SMESG000074921.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029902 ID=SMED30029902|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2323bp
TAATCAGCACACAAATTTATAGAATATTGATTATTATTATAGTTATTTGT
GTGCTATGTGATAATTAATTGGACAACGAAAGCTCATAATAATTGTTAAA
GCAATTTTAATAAAGGATGTTAGAATGATCAAATTTGTCTTCATTATTCT
AATAATATTCATCAAACAATCCCTCCATGAAATCCCGAGATCGCACTGTC
CTATAGGCTCCCCATTCAAAACAAAAGACAACCTTTGCAAGGATTTCTAT
GAGGTCTGTGTGAAACAAAACGACCTGGAATGCCTAAATTTTCAAACTAT
TTGCAAACAATGTCCACCATCAAATTACAGTGTCTTGATGTTTATGGATT
TATTAACTGTCAAAAATGAGTTAATTAAAACAAAAGATCAACTTGAAGCT
TTGAAAACTCAATCAGAATTATGTCAAAACAAGACTTCCGGGACATTGAT
GAAACAAAATCAACAAATTAAAAAAATATTCACTCTTTTGTGGATACTCA
TATTTATTATAGCAATCATTCTGGTTCTGATTGTTTTCGAGGTCCGGTTC
AAATTATTCACAAAGATTTGCAGGAAACATCAGAAATCAAAAAACAGATA
TGAAATTTTGAAAAGTCGAAAACAGGAATATCTCAAAGATTTAATTCATG
AAAATGAGAGTAAATCTATTGAAAGCATTAGAAGTTCTCTAGAAGAAACA
ATTGATAGAAAATTGAATGAGCTCATGGAAAAGATGGAAAGCTTGTTGGA
TCAAAATAATTTACCAATAAAGTTCAAAGTTGACAACAAAGTATTGGAAG
TGGCAGTTACCGAAAATGATACAGCTGTAAAAATAAAACGAGATATCTGT
CAGAGGTTACCCCTGCGGAATTCAGATAGTTTCAAGAGGATGATAATGAT
ATATTACGGATCTCTCATTGATGATAACGAGTATTTATTAAAGCGTCTCG
AAACCGGAAATAAAATTATCACCTGTGAATTCGATGAGAAAATAAATCCA
AAGGACTTTGTCGTTTTGAATATAGAGATGGAACATTTCCCGGGGAAATT
TATTAAGATTCGAAAATCTGGAAATATTTTAGATCTGCAAAAGATTATTA
AAGCTCATTTCAATAATCCAAGCGATTTAATAATATTGAAGGACGGCCTT
AAACTGGAAGGTCCTCAGACCTTCGAAGGTTGGTTAGATGATACTTGTCT
CCGAGTGATAGAAAGTAACGAAAAAGAATTGACAATATCTAATATATTCG
ATGAGAAGACCACAGTGAGGGTGACCTATTTACCTACTGATTCCGTGGGA
ATAGTCAAAAAGCACATGGCAGATACATTTTCTGCTGATGCAGATAGATT
TGTGCTATTCCTCAGAAATCATTCTTTGGACGAGAATAAATTCATGTATC
AATATAAAATTGAAAATGAATATTCCATTAACTATTGCTGCTTACAGAGG
TTGAACGGGGTTGAGCTTGGCATCAGCCTTTATAAGGGGATAATATATGA
ATTACTAAAAGCAAAAGATAAAGCGACAAAGAAGGAAATGCTCTTACTGA
GATGCAATATAATTGCAGAAAACAAATTCCGAGAGAACGAGCATATTGTG
AAGGAATTGCGGATCTTCCAAATAACAAAATCAAATGAAAGATTTGTAAA
ATTGTTAAACATTTATCAAAAGGACCAAAATGTTTACGTATCCATGGAAA
ATATGAGTGAAGGAACTTTGAAGATGTATTTAGACAAATATTGGCCAATA
GATATCAAAATAGTTTTTGATTGGTCGATGAAAATATTGTGCGGACTGGA
ATATCTTCATCAGAATAAAATAGTTCTTCGTGATTTAAATCCTTCAACTA
TTCTCGTGGATGAGAATAGAGATATCAAATTATACGGATTCAATTTGTCG
AAATATACAGAGTATTACAGTCCAAGTACGTTTTCTAAAAGCGATAATTT
TACTGGTTTGTCGGTGCGTTATTTTGCTCCGGAATTATTTCTGAATGAAG
ATTACAACGAGAAATGCGACCTGTGGTCATTTGGAGTGGTTTTGGTCAAA
ATAACCACAAAAAAGAAGCCATTCCCAGATCTTTCCAGAGATGAGATTGT
TAAAATGCATAGATTAGATCAATTTCCGTATAATAGATATTCCACTGAAG
TCATTGAGCCACCCTTGAAAGACATAATTGAGAAATGTCTAACGAAACAA
GATGAAAGAACATCTTTGATACTGTTAAAAGAAAATTTTCAAACAAAAAT
TTTGCAAGATGAAAATATTATTTAAAACACGAAAAATATTATAAATATTG
AAATATAATTATTTGTTTTTTTT
back to top

protein sequence of SMED30029902-orf-1

>SMED30029902-orf-1 ID=SMED30029902-orf-1|Name=SMED30029902-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=717bp
MIKFVFIILIIFIKQSLHEIPRSHCPIGSPFKTKDNLCKDFYEVCVKQND
LECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELC
QNKTSGTLMKQNQQIKKIFTLLWILIFIIAIILVLIVFEVRFKLFTKICR
KHQKSKNRYEILKSRKQEYLKDLIHENESKSIESIRSSLEETIDRKLNEL
MEKMESLLDQNNLPIKFKVDNKVLEVAVTENDTAVKIKRDICQRLPLRNS
DSFKRMIMIYYGSLIDDNEYLLKRLETGNKIITCEFDEKINPKDFVVLNI
EMEHFPGKFIKIRKSGNILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTF
EGWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMAD
TFSADADRFVLFLRNHSLDENKFMYQYKIENEYSINYCCLQRLNGVELGI
SLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQI
TKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDW
SMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSP
STFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPF
PDLSRDEIVKMHRLDQFPYNRYSTEVIEPPLKDIIEKCLTKQDERTSLIL
LKENFQTKILQDENII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000626Ubiquitin-like_dom
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004697protein kinase C activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular