slc25a-30

Overview
Nameslc25a-30 (AKN21598.1)
Smed IDSMED30029899
Length (bp)1097
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-30 (SMED30029899) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-30 (SMED30029899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-30 (SMED30029899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-30 (SMED30029899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029899

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029899SMESG000044697.1 SMESG000022161.1 Contig1836GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v4_50_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029899SMESG000044697.1 SMESG000022161.1 dd_Smed_v6_50_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-30 vs. Ensembl Human
Match: SLC25A6 (solute carrier family 25 member 6 [Source:HGNC Symbol;Acc:HGNC:10992])

HSP 1 Score: 263.077 bits (671), Expect = 9.049e-86
Identity = 154/295 (52.20%), Postives = 198/295 (67.12%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G++DC VR  K +G++ FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F G+ D   K  KSDGI GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +G++SYP DT+RRRMMM SG+    + Y G++DC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:    6 ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKV 297          

HSP 2 Score: 53.9138 bits (128), Expect = 1.728e-7
Identity = 47/174 (27.01%), Postives = 79/174 (45.40%), Query Frame = 3
Query:  396 KSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVM------SSFALGYGVTVTSGLISYPIDTIRRRMMM---TSGQAVKYKGSIDCTVQIMKNEGFMALMKG 887
            + A+ FAK+  +GG A A+S   V  ++  +  L     S +  + +Q+ G+VD   +  K  G++  +RG + + +     +   F F D  K + LG  D           + A G     TS    YP+D  R R+      SG   +++G  DC V+I K++G   L +G
Sbjct:    3 EQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Human
Match: SLC25A5 (solute carrier family 25 member 5 [Source:HGNC Symbol;Acc:HGNC:10991])

HSP 1 Score: 262.307 bits (669), Expect = 1.851e-85
Identity = 156/293 (53.24%), Postives = 197/293 (67.24%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G+IDC VR  K +G++ FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +  + FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F G+ D   K  KSDGI GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G++DC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K
Sbjct:    6 VSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQ-HASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIK 295          

HSP 2 Score: 52.373 bits (124), Expect = 5.132e-7
Identity = 47/176 (26.70%), Postives = 81/176 (46.02%), Query Frame = 3
Query:  399 SAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGV----------MSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKG 887
            +A+ FAK+  +GG A A+S   V  ++  +  L     S +  + +Q+ G++D   +  K  G++  +RG + + +     +   F F D  K + LG   GV            + A G     TS    YP+D  R R+    G+A    +++G  DC V+I K++G   L +G
Sbjct:    4 AAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLG---GVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Human
Match: SLC25A4 (solute carrier family 25 member 4 [Source:HGNC Symbol;Acc:HGNC:10990])

HSP 1 Score: 258.07 bits (658), Expect = 8.412e-84
Identity = 152/292 (52.05%), Postives = 193/292 (66.10%), Query Frame = 3
Query:   96 SFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            SF ++F   G AA +SKTA APIERVKLL+Q Q    KQ   ++ Y G+IDC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K LF     +  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K  + R+F+G+ D   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  +  S+ +   VT  +GL+SYP DT+RRRMMM SG+    + Y G++DC  +I K+EG  A  KGA +N+LRG+ GA VL  +D+ K
Sbjct:    7 SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQ-HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIK 295          
BLAST of slc25a-30 vs. Ensembl Human
Match: SLC25A31 (solute carrier family 25 member 31 [Source:HGNC Symbol;Acc:HGNC:25319])

HSP 1 Score: 250.366 bits (638), Expect = 1.603e-80
Identity = 152/293 (51.88%), Postives = 189/293 (64.51%), Query Frame = 3
Query:   96 SFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVK-YKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLY 962
            SF ++    G AA +SKTA APIERVKLL+Q Q    KQ   +  Y G++DC VR  + +G   FWRGNLAN IRYFPTQALNFAFKDK K LF     K  +    F  N+ASGGAAGA SL  VY LD+ RTRL  D+   K    RQF G+ D   K  KSDGI GLY+GF +S  GI+VYR  YFG YDT+K LL        + SF +   VT  SG++SYP DT+RRRMMM SG+A + YKG++DC V+I ++EG  +  +GA +N+LRG  GA VL  +DK K+ +
Sbjct:   19 SFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASS-KQISPEARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDI--GKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILSYPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYDKIKEFF 308          

HSP 2 Score: 50.8322 bits (120), Expect = 1.712e-6
Identity = 51/198 (25.76%), Postives = 87/198 (43.94%), Query Frame = 3
Query:  348 AFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGV----------MSSFALGYGVTVTSGLISYPIDTIRRRMMMTSG---QAVKYKGSIDCTVQIMKNEGFMALMKGAGANI 902
            A K   K LFD       A  F K++ +GG A A+S   V  ++  +  L     S +     ++ GMVD   +  +  G    +RG + + +     +   F F D  K L +   +GV          +++ A G     TS  + YP+D  R R+ +  G   +  ++KG  DC ++I K++G   L +G G ++
Sbjct:    6 AKKKAEKRLFD-------ASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFM---SGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSV 193          
BLAST of slc25a-30 vs. Ensembl Human
Match: SLC25A4 (solute carrier family 25 member 4 [Source:HGNC Symbol;Acc:HGNC:10990])

HSP 1 Score: 195.282 bits (495), Expect = 1.404e-60
Identity = 111/196 (56.63%), Postives = 133/196 (67.86%), Query Frame = 3
Query:   96 SFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLK 677
            SF ++F   G AA +SKTA APIERVKLL+Q Q    KQ   ++ Y G+IDC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K LF     +  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K  + R+F+G+ D   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K
Sbjct:    7 SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQ-HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAK 199          

HSP 2 Score: 49.6766 bits (117), Expect = 2.054e-6
Identity = 38/149 (25.50%), Postives = 65/149 (43.62%), Query Frame = 3
Query:  486 RTRLANDVKSSKK--GSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSD----------AGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAV---KYKGSIDCTVQIMKNEGFMALMKG 887
            R +L   V+ + K   + +Q+ G++D   +  K  G +  +RG + + +     +   F F D  K L LG            AG ++S   G     TS    YP+D  R R+    G+     ++ G  DC ++I K++G   L +G
Sbjct:   31 RVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLAS---GGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Celegans
Match: ant-1.3 (Adenine Nucleotide Translocator; Mitochondrial adenine nucleotide translocase 1.3 [Source:UniProtKB/TrEMBL;Acc:G5EFW8])

HSP 1 Score: 248.054 bits (632), Expect = 3.465e-80
Identity = 147/289 (50.87%), Postives = 181/289 (62.63%), Query Frame = 3
Query:   60 KMSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSA---MVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL--GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            K  E  K      F  +    G AA +SKTA APIERVKLL+Q Q   +     D+ Y G++D  VR  K +G    WRGNLAN IRYFPTQALNFAFKD  K +F  K  DK       FA N+ASGGAAGA SL FVY LD+ RTRLA DV    K + R+F G+ D   K  KSDG +GLYRGF +S  GI++YR  YFG +DT K +    G      +++A+   VTV SG+ISYP DT+RRRMMM SG+  V YK ++DC V+I+KNEG  A+ KGA +N+ R
Sbjct:   12 KKKEDKKGFDTRKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASLTIAA-DKRYKGIVDVLVRVPKEQGYAALWRGNLANVIRYFPTQALNFAFKDTYKNIFQ-KGLDKKKDFWKFFAGNLASGGAAGATSLCFVYPLDFARTRLAADV---GKANEREFKGLADCLVKIAKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAKMVFTADGKKLNFFAAWAIAQVVTVGSGIISYPWDTVRRRMMMQSGRKDVLYKNTLDCAVKIIKNEGMSAMFKGALSNVFR 295          
BLAST of slc25a-30 vs. Ensembl Celegans
Match: ant-1.4 (Adenine Nucleotide Translocator; Mitochondrial adenine nucleotide translocase 1.4 [Source:UniProtKB/TrEMBL;Acc:G5EFU2])

HSP 1 Score: 247.284 bits (630), Expect = 8.690e-80
Identity = 146/289 (50.52%), Postives = 181/289 (62.63%), Query Frame = 3
Query:   60 KMSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSA---MVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL--GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            K  E  K      F  +    G AA +SKTA APIERVKLL+Q Q   +     D+ Y G++D  VR  K +G    WRGNLAN IRYFPTQALNFAFKD  K +F  K  DK       FA N+ASGGAAGA SL FVY LD+ RTRLA DV    K + R+F G+ D   K  KSDG +GLYRGF +S  GI++YR  YFG +DT K +    G      +++A+   VTV SG++SYP DT+RRRMMM SG+  V YK ++DC V+I+KNEG  A+ KGA +N+ R
Sbjct:   12 KKKEDKKGFDTRKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASLTIAA-DKRYKGIVDVLVRVPKEQGYAALWRGNLANVIRYFPTQALNFAFKDTYKNIFQ-KGLDKKKDFWKFFAGNLASGGAAGATSLCFVYPLDFARTRLAADV---GKANEREFKGLADCLVKIAKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAKMVFTADGKKLNFFAAWAIAQVVTVGSGILSYPWDTVRRRMMMQSGRKDVLYKNTLDCAVKIIKNEGMSAMFKGALSNVFR 295          
BLAST of slc25a-30 vs. Ensembl Celegans
Match: ant-1.1 (Adenine Nucleotide Translocator [Source:UniProtKB/TrEMBL;Acc:G3MU69])

HSP 1 Score: 244.588 bits (623), Expect = 5.505e-79
Identity = 140/270 (51.85%), Postives = 182/270 (67.41%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF----DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFA---LGYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G AA +SKTA APIERVKLL+Q Q +  K   +D+ Y G++D  +R  K +G+   WRGNLAN IRYFPTQA+NFAFKD  KA+F    D KK       FA N+ASGGAAGA SL FVY LD+ RTRLA D+    K + R+F G+ D   K +KSDG +GLYRGF +S  GI++YR  YFG +DT K ++  SD   ++ FA   +   VTV SG++SYP DT+RRRMMM SG+  + YK ++DC  +I++NEG  A+ KGA +N+ R
Sbjct:   20 GTAAAVSKTAVAPIERVKLLLQVQ-DASKAIAVDKRYKGIMDVLIRVPKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKD--FWKFFAGNLASGGAAGATSLCFVYPLDFARTRLAADI---GKANDREFKGLADCLIKIVKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAK-MVFASDGQKLNFFAAWGIAQVVTVGSGILSYPWDTVRRRMMMQSGRKDILYKNTLDCAKKIIQNEGMSAMFKGALSNVFR 282          
BLAST of slc25a-30 vs. Ensembl Celegans
Match: ant-1.1 (Adenine Nucleotide Translocator [Source:UniProtKB/TrEMBL;Acc:G3MU69])

HSP 1 Score: 244.588 bits (623), Expect = 5.505e-79
Identity = 140/270 (51.85%), Postives = 182/270 (67.41%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF----DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFA---LGYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G AA +SKTA APIERVKLL+Q Q +  K   +D+ Y G++D  +R  K +G+   WRGNLAN IRYFPTQA+NFAFKD  KA+F    D KK       FA N+ASGGAAGA SL FVY LD+ RTRLA D+    K + R+F G+ D   K +KSDG +GLYRGF +S  GI++YR  YFG +DT K ++  SD   ++ FA   +   VTV SG++SYP DT+RRRMMM SG+  + YK ++DC  +I++NEG  A+ KGA +N+ R
Sbjct:   20 GTAAAVSKTAVAPIERVKLLLQVQ-DASKAIAVDKRYKGIMDVLIRVPKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKD--FWKFFAGNLASGGAAGATSLCFVYPLDFARTRLAADI---GKANDREFKGLADCLIKIVKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAK-MVFASDGQKLNFFAAWGIAQVVTVGSGILSYPWDTVRRRMMMQSGRKDILYKNTLDCAKKIIQNEGMSAMFKGALSNVFR 282          
BLAST of slc25a-30 vs. Ensembl Celegans
Match: ant-1.1 (Adenine Nucleotide Translocator [Source:UniProtKB/TrEMBL;Acc:G3MU69])

HSP 1 Score: 244.588 bits (623), Expect = 5.505e-79
Identity = 140/270 (51.85%), Postives = 182/270 (67.41%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF----DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFA---LGYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G AA +SKTA APIERVKLL+Q Q +  K   +D+ Y G++D  +R  K +G+   WRGNLAN IRYFPTQA+NFAFKD  KA+F    D KK       FA N+ASGGAAGA SL FVY LD+ RTRLA D+    K + R+F G+ D   K +KSDG +GLYRGF +S  GI++YR  YFG +DT K ++  SD   ++ FA   +   VTV SG++SYP DT+RRRMMM SG+  + YK ++DC  +I++NEG  A+ KGA +N+ R
Sbjct:   20 GTAAAVSKTAVAPIERVKLLLQVQ-DASKAIAVDKRYKGIMDVLIRVPKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKD--FWKFFAGNLASGGAAGATSLCFVYPLDFARTRLAADI---GKANDREFKGLADCLIKIVKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAK-MVFASDGQKLNFFAAWGIAQVVTVGSGILSYPWDTVRRRMMMQSGRKDILYKNTLDCAKKIIQNEGMSAMFKGALSNVFR 282          
BLAST of slc25a-30 vs. Ensembl Fly
Match: sesB (gene:FBgn0003360 transcript:FBtr0073424)

HSP 1 Score: 257.684 bits (657), Expect = 8.317e-84
Identity = 155/304 (50.99%), Postives = 196/304 (64.47%), Query Frame = 3
Query:   66 SEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQ---AVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            S+ GK    + F ++F   G +A +SKTA APIERVKLL+Q Q  + KQ   D+ Y G++DC +R  K +G   FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D   + KG  R+F G+ +   K  KSDGIVGLYRGF +S  GI++YR  YFGFYDT + +L    +  +  S+A+   VT  +G++SYP DT+RRRMMM SG+    V YK ++ C   I K EG  A  KGA +NILRG  GA VL  +D+ K +
Sbjct:   12 SKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQ-HISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD---TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKV 311          
BLAST of slc25a-30 vs. Ensembl Fly
Match: sesB (gene:FBgn0003360 transcript:FBtr0073422)

HSP 1 Score: 257.684 bits (657), Expect = 8.317e-84
Identity = 155/304 (50.99%), Postives = 196/304 (64.47%), Query Frame = 3
Query:   66 SEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQ---AVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            S+ GK    + F ++F   G +A +SKTA APIERVKLL+Q Q  + KQ   D+ Y G++DC +R  K +G   FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D   + KG  R+F G+ +   K  KSDGIVGLYRGF +S  GI++YR  YFGFYDT + +L    +  +  S+A+   VT  +G++SYP DT+RRRMMM SG+    V YK ++ C   I K EG  A  KGA +NILRG  GA VL  +D+ K +
Sbjct:   12 SKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQ-HISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD---TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKV 311          
BLAST of slc25a-30 vs. Ensembl Fly
Match: sesB (gene:FBgn0003360 transcript:FBtr0346384)

HSP 1 Score: 256.529 bits (654), Expect = 1.462e-83
Identity = 154/301 (51.16%), Postives = 194/301 (64.45%), Query Frame = 3
Query:   75 GKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQ---AVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            GK    + F ++F   G +A +SKTA APIERVKLL+Q Q  + KQ   D+ Y G++DC +R  K +G   FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D   + KG  R+F G+ +   K  KSDGIVGLYRGF +S  GI++YR  YFGFYDT + +L    +  +  S+A+   VT  +G++SYP DT+RRRMMM SG+    V YK ++ C   I K EG  A  KGA +NILRG  GA VL  +D+ K +
Sbjct:    2 GKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQ-HISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD---TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKV 298          
BLAST of slc25a-30 vs. Ensembl Fly
Match: sesB (gene:FBgn0003360 transcript:FBtr0073423)

HSP 1 Score: 256.529 bits (654), Expect = 1.462e-83
Identity = 154/301 (51.16%), Postives = 194/301 (64.45%), Query Frame = 3
Query:   75 GKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQ---AVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            GK    + F ++F   G +A +SKTA APIERVKLL+Q Q  + KQ   D+ Y G++DC +R  K +G   FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D   + KG  R+F G+ +   K  KSDGIVGLYRGF +S  GI++YR  YFGFYDT + +L    +  +  S+A+   VT  +G++SYP DT+RRRMMM SG+    V YK ++ C   I K EG  A  KGA +NILRG  GA VL  +D+ K +
Sbjct:    2 GKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQ-HISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD---TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKV 298          
BLAST of slc25a-30 vs. Ensembl Fly
Match: sesB (gene:FBgn0003360 transcript:FBtr0073421)

HSP 1 Score: 256.529 bits (654), Expect = 1.462e-83
Identity = 154/301 (51.16%), Postives = 194/301 (64.45%), Query Frame = 3
Query:   75 GKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQ---AVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            GK    + F ++F   G +A +SKTA APIERVKLL+Q Q  + KQ   D+ Y G++DC +R  K +G   FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D   + KG  R+F G+ +   K  KSDGIVGLYRGF +S  GI++YR  YFGFYDT + +L    +  +  S+A+   VT  +G++SYP DT+RRRMMM SG+    V YK ++ C   I K EG  A  KGA +NILRG  GA VL  +D+ K +
Sbjct:    2 GKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQ-HISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD---TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKV 298          
BLAST of slc25a-30 vs. Ensembl Zebrafish
Match: slc25a6 (solute carrier family 25 member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-446])

HSP 1 Score: 267.314 bits (682), Expect = 1.278e-87
Identity = 156/293 (53.24%), Postives = 197/293 (67.24%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
             SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G++DC VR  K +G   FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K GS+R+F+G+ D   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  +M S+ +   VT  +G++SYP DT+RRRMMM SG+    + Y G++DC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+FK
Sbjct:    6 FSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQ-HASKQISADKQYKGIVDCIVRIPKEQGFASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGSTREFSGLADCLAKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIMVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTLDCWRKIARDEGSKAFFKGALSNVLRGMGGAFVLVLYDEFK 295          

HSP 2 Score: 50.8322 bits (120), Expect = 1.069e-6
Identity = 46/173 (26.59%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  399 SAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVM------SSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKG 887
            +A  FAK+  +GG A A+S   V  ++  +  L     S +  + +Q+ G+VD   +  K  G    +RG + + +     +   F F D  K + LG  D           + A G     TS    YP+D  R R+    G+A    ++ G  DC  +I K++G   L +G
Sbjct:    4 AAFSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIVDCIVRIPKEQGFASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGSTREFSGLADCLAKIFKSDGLRGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Zebrafish
Match: slc25a6 (solute carrier family 25 member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-446])

HSP 1 Score: 266.929 bits (681), Expect = 1.973e-87
Identity = 156/293 (53.24%), Postives = 197/293 (67.24%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
             SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G++DC VR  K +G   FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K GS+R+F+G+ D   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  +M S+ +   VT  +G++SYP DT+RRRMMM SG+    + Y G++DC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+FK
Sbjct:    6 FSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQ-HASKQISADKQYKGIVDCIVRIPKEQGFASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGSTREFSGLADCLAKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIMVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTLDCWRKIARDEGGKAFFKGALSNVLRGMGGAFVLVLYDEFK 295          

HSP 2 Score: 50.8322 bits (120), Expect = 1.059e-6
Identity = 46/173 (26.59%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  399 SAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVM------SSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKG 887
            +A  FAK+  +GG A A+S   V  ++  +  L     S +  + +Q+ G+VD   +  K  G    +RG + + +     +   F F D  K + LG  D           + A G     TS    YP+D  R R+    G+A    ++ G  DC  +I K++G   L +G
Sbjct:    4 AAFSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIVDCIVRIPKEQGFASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGSTREFSGLADCLAKIFKSDGLRGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Zebrafish
Match: slc25a5 (solute carrier family 25 member 5 [Source:ZFIN;Acc:ZDB-GENE-020419-9])

HSP 1 Score: 259.61 bits (662), Expect = 1.441e-84
Identity = 155/295 (52.54%), Postives = 197/295 (66.78%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F+G+ +   K  KSDGI GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G+IDC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:    6 ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQITADKQYKGIMDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGAEREFSGLGNCLVKISKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLASYPFDTVRRRMMMQSGRKGADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKV 297          
BLAST of slc25a-30 vs. Ensembl Zebrafish
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 254.603 bits (649), Expect = 1.042e-82
Identity = 153/293 (52.22%), Postives = 191/293 (65.19%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +SF ++F   G AA ISKTA APIERVKLL+Q Q    KQ   D  Y G+IDC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D+   K  + R+F G+ +   K  KSDG+ GLY GF +S  GI++YR  YFG YDT K +L       ++ S+ +   VT  +G+ISYP DT+RRRMMM SG+    + YKG+IDC  +I K+EG  A  KGA +N++RG  GA VL  +D+ K
Sbjct:    6 ISFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQ-HASKQITADMQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADI--GKGAAEREFTGLGNCVAKIFKSDGLRGLYLGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKHTHIVVSWMIAQTVTAVAGIISYPFDTVRRRMMMQSGRKGADIMYKGTIDCWKKIAKDEGGKAFFKGALSNVIRGAGGAFVLVLYDEIK 295          
BLAST of slc25a-30 vs. Ensembl Zebrafish
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 254.603 bits (649), Expect = 1.042e-82
Identity = 153/293 (52.22%), Postives = 191/293 (65.19%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +SF ++F   G AA ISKTA APIERVKLL+Q Q    KQ   D  Y G+IDC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D+   K  + R+F G+ +   K  KSDG+ GLY GF +S  GI++YR  YFG YDT K +L       ++ S+ +   VT  +G+ISYP DT+RRRMMM SG+    + YKG+IDC  +I K+EG  A  KGA +N++RG  GA VL  +D+ K
Sbjct:    6 ISFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQ-HASKQITADMQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADI--GKGAAEREFTGLGNCVAKIFKSDGLRGLYLGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKHTHIVVSWMIAQTVTAVAGIISYPFDTVRRRMMMQSGRKGADIMYKGTIDCWKKIAKDEGGKAFFKGALSNVIRGAGGAFVLVLYDEIK 295          
BLAST of slc25a-30 vs. Ensembl Xenopus
Match: epha10 (EPH receptor A10 [Source:Xenbase;Acc:XB-GENE-5893530])

HSP 1 Score: 258.455 bits (659), Expect = 5.218e-84
Identity = 153/293 (52.22%), Postives = 195/293 (66.55%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F  +  K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K  + R+F G+ D   K  +SDGI GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +G +SYP DT+RRRMMM SG+    + Y G+IDC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K
Sbjct:    6 ISFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQ-HASKQITADKHYKGIMDCVVRIPKEQGFMSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKKTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKGNAEREFKGLGDCLVKISRSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQTVTAVAGFVSYPFDTVRRRMMMQSGRKGADIMYSGTIDCWRKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELK 295          
BLAST of slc25a-30 vs. Ensembl Xenopus
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-GENE-966791])

HSP 1 Score: 253.832 bits (647), Expect = 3.206e-82
Identity = 152/293 (51.88%), Postives = 194/293 (66.21%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            LSF ++F   G AA ISKTA APIERVKLL+Q Q    KQ  +D+ Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    F  N+ASGGAAGA SL FVY LD+ RTRLA DV   K  + R+F G+ +   K  K DG+ GLY+GF +S  GI++YR  YFG YDT K ++    +  ++ S+ +   VT  +GL+SYP DT+RRRMMM SG+    + YKG+IDC  +I K+EG  A  KGA +N+LRG+ GA VL  +D+ K
Sbjct:    6 LSFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQISVDKQYKGIMDCVVRIPKEQGFISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRFFVGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKGLNEREFTGLGNCIAKIYKLDGLKGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMMPDPKNVHIVVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYKGTIDCWKKISKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIK 295          
BLAST of slc25a-30 vs. Ensembl Xenopus
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:100216243])

HSP 1 Score: 101.293 bits (251), Expect = 9.552e-24
Identity = 81/256 (31.64%), Postives = 124/256 (48.44%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKT-LKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLK-------PLLLG------SDAGVMSSFA--LGYGVT-VTSGLISYPIDTIRRRMMMTS 803
            K+  +  +F   G A+  +KT  AP++R+K+L+Q Q    +       + G++       K EG +  ++GN A  +R FP  A+ F   DK K +   +    S  V    + +G  AG  +++F Y LD  R RLA  VK   +     +NG++  +K   LK  GI G YRG V + VG+  Y G  F  ++TLK       P LLG       D  V+ + A  L  G+    +  ISYP+D  RRRM +++
Sbjct:   20 KEYYWLRSFVAGGVASCCAKTTIAPLDRIKILLQAQNVHYR-------HLGILATAFAVQKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDKYKKVLKKRFIKHSEHV--PRLMAGSMAGITAVIFTYPLDMVRARLAFQVKGEHR-----YNGIIHAFKTIYLKEGGIRGYYRGLVPTIVGMAPYAGFSFFTFETLKTAGLRHAPELLGKPSSDNPDVMVLKTHASLLCGGIAGAIAQSISYPLDVTRRRMQLSA 261          
BLAST of slc25a-30 vs. Ensembl Xenopus
Match: slc25a24 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 [Source:NCBI gene;Acc:496457])

HSP 1 Score: 100.523 bits (249), Expect = 6.308e-23
Identity = 76/277 (27.44%), Postives = 127/277 (45.85%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL------GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQ---------IMKNEGFMALMKGAGANILR 908
            G A  +S+T  AP++R+K+++Q  G         +    +I    +  K  G+   WRGN  N I+  P  A+ F   ++ K LF    ++   +  A+   +G  AGA +   +Y ++  +TRLA        G + Q++GM D  KK ++ +G+   Y+G++ + +GI+ Y G     Y+TLK   L       ++ GV+     G   +    L SYP+  IR RM        + + SI+   Q         I+  EGF  L +G   N L+
Sbjct:  140 GMAGAVSRTGTAPLDRLKVMMQVHG--------SKGNANIITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLF---TSESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRLA-------VGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRM--------QAQASIEGAPQLNMGGLFRKIVAKEGFFGLYRGIAPNFLK 390          
BLAST of slc25a-30 vs. Ensembl Xenopus
Match: slc25a24 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 [Source:NCBI gene;Acc:496457])

HSP 1 Score: 100.138 bits (248), Expect = 8.069e-23
Identity = 76/277 (27.44%), Postives = 127/277 (45.85%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL------GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQ---------IMKNEGFMALMKGAGANILR 908
            G A  +S+T  AP++R+K+++Q  G         +    +I    +  K  G+   WRGN  N I+  P  A+ F   ++ K LF    ++   +  A+   +G  AGA +   +Y ++  +TRLA        G + Q++GM D  KK ++ +G+   Y+G++ + +GI+ Y G     Y+TLK   L       ++ GV+     G   +    L SYP+  IR RM        + + SI+   Q         I+  EGF  L +G   N L+
Sbjct:  148 GMAGAVSRTGTAPLDRLKVMMQVHG--------SKGNANIITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFT---SESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRLA-------VGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRM--------QAQASIEGAPQLNMGGLFRKIVAKEGFFGLYRGIAPNFLK 398          
BLAST of slc25a-30 vs. Ensembl Mouse
Match: Slc25a5 (solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 5 [Source:MGI Symbol;Acc:MGI:1353496])

HSP 1 Score: 261.922 bits (668), Expect = 1.878e-85
Identity = 156/293 (53.24%), Postives = 195/293 (66.55%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G+IDC VR  K +G++ FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F G+ D   K  KSDGI GLY+GF +S  GI++YR  YFG YDT K +L    +  +  S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G++DC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K
Sbjct:    6 VSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQ-HASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIK 295          

HSP 2 Score: 53.5286 bits (127), Expect = 1.516e-7
Identity = 48/176 (27.27%), Postives = 81/176 (46.02%), Query Frame = 3
Query:  399 SAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGV----------MSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKG 887
            +A+ FAK+  +GG A A+S   V  ++  +  L     S +  + +Q+ G++D   +  K  G++  +RG + + +     +   F F D  K + LG   GV            + A G     TS    YP+D  R R+    G+A    ++KG  DC V+I K++G   L +G
Sbjct:    4 AAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLG---GVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Mouse
Match: Slc25a4 (solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4 [Source:MGI Symbol;Acc:MGI:1353495])

HSP 1 Score: 261.922 bits (668), Expect = 1.919e-85
Identity = 154/293 (52.56%), Postives = 195/293 (66.55%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            LSF ++F   G AA +SKTA APIERVKLL+Q Q    KQ   ++ Y G+IDC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     +  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K  S R+FNG+ D   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL+SYP DT+RRRMMM SG+    + Y G++DC  +I K+EG  A  KGA +N+LRG+ GA VL  +D+ K
Sbjct:    6 LSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQ-HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIK 295          
BLAST of slc25a-30 vs. Ensembl Mouse
Match: Slc25a31 (solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 [Source:MGI Symbol;Acc:MGI:1920583])

HSP 1 Score: 250.366 bits (638), Expect = 1.258e-80
Identity = 151/293 (51.54%), Postives = 193/293 (65.87%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SF+++    G AA +SKTA APIERVKLL+Q Q    KQ   +  Y G++DC VR  + +G + +WRGNLAN IRYFPTQALNFAFKDK K LF     K  +    F  N+ASGGAAGA SL  VY LD+ RTRL  D+   K    RQF G+ D   K  KSDG++GLY+GF +S  GI+VYR  YFG YDT+K LL    +   + SF +   VT  SG++SYP DT+RRRMMM SG++  +YKG+IDC ++I ++EG  A  +GA +NILRG  GA VL  +DK K+ 
Sbjct:   19 VSFSKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASS-KQISPEARYKGMLDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKELFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDI--GKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLVSFIIAQIVTTCSGILSYPFDTVRRRMMMQSGESDRQYKGTIDCFLKIYRHEGVPAFFRGAFSNILRGTGGALVLVLYDKIKEF 308          
BLAST of slc25a-30 vs. Ensembl Mouse
Match: Slc25a31 (solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 [Source:MGI Symbol;Acc:MGI:1920583])

HSP 1 Score: 250.366 bits (638), Expect = 1.258e-80
Identity = 151/293 (51.54%), Postives = 193/293 (65.87%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SF+++    G AA +SKTA APIERVKLL+Q Q    KQ   +  Y G++DC VR  + +G + +WRGNLAN IRYFPTQALNFAFKDK K LF     K  +    F  N+ASGGAAGA SL  VY LD+ RTRL  D+   K    RQF G+ D   K  KSDG++GLY+GF +S  GI+VYR  YFG YDT+K LL    +   + SF +   VT  SG++SYP DT+RRRMMM SG++  +YKG+IDC ++I ++EG  A  +GA +NILRG  GA VL  +DK K+ 
Sbjct:   19 VSFSKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASS-KQISPEARYKGMLDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKELFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDI--GKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLVSFIIAQIVTTCSGILSYPFDTVRRRMMMQSGESDRQYKGTIDCFLKIYRHEGVPAFFRGAFSNILRGTGGALVLVLYDKIKEF 308          
BLAST of slc25a-30 vs. Ensembl Mouse
Match: Slc25a25 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25 [Source:MGI Symbol;Acc:MGI:1915913])

HSP 1 Score: 93.2041 bits (230), Expect = 2.043e-20
Identity = 72/274 (26.28%), Postives = 130/274 (47.45%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNG-VIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL------GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTV-----QIMKNEGFMALMKGAGANILR 908
            G A  +S+T  AP++R+K+L+Q            R  N  ++    +  +  G    WRGN  N ++  P  A+ F   +++K L     +D+  +   + + +G  AGA++   +Y ++  +TR+A      K G   Q++GM+D  ++ L  +G+   Y+G++ + +GI+ Y G     Y+TLK   L       +D GV    A G   +    L SYP+  +R RM   +      +G+ + T+     QI++ EG   L +G   N ++
Sbjct:  214 GGAGAVSRTCTAPLDRLKVLMQVHA--------SRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQMKRLVG---SDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMA----LRKTG---QYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETLKNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQAS----IEGAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMK 465          
BLAST of slc25a-30 vs. UniProt/SwissProt
Match: sp|P18238|ADT3_YEAST (ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAC3 PE=1 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.956e-122
Identity = 191/291 (65.64%), Postives = 232/291 (79.73%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            ++ +FA NF + G +A I+KTAA+PIERVK+L+QNQ EMIKQG LD+ Y+G++DC  RT K EGL+ FWRGN AN IRYFPTQALNFAFKDKIK +F  KK +     FA N+ASGGAAGA+SLLFVYSLD+ RTRLA D KSSKKG +RQFNG+ DVYKKTLKSDGI GLYRGF+ S VGIVVYRG YFG +D+LKPL+L GS D   ++SF LG+ VT  +   SYP+DT+RRRMMMTSGQAVKY G+IDC  +I+ +EG  +L KG GANILR VAGAGV++ +D+ +
Sbjct:    8 QETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQ 298          
BLAST of slc25a-30 vs. UniProt/SwissProt
Match: sp|P18239|ADT2_YEAST (ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PET9 PE=1 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 5.899e-120
Identity = 190/288 (65.97%), Postives = 229/288 (79.51%), Query Frame = 3
Query:   96 SFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +F  +F + G +A ++KTAA+PIERVKLL+QNQ EM+KQG LDR Y G++DC  RT   EG++ FWRGN AN IRYFPTQALNFAFKDKIKA+F  KK +  A  FA N+ASGGAAGA+SLLFVYSLDY RTRLA D KSSKKG +RQFNG++DVYKKTLKSDG+ GLYRGF+ S VGIVVYRG YFG YD+LKPLLL GS +   ++SF LG+ VT  +   SYP+DT+RRRMMMTSGQAVKY G+ DC  +I+  EG  +L KG GANILRGVAGAGV++ +D+ +
Sbjct:   22 NFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVISMYDQLQ 309          
BLAST of slc25a-30 vs. UniProt/SwissProt
Match: sp|O49447|ADT3_ARATH (ADP,ATP carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AAC3 PE=1 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.537e-117
Identity = 197/288 (68.40%), Postives = 226/288 (78.47%), Query Frame = 3
Query:   99 FAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKT-DKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL--GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            F  +F + G +A +SKTAAAPIERVKLL+QNQ EMIK G L  PY G+ DC  RT K EG++  WRGN AN IRYFPTQALNFAFKD  K LF+ KK  D     FA N+ASGGAAGA SLLFVYSLDY RTRLAND K++KKG  RQFNGMVDVYKKT+ SDGIVGLYRGF ISCVGIVVYRG YFG YD+LKP++L  G     ++SF LG+G+T+ +GL SYPIDT+RRRMMMTSG+AVKYK S+    QI+KNEG  +L KGAGANILR VAGAGVLAG+DK +
Sbjct:   79 FLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGQRQFNGMVDVYKKTIASDGIVGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVLVDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQ 366          
BLAST of slc25a-30 vs. UniProt/SwissProt
Match: sp|P02723|ADT_NEUCR (ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=aac PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 4.159e-117
Identity = 192/302 (63.58%), Postives = 226/302 (74.83%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKK-TDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSD--AGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            M+E  K +    F  +F + G +A +SKTAAAPIER+KLLVQNQ EMI+ G LDR YNG+IDC  RT   EG++  WRGN AN IRYFPTQALNFAF+DK K +F  KK  D      A N+ASGGAAGA SLLFVYSLDY RTRLAND KS+KKG  RQFNG+VDVY+KT+ SDGI GLYRGF  S  GIVVYRG YFG YD++KP+LL  D     ++SFALG+ VT  +G+ SYP+DTIRRRMMMTSG+AVKYK S D   QI+  EG  +L KGAGANILRGVAGAGVL+ +D+ + L
Sbjct:    1 MAEQQKVLGMPPFVADFLMGGVSAAVSKTAAAPIERIKLLVQNQDEMIRAGRLDRRYNGIIDCFKRTTADEGVMALWRGNTANVIRYFPTQALNFAFRDKFKKMFGYKKDVDGYWKWMAGNLASGGAAGATSLLFVYSLDYARTRLANDAKSAKKGGERQFNGLVDVYRKTIASDGIAGLYRGFGPSVAGIVVYRGLYFGLYDSIKPVLLVGDLKNNFLASFALGWCVTTAAGIASYPLDTIRRRMMMTSGEAVKYKSSFDAASQIVAKEGVKSLFKGAGANILRGVAGAGVLSIYDQLQVL 302          
BLAST of slc25a-30 vs. UniProt/SwissProt
Match: sp|P27080|ADT_CHLRE (ADP,ATP carrier protein OS=Chlamydomonas reinhardtii OX=3055 GN=ABT PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 2.030e-116
Identity = 191/292 (65.41%), Postives = 225/292 (77.05%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSS-RQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKP-LLLGSDA-GVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            ++ +F  +F   G +A +SKTAAAPIERVKLL+QNQ EMIKQG L  PY G+ +C VRT + EG    WRGN AN IRYFPTQALNFAFKDK K +F   K  +    FA N+ASGGAAGA+SL FVYSLDY RTRLAND KS+KKG   RQFNG+VDVY+KT+ SDGI GLYRGF ISCVGIVVYRG YFG YD+LKP +L+G  A   +++F LG+G+T+ +GL SYPIDTIRRRMMMTSG AVKY  S  C  +I+KNEG  +L KGAGANILR VAGAGVLAG+D+ +
Sbjct:    4 EEKNFMVDFLAGGLSAAVSKTAAAPIERVKLLIQNQDEMIKQGRLASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQALNFAFKDKFKRMFGFNKDKEYWKWFAGNMASGGAAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGFNISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRRRMMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQ 295          
BLAST of slc25a-30 vs. TrEMBL
Match: A0A0H3YKC3 (Slc25a-30 OS=Schmidtea mediterranea OX=79327 GN=slc25a-30 PE=2 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 305/305 (100.00%), Postives = 305/305 (100.00%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFRK 977
            MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASGGAAGAMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRGVAGAGVLAGFDKFKDLYVSFRK
Sbjct:    1 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASGGAAGAMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRGVAGAGVLAGFDKFKDLYVSFRK 305          
BLAST of slc25a-30 vs. TrEMBL
Match: A0A0H3YJB1 (Slc25a-1 OS=Schmidtea mediterranea OX=79327 GN=slc25a-1 PE=2 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 4.851e-170
Identity = 250/304 (82.24%), Postives = 271/304 (89.14%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFR 974
            M EGG Y+K+LSFAENFGLSG AAVISKTAAAPIERVKLLVQNQGEM+KQG LDRPYNGVIDCT+ TF+ EGL PFWRGNLANCIRYFPTQALNFAFKD+IK LF   K D   + F KN+ SGGAAGAMSL FVYSLDY RTRLAND KSSK+G  RQFNG++DVYK+TLK+DG+ GLYRGFVISCVGIVVYRGCYFGFYDTLKP+LLG+DAGVM SFALGY VTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDC   ++ NEGF+ALM GAGANILRGVAGAGVLAGFDKFK++YV  R
Sbjct:    1 MGEGGAYMKELSFAENFGLSGVAAVISKTAAAPIERVKLLVQNQGEMLKQGLLDRPYNGVIDCTITTFRNEGLFPFWRGNLANCIRYFPTQALNFAFKDQIKILFKSSKNDSYLVGFGKNIGSGGAAGAMSLFFVYSLDYARTRLANDTKSSKRGGQRQFNGLLDVYKQTLKTDGVGGLYRGFVISCVGIVVYRGCYFGFYDTLKPILLGNDAGVMLSFALGYVVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCARHVLVNEGFLALMHGAGANILRGVAGAGVLAGFDKFKEIYVKLR 304          
BLAST of slc25a-30 vs. TrEMBL
Match: A0A267FYQ0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015634g1 PE=3 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 1.552e-169
Identity = 251/305 (82.30%), Postives = 275/305 (90.16%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGS-SRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFR 974
            M EGG Y+KDLSFAENFGLSG AAVISKTAAAPIERVKLLVQNQ EMIK G LD+PY GVIDCTVRTF+ EGL+PFWRGNLANCIRYFPTQALNFAFKDKIKA F+P KTD   + F KN+ASGGAAGAMSL FVYSLDY RTRLAND KS+KKG+  RQFNG++DVYKKTL SDGIVGLYRGFVISCVGI+VYRG YFG YDTLKP++LG +AGV  SF LGY VT+T+GLISYP+DTIRRRMMMTSGQAVKYKGS+DC VQI+K EGFM++MKGAGANILRGVAGAGVLAGFDKFK++YVSFR
Sbjct:    1 MGEGGAYMKDLSFAENFGLSGAAAVISKTAAAPIERVKLLVQNQAEMIKTGRLDKPYTGVIDCTVRTFRNEGLLPFWRGNLANCIRYFPTQALNFAFKDKIKATFNPSKTDSYMVSFGKNIASGGAAGAMSLCFVYSLDYARTRLANDTKSAKKGAGERQFNGLLDVYKKTLASDGIVGLYRGFVISCVGIMVYRGFYFGLYDTLKPIVLGENAGVALSFVLGYTVTITAGLISYPVDTIRRRMMMTSGQAVKYKGSVDCAVQIVKTEGFMSMMKGAGANILRGVAGAGVLAGFDKFKEIYVSFR 305          
BLAST of slc25a-30 vs. TrEMBL
Match: T1FNQ6 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20210453 PE=3 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 1.249e-165
Identity = 251/305 (82.30%), Postives = 274/305 (89.84%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGS-SRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFR 974
            MSE  K    LSF ENF LSG AA+ISKTAAAPIERVKLLVQNQGEMIK G LDRPYNGVIDCTVRTFKTEG++PFWRGNLANCIRYFPTQALNFAFKDKIKALF   K D   + F+KNVASGG AGAMSL+FVYSLDYCRTRLAND K+SKKG   RQFNGMVDVY+KT+ SDG+VGLYRGFVISCVGI+VYRGCYFGFYDTLKP++LG +AG+M SFALGY VT+TSGLISYPIDTIRRRMMMTSG+AVKYKGSIDC V+++K+EGFM+LMKGAGANILRGVAGAGVLAGFDKFK LYV +R
Sbjct:    1 MSEESKPSPLLSFYENFLLSGAAAIISKTAAAPIERVKLLVQNQGEMIKMGRLDRPYNGVIDCTVRTFKTEGILPFWRGNLANCIRYFPTQALNFAFKDKIKALFVMNKKDPYMVNFSKNVASGGVAGAMSLVFVYSLDYCRTRLANDAKASKKGGGDRQFNGMVDVYRKTIASDGVVGLYRGFVISCVGIIVYRGCYFGFYDTLKPIVLGDNAGLMISFALGYIVTITSGLISYPIDTIRRRMMMTSGEAVKYKGSIDCAVKVVKSEGFMSLMKGAGANILRGVAGAGVLAGFDKFKALYVKWR 305          
BLAST of slc25a-30 vs. TrEMBL
Match: R7U7C2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_163594 PE=3 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 2.791e-164
Identity = 242/296 (81.76%), Postives = 267/296 (90.20%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFR 974
            + L FAENF LSG AAVISKTAAAPIERVKLLVQNQ EMIK G LD+PY+GV+DCT+RT KTEG++PFWRGNLANC+RYFPTQALNFAFKDKIK +F   KTD   + F+KN+ASGGAAGAMSL FVYSLDY RTRLAND K  KKG  RQFNG+VDVYKKTLKSDG VGLYRGFVISCVGIVVYRGCYFGFYDTLKP++LG DAGVM SFALGY VT+TSGLISYPIDTIRRRMMMTSG+AVKYKGSIDC +Q++K EGFM+LMKGAGANILRGVAGAGVLAGFDKFK++Y++FR
Sbjct:    6 RKLGFAENFALSGAAAVISKTAAAPIERVKLLVQNQDEMIKAGRLDKPYSGVVDCTMRTLKTEGVLPFWRGNLANCLRYFPTQALNFAFKDKIKIMFKMHKTDSYGVKFSKNIASGGAAGAMSLCFVYSLDYARTRLANDAKGGKKGGERQFNGLVDVYKKTLKSDGFVGLYRGFVISCVGIVVYRGCYFGFYDTLKPIVLGEDAGVMMSFALGYVVTITSGLISYPIDTIRRRMMMTSGEAVKYKGSIDCGMQVIKGEGFMSLMKGAGANILRGVAGAGVLAGFDKFKEVYIAFR 301          
BLAST of slc25a-30 vs. Ensembl Cavefish
Match: ENSAMXT00000031288.1 (ADP/ATP translocase 2 [Source:NCBI gene;Acc:103047840])

HSP 1 Score: 262.307 bits (669), Expect = 9.743e-86
Identity = 154/292 (52.74%), Postives = 195/292 (66.78%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D  Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F+G+ +   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG  + Y G+IDC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:   13 ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQITADMQYKGIMDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGAEREFSGLGNCLAKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGPDIMYTGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKV 301          
BLAST of slc25a-30 vs. Ensembl Cavefish
Match: slc25a5 (ADP/ATP translocase 2 [Source:NCBI gene;Acc:103035973])

HSP 1 Score: 259.61 bits (662), Expect = 1.050e-84
Identity = 154/295 (52.20%), Postives = 196/295 (66.44%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F G+ +   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G+IDC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:    6 ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQITADKHYKGIMDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGAEREFTGLGNCLGKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQSVTAVAGLASYPFDTVRRRMMMQSGRKGADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKV 297          
BLAST of slc25a-30 vs. Ensembl Cavefish
Match: slc25a5 (ADP/ATP translocase 2 [Source:NCBI gene;Acc:103035973])

HSP 1 Score: 259.61 bits (662), Expect = 1.263e-84
Identity = 154/295 (52.20%), Postives = 196/295 (66.44%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D+ Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F G+ +   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G+IDC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:    5 ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQITADKHYKGIMDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGAEREFTGLGNCLGKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQSVTAVAGLASYPFDTVRRRMMMQSGRKGADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKV 296          
BLAST of slc25a-30 vs. Ensembl Cavefish
Match: ENSAMXT00000041476.1 (ADP/ATP translocase 2 [Source:NCBI gene;Acc:103047840])

HSP 1 Score: 258.455 bits (659), Expect = 3.070e-84
Identity = 154/295 (52.20%), Postives = 196/295 (66.44%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ   D  Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G+ R+F+G+ +   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G+IDC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:    6 ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQITADMQYKGIMDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGAEREFSGLGNCLAKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGADIMYTGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKV 297          
BLAST of slc25a-30 vs. Ensembl Cavefish
Match: slc25a4 (ADP/ATP translocase 1 [Source:NCBI gene;Acc:103040979])

HSP 1 Score: 255.373 bits (651), Expect = 5.916e-83
Identity = 153/293 (52.22%), Postives = 193/293 (65.87%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +SF ++F   G AA ISKTA APIERVKLL+Q Q    KQ   D  Y G+IDC +R  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA D+   K  + R+F G+ +   K  KSDG+ GLY GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +G+ISYP DT+RRRMMM SG+    + YKG+IDC  +I K+EG  A  KGA +N+LRG+ GA VL  +D+ K
Sbjct:    6 VSFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQITADMQYKGIIDCAIRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLGGVDKNKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADI--GKGTAEREFTGLGNCLAKIFKSDGVRGLYLGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGIISYPFDTVRRRMMMQSGRKGADIMYKGTIDCWKRITKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIK 295          
BLAST of slc25a-30 vs. Ensembl Sea Lamprey
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 259.61 bits (662), Expect = 2.699e-85
Identity = 151/293 (51.54%), Postives = 194/293 (66.21%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAG-VMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            + F ++F   G AA ISKTA APIERVKLL+Q Q    KQ  +D+ Y G++DC VR  + +G V FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K  + R+F G+ D   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  SG++SYP DT+RRRMMM SG+    + Y+G+IDC  +I++ EG  A  KGA +N++RG  GA VL  +D+ K
Sbjct:    8 IGFLKDFMAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQIAVDQQYKGIMDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKGQAEREFKGLADCISKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPNPKSTPLVVSWMIAQSVTAVSGIVSYPFDTVRRRMMMQSGRKGADIMYRGTIDCWKKILQQEGGKAFFKGAWSNVIRGAGGAFVLVLYDEIK 297          

HSP 2 Score: 46.595 bits (109), Expect = 4.387e-6
Identity = 47/175 (26.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  402 AMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGV----------MSSFALGYGVTVTSGLISYPIDTIRRRMM--MTSGQAVK-YKGSIDCTVQIMKNEGFMALMKG 887
            A+ F K+  +GG A A+S   V  ++  +  L     S +    +Q+ G++D   +  +  G V  +RG + + +     +   F F D  K + LG   GV            + A G     TS    YP+D  R R+   +  GQA + +KG  DC  +I K++G   L +G
Sbjct:    7 AIGFLKDFMAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIMDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLG---GVDKHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGQAEREFKGLADCISKIFKSDGLRGLYQG 178          
BLAST of slc25a-30 vs. Ensembl Sea Lamprey
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 221.476 bits (563), Expect = 7.120e-71
Identity = 131/257 (50.97%), Postives = 166/257 (64.59%), Query Frame = 3
Query:  207 KQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            KQ  +D+ Y G+IDC VR  + +G V FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRL  DV   K  + R+F G+ D   K  KSDG  GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  SG  SYP DT+RRRMMM SG+    + Y G+IDC  +I + EG  A  KGA +N+LRG+ GA VL  +D+ K++
Sbjct:    9 KQIAVDQQYKGIIDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKRKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLGADV--GKGNAQREFTGLGDCLTKIFKSDGFRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTPIVVSWMIAQTVTAVSGFASYPFDTVRRRMMMQSGRKAADIMYTGTIDCWRKIARQEGTRAFFKGAWSNVLRGMGGAFVLVLYDEIKNV 263          

HSP 2 Score: 46.595 bits (109), Expect = 3.628e-6
Identity = 42/173 (24.28%), Postives = 74/173 (42.77%), Query Frame = 3
Query:   99 FAENFGLSGCAAVISKTAAAPIE--RVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF-DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRG 608
            FA N    G A   S     P++  R +L     G  + +G   R + G+ DC  + FK++G    ++G   +       +A  F   D  K +  DPK T    +V +  +A      A+S    Y  D  R R+   ++S +K +   + G +D ++K  + +G    ++G
Sbjct:   79 FAGNLASGGAAGATSLCFVYPLDFARTRL-----GADVGKGNAQREFTGLGDCLTKIFKSDGFRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNT---PIVVSWMIAQ--TVTAVSGFASYPFDTVRRRMM--MQSGRKAADIMYTGTIDCWRKIARQEGTRAFFKG 239          
BLAST of slc25a-30 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 3.607e-22
Identity = 69/273 (25.27%), Postives = 126/273 (46.15%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYN--GVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL------GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTS---GQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G A V+S+T  AP++R+K+++Q +            +N  GV+       +  G+   WRGN  N I+  P  A+ F   ++IK L   ++     +   + + +G  AGA +   +Y ++  +TRLA        G + Q++ MVD  +K  K +G+   ++G++ + +GI+ Y G     Y+TLK   L      G++ G+          +    L SYP+  +R RM   +   G      G +     I++ +G + L +G   N ++
Sbjct:   32 GGAGVVSRTCTAPLDRLKVIMQVKASR---------HNTIGVVGGLAHMIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIKKLIGMRQEQ---IGVQERLVAGSLAGATAQTVIYPMEVVKTRLA-------LGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQKHGAEGANPGIAVLLCCATTSSTCGQLASYPLALVRTRMQAAASIGGPGASQPGMVGLMRSIVQQDGLLGLYRGIAPNFMK 285          

HSP 2 Score: 58.5362 bits (140), Expect = 6.033e-10
Identity = 48/200 (24.00%), Postives = 85/200 (42.50%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVK--LLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMV-FAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLK 677
            + +   E       A   ++T   P+E VK  L +   G+          Y+ ++DC  +  K EGL  F++G L N +   P   ++ A  + +K  +  K   + A    A  +     +     L  Y L   RTR+         G+S+   GMV + +  ++ DG++GLYRG   + + ++   G  +  Y+ LK
Sbjct:  114 EQIGVQERLVAGSLAGATAQTVIYPMEVVKTRLALGKTGQ----------YSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQKHGAEGANPGIAVLLCCATTSSTCGQLASYPLALVRTRMQAAASIGGPGASQP--GMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENLK 301          
BLAST of slc25a-30 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 93.2041 bits (230), Expect = 3.243e-21
Identity = 74/272 (27.21%), Postives = 126/272 (46.32%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL------GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMM----MTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G A  +S+T  AP++R+K+ +Q  G   K   +      ++    +  K  G+   WRGN  N I+  P  A+ F   ++IK       ++  ++   +   +G  AGA +   +Y ++  +TRL       K G   Q++GM+D  KK    +G++  Y+G+V + +GI+ Y G     Y+TLK   L       +D G++   A G   +    + SYP+  IR RM     M  G  +   G       I+KN+G + L +G   N ++
Sbjct:  218 GAAGAVSRTGTAPLDRMKVFMQVHGS--KSNNIS-----ILTGFKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQIKKFIG---SNNVSLGIHERFMAGSLAGATAQTIIYPMEVMKTRLT----LRKTG---QYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWLTKYAKDTADPGILVLLACGTVSSSCGQVASYPLALIRTRMQAQASMEGGPQLSMVGLFR---NIVKNDGPLGLYRGIAPNFMK 469          

HSP 2 Score: 58.151 bits (139), Expect = 1.073e-9
Identity = 49/205 (23.90%), Postives = 92/205 (44.88%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIE--RVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSA-----MVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLL 686
            L   E F     A   ++T   P+E  + +L ++  G+          Y+G++DC  + F  EG++ F++G + N I   P   ++ A  + +K  +  K    +A     ++ A    S       S    Y L   RTR+    ++S +G  +    MV +++  +K+DG +GLYRG   + + ++      +  Y+ LK +L
Sbjct:  302 LGIHERFMAGSLAGATAQTIIYPMEVMKTRLTLRKTGQ----------YSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWLTKYAKDTADPGILVLLACGTVSSSCGQVAS----YPLALIRTRM--QAQASMEGGPQL--SMVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYENLKRVL 488          
BLAST of slc25a-30 vs. Ensembl Sea Lamprey
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 81.2629 bits (199), Expect = 1.471e-17
Identity = 76/261 (29.12%), Postives = 112/261 (42.91%), Query Frame = 3
Query:   78 KYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKK--TDKSAMVFAKNVA---SXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLK-------PLLLGSDAG-------VMSSFALGYGVT--VTSGLISYPIDTIRRRMMM 797
            ++     +  NF   G A   +KT  AP++RVK+L+Q      K       + GV    V   + EG +  ++GN A  +R FP  A+ F   +K K +   +   T     + A +     S  A G  +++F Y LD  R RLA  VK    G     +    +YK   K  G  G Y G V + +G+  Y G  F  + TLK       P LLG  +        + +   L +G T    +  ISYP+D  RRRM +
Sbjct:   28 QHTNSSRWMRNFLAGGIAGCCAKTTIAPLDRVKILLQAYNPHYK-------HLGVFSTLVAIPRKEGFLGLYKGNGAMMVRIFPYGAIQFTAFEKYKRVLSKQMGITGHVHRLLAGSHGWYLSPCAPGITAVIFTYPLDMVRARLAYQVKGD-HGYRGILHAFSLIYK---KEGGFRGFYHGLVPTIIGMAPYAGFSFFTFSTLKSVGLTRAPALLGRPSADNPDVLVLRTPINLLFGGTAGAIAQTISYPLDVARRRMQL 277          
BLAST of slc25a-30 vs. Ensembl Yeast
Match: AAC3 (Mitochondrial inner membrane ADP/ATP translocator; exchanges cytosolic ADP for mitochondrially synthesized ATP; expressed under anaerobic conditions; similar to Aac1p; has roles in maintenance of viability and in respiration; AAC3 has a paralog, PET9, that arose from the whole genome duplication [Source:SGD;Acc:S000000289])

HSP 1 Score: 358.221 bits (918), Expect = 4.256e-124
Identity = 191/291 (65.64%), Postives = 232/291 (79.73%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            ++ +FA NF + G +A I+KTAA+PIERVK+L+QNQ EMIKQG LD+ Y+G++DC  RT K EGL+ FWRGN AN IRYFPTQALNFAFKDKIK +F  KK +     FA N+ASGGAAGA+SLLFVYSLD+ RTRLA D KSSKKG +RQFNG+ DVYKKTLKSDGI GLYRGF+ S VGIVVYRG YFG +D+LKPL+L GS D   ++SF LG+ VT  +   SYP+DT+RRRMMMTSGQAVKY G+IDC  +I+ +EG  +L KG GANILR VAGAGV++ +D+ +
Sbjct:    8 QETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQ 298          
BLAST of slc25a-30 vs. Ensembl Yeast
Match: PET9 (Major ADP/ATP carrier of the mitochondrial inner membrane; exchanges cytosolic ADP for mitochondrially synthesized ATP; also imports heme and ATP; required for viability in many lab strains that carry a sal1 mutation; PET9 has a paralog, AAC3, that arose from the whole genome duplication; human homolog SLC25A4 implicated in progressive external ophthalmoplegia can complement yeast null mutant [Source:SGD;Acc:S000000126])

HSP 1 Score: 352.829 bits (904), Expect = 8.495e-122
Identity = 190/288 (65.97%), Postives = 229/288 (79.51%), Query Frame = 3
Query:   96 SFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GS-DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            +F  +F + G +A ++KTAA+PIERVKLL+QNQ EM+KQG LDR Y G++DC  RT   EG++ FWRGN AN IRYFPTQALNFAFKDKIKA+F  KK +  A  FA N+ASGGAAGA+SLLFVYSLDY RTRLA D KSSKKG +RQFNG++DVYKKTLKSDG+ GLYRGF+ S VGIVVYRG YFG YD+LKPLLL GS +   ++SF LG+ VT  +   SYP+DT+RRRMMMTSGQAVKY G+ DC  +I+  EG  +L KG GANILRGVAGAGV++ +D+ +
Sbjct:   22 NFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVISMYDQLQ 309          
BLAST of slc25a-30 vs. Ensembl Yeast
Match: AAC1 (Mitochondrial inner membrane ADP/ATP translocator; exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; Aac1p is a minor isoform while Pet9p is the major ADP/ATP translocator; relocalizes from mitochondrion to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000004660])

HSP 1 Score: 329.717 bits (844), Expect = 5.931e-113
Identity = 174/300 (58.00%), Postives = 221/300 (73.67%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFD-PKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS--DAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFK 953
            MS      +   F  +F + G +A I+KT AAPIERVKLL+QNQ EM+KQG LD  Y G++DC  RT   EG+V FWRGN AN +RYFPTQALNFAFKDKIK+L    ++ D  A  FA N+ SGGAAG +SLLFVYSLDY RTRLA D + SK  S RQFNG++DVYKKTLK+DG++GLYRGFV S +GI+VYRG YFG YD+ KP+LL    +   ++SF LG+ +T+ +   SYP+DT+RRRMMMTSGQ +KY G++DC  +I++ EG  +L KG GANI RGVA AGV++ +D+ +
Sbjct:    1 MSHTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGASTASYPLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQ 300          
BLAST of slc25a-30 vs. Ensembl Yeast
Match: YPR011C_mRNA (Mitochondrial transporter; major substrates are adenosine 5'-phosphosulfate (APS) and 3'-phospho-adenosine 5'-phosphosulfate (PAPS); member of the mitochondrial carrier family; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000006215])

HSP 1 Score: 92.4337 bits (228), Expect = 1.017e-21
Identity = 80/282 (28.37%), Postives = 128/282 (45.39%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYN-GVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKI-KALFDPKKTD-KSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLA------NDVKSSKKGSSRQFNGMVDVYKKTLKSD-GIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTV------TSGLISYPIDTIRRRMMMTS--GQAV--KYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G A  +S+T  +P ERVK+L+Q Q            YN G+     + +  EG    +RGN  NCIR FP  A+ F   +   K LF     + +  +   + + SG   G  S++  Y LD  +TRL+      + +  SK  S  +  G+  +  +T + + G+ GLYRG   + +G+V Y    F  Y+ L+   + S     S  +  Y +T+       +  I+YP D +RRR  + +  G  +  +Y    D  V I + EG     KG  AN+ +
Sbjct:   30 GVAGAVSRTVVSPFERVKILLQVQSSTTS-------YNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304          
BLAST of slc25a-30 vs. Ensembl Yeast
Match: OAC1 (Mitochondrial inner membrane transporter; transports oxaloacetate, sulfate, thiosulfate, and isopropylmalate; member of the mitochondrial carrier family [Source:SGD;Acc:S000001603])

HSP 1 Score: 79.7221 bits (195), Expect = 3.349e-17
Identity = 78/275 (28.36%), Postives = 117/275 (42.55%), Query Frame = 3
Query:  108 NFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKA----LFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGL----ISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            +F   G AA I+ T   PIE +K+ +Q QGEM       + Y   I      FK EG+    +G  A  I           F + I++    LF P +          NV SG A+G +  +    L   +TRL +  +  K G    + G+ +      K++G+ GL+RG   + +            Y+T K +L+ +D  +    AL    +  SGL    +  P D I  R+    G    YKG IDC V+ ++ EG  AL KG  A + R
Sbjct:   25 SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDL-MKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294          
BLAST of slc25a-30 vs. Ensembl Nematostella
Match: EDO47068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN38])

HSP 1 Score: 470.7 bits (1210), Expect = 4.134e-168
Identity = 239/296 (80.74%), Postives = 266/296 (89.86%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFR 974
            K L F ENFGLSG AA+ISKTAAAPIERVKLLVQNQ EM+K G LD PY GVIDCT RT+++EG + FWRGNLANCIRYFPTQALNFAFKD++KALF PKKTD +A+ F+KN+ASGGAAGAMSL FVYSLDYCRTRLAND K  KKG  RQFNGM+DVYKKT+ SDG+VGLYRGFVISCVGI+VYRG YFG YDTLKP+LLG DAGV+ SF LGYGVTV++GL SYPIDTIRRRMMMTSG+AVKYKGSIDCT+QI+K EG M+LMKGAGANILRG+AGAGVLAGFDKFK+LYV+FR
Sbjct:    5 KKLHFVENFGLSGAAAIISKTAAAPIERVKLLVQNQDEMLKAGRLDHPYKGVIDCTSRTYRSEGFLSFWRGNLANCIRYFPTQALNFAFKDQVKALFKPKKTDSNAIKFSKNIASGGAAGAMSLFFVYSLDYCRTRLANDAKVGKKGGERQFNGMIDVYKKTIASDGLVGLYRGFVISCVGIIVYRGFYFGLYDTLKPILLGEDAGVVISFVLGYGVTVSAGLASYPIDTIRRRMMMTSGEAVKYKGSIDCTIQILKKEGAMSLMKGAGANILRGMAGAGVLAGFDKFKELYVNFR 300          
BLAST of slc25a-30 vs. Ensembl Nematostella
Match: EDO35336 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ2])

HSP 1 Score: 449.899 bits (1156), Expect = 6.052e-160
Identity = 233/297 (78.45%), Postives = 259/297 (87.21%), Query Frame = 3
Query:   87 KDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGS-SRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFR 974
            ++L F ENF LSG AA+ISKTAAAPIERVKLLVQNQ EM+K G L  PY GV+DCT+RT++ EG+  FWRGNLANCIRYFPTQALNFAFKD+IKALF  K+TD +AM F KN+ASGGAAGAMSL FVYSLDY RTRLAND KSS KG   RQFNG+VDVY+KTL SDGIVGLYRGFVISCVGIVVYRG YFG YDTLKP+LLG  A V +SFALGY VTV+SGL SYPIDTIRRRMMMTSG+AVKYKGSIDC VQIMK EG M++MKGAGAN+LRG+AGAGVLAGFDKFK+ Y++FR
Sbjct:    6 QNLHFVENFALSGAAAIISKTAAAPIERVKLLVQNQDEMLKAGRLSSPYKGVVDCTMRTYRAEGIGSFWRGNLANCIRYFPTQALNFAFKDQIKALFKSKQTDSNAMKFTKNIASGGAAGAMSLSFVYSLDYARTRLANDAKSSGKGGGERQFNGLVDVYRKTLASDGIVGLYRGFVISCVGIVVYRGFYFGLYDTLKPILLGDQANVFASFALGYAVTVSSGLASYPIDTIRRRMMMTSGEAVKYKGSIDCAVQIMKKEGAMSMMKGAGANVLRGMAGAGVLAGFDKFKEFYINFR 302          
BLAST of slc25a-30 vs. Ensembl Nematostella
Match: EDO30286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T182])

HSP 1 Score: 354.755 bits (909), Expect = 1.454e-123
Identity = 185/224 (82.59%), Postives = 206/224 (91.96%), Query Frame = 3
Query:  297 GNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVS 968
            GNLANCIRYFPTQALNFAFKD++KALF PKKTD +A+ F+KN+ASGGAAGAMSL FVYSLDYCRTRLAND K  KKG  RQFNGM+DVYKKT+ SDG+VGLYRGFVISCVGI+VYRG YFG YDTLKP+LLG DAGV+ SF LGYGVTV++GL SYPIDTIRRRMMMTSG+AVKYKGSIDCT+QI+K EG M+LMKGAGANILRG+AGAGVLAGFDKFK+LYV+
Sbjct:    4 GNLANCIRYFPTQALNFAFKDQVKALFKPKKTDSNAIKFSKNIASGGAAGAMSLFFVYSLDYCRTRLANDAKVGKKGGERQFNGMIDVYKKTIASDGLVGLYRGFVISCVGIIVYRGFYFGLYDTLKPILLGEDAGVVISFVLGYGVTVSAGLASYPIDTIRRRMMMTSGEAVKYKGSIDCTIQILKKEGAMSLMKGAGANILRGMAGAGVLAGFDKFKELYVN 227          

HSP 2 Score: 50.0618 bits (118), Expect = 3.912e-7
Identity = 42/172 (24.42%), Postives = 77/172 (44.77%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRG 608
            + F++N    G A  +S      ++  +  + N  ++ K+GG +R +NG+ID   +T  ++GLV  +RG + +C+     +   F   D +K    P    + A V    V   G   +  L   Y +D  R R+         G + ++ G +D   + LK +G + L +G
Sbjct:   40 IKFSKNIASGGAAGAMSLFFVYSLDYCRTRLANDAKVGKKGG-ERQFNGMIDVYKKTIASDGLVGLYRGFVISCVGIIVYRGFYFGLYDTLK----PILLGEDAGVVISFVLGYGVTVSAGLA-SYPIDTIRRRMM-----MTSGEAVKYKGSIDCTIQILKKEGAMSLMKG 200          
BLAST of slc25a-30 vs. Ensembl Nematostella
Match: EDO34426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF1])

HSP 1 Score: 124.405 bits (311), Expect = 1.158e-32
Identity = 93/284 (32.75%), Postives = 141/284 (49.65%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFD-PKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDG--IVG-LYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGS---------------DAGVMSSFAL--GYGVTVTSGLISYPIDTIRRRMMMTSGQA-VKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G A  +S+T+ +P+ERVK+L+Q Q +  K       + GV+   ++  K EG++ +++GN  N IR FP  A+ FA  ++ K L + P   +    +  K + +G  AG  S+   Y LD  RTRL      S +G+ R++ G+V  ++  L  +G    G LYRG V + +GI  Y G  F  Y+TLK  L  +               D  +  +F L  G      S   +YP+D +RRRM M   +A   YK ++     I+K EGF  L KG   NIL+
Sbjct:   42 GIAGAVSRTSVSPLERVKILLQIQVKNPK-------FKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYKKLLNIPDDPEHQTPI--KRLVAGAMAGVTSITATYPLDLIRTRL------SAQGADRKYRGIVHAFRTILNEEGGFFSGCLYRGLVPTAMGIAPYVGLNFAVYETLKGFLFSTVMASSQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMKGIRADFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILK 310          
BLAST of slc25a-30 vs. Ensembl Nematostella
Match: EDO35337 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ3])

HSP 1 Score: 102.834 bits (255), Expect = 8.672e-25
Identity = 80/283 (28.27%), Postives = 141/283 (49.82%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNF-AFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFY---DTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTS-------GQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            +++ ++F   G +AV++++  +P+E VK+L Q  G    + GL R +  V       +K EG+  FW+GN  +CIR FP  A+ + AF   + +L DP   + S    + ++ +G ++  ++++ VY  +  +TRL   V+   K S+  + GM    K  L+ +GI+ LY+G   S +G+  + G  F  Y   D +        A  +  F  G      +  +S+P DTIR++M   S       G  V++     C VQ ++  GF  L +G  A++L+
Sbjct:   10 ITWFQSFLCGGTSAVLARSLTSPLEVVKVLAQ-VGTQEAKPGLIRTFASV-------YKREGIKAFWKGNGVSCIRLFPYSAVQYAAFNRIVASLEDPHNGELSD---SGSMLAGTSSTLIAMVTVYPCEVIKTRLT--VQHVNK-SNAHYKGMRHALKTILREEGILALYKGVTPSFLGLFPFAGGSFLAYQILDKVDSTRTEPSATPICMFVNGCVAGAFAHTLSHPFDTIRKKMQAKSTFLPKGGGVDVEFVSMSSCFVQTVRVNGFTGLWRGLVAHLLK 278          
BLAST of slc25a-30 vs. Ensembl Medaka
Match: ENSORLT00000040922.1 (ADP/ATP translocase 3 [Source:NCBI gene;Acc:101163991])

HSP 1 Score: 263.462 bits (672), Expect = 3.697e-86
Identity = 155/295 (52.54%), Postives = 196/295 (66.44%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G +A ISKTA APIERVKLL+Q Q    KQ   D+ Y G+IDC VR  K +G + FWRGN+AN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G  R+F G+ D  KK  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G+IDC  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:    6 ISFAKDFLAGGISAAISKTAVAPIERVKLLLQVQ-HASKQITADKQYKGIIDCVVRIPKEQGALSFWRGNMANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGQEREFRGLADCLKKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKV 297          

HSP 2 Score: 50.447 bits (119), Expect = 1.170e-6
Identity = 44/174 (25.29%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  396 KSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GSDAGVM------SSFALGYGVTVTSGLISYPIDTIRRRMMM---TSGQAVKYKGSIDCTVQIMKNEGFMALMKG 887
            + A+ FAK+  +GG + A+S   V  ++  +  L     S +  + +Q+ G++D   +  K  G +  +RG + + +     +   F F D  K + L G D           + A G     TS    YP+D  R R+      +GQ  +++G  DC  +I K++G   L +G
Sbjct:    3 EQAISFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGALSFWRGNMANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGQEREFRGLADCLKKIFKSDGLKGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Medaka
Match: SLC25A6 (ADP/ATP translocase 2 [Source:NCBI gene;Acc:101171421])

HSP 1 Score: 261.151 bits (666), Expect = 2.466e-85
Identity = 154/295 (52.20%), Postives = 196/295 (66.44%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDL 959
            +SFA++F   G AA ISKTA APIERVKLL+Q Q    KQ  +D+ Y G++DC VR  K +G + FWRGNLAN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G  R+F G+ D   K  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  +  S+ +   VT  +GL+SYP DT+RRRMMM SG+    + Y G+I+C  +I ++EG  A  KGA +N+LRG+ GA VL  +D+ K +
Sbjct:    6 ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQ-HASKQISVDKQYKGIVDCVVRIPKEQGFISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKTGQGREFKGLGDCLAKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTINCWRKIARDEGPKAFFKGALSNVLRGMGGAFVLVLYDELKKV 297          

HSP 2 Score: 52.7582 bits (125), Expect = 1.879e-7
Identity = 47/174 (27.01%), Postives = 77/174 (44.25%), Query Frame = 3
Query:  396 KSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GSDAGVM------SSFALGYGVTVTSGLISYPIDTIRRRMMM---TSGQAVKYKGSIDCTVQIMKNEGFMALMKG 887
            + A+ FAK+  +GG A A+S   V  ++  +  L     S +    +Q+ G+VD   +  K  G +  +RG + + +     +   F F D  K + L G D           + A G     TS    YP+D  R R+      +GQ  ++KG  DC  +I K++G   L +G
Sbjct:    3 EQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQISVDKQYKGIVDCVVRIPKEQGFISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKTGQGREFKGLGDCLAKIFKSDGLKGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Medaka
Match: ENSORLT00000008528.2 (ADP/ATP translocase 3 [Source:NCBI gene;Acc:101163991])

HSP 1 Score: 247.669 bits (631), Expect = 5.650e-80
Identity = 139/263 (52.85%), Postives = 173/263 (65.78%), Query Frame = 3
Query:   93 LSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALF--DPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLG-SDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA---VKYKGSIDCTVQIMKNE 863
            +SFA++F   G +A ISKTA APIERVKLL+Q Q    KQ   D+ Y G+IDC VR  K +G + FWRGN+AN IRYFPTQALNFAFKDK K +F     K  +    FA N+ASGGAAGA SL FVY LD+ RTRLA DV   K G  R+F G+ D  KK  KSDG+ GLY+GF +S  GI++YR  YFG YDT K +L    +  ++ S+ +   VT  +GL SYP DT+RRRMMM SG+    + Y G+IDC  Q +  +
Sbjct:    6 ISFAKDFLAGGISAAISKTAVAPIERVKLLLQVQ-HASKQITADKQYKGIIDCVVRIPKEQGALSFWRGNMANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADV--GKAGQEREFRGLADCLKKIFKSDGLKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGADIMYSGTIDCWSQFLSQQ 265          

HSP 2 Score: 50.447 bits (119), Expect = 1.084e-6
Identity = 44/174 (25.29%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  396 KSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-GSDAGVM------SSFALGYGVTVTSGLISYPIDTIRRRMMM---TSGQAVKYKGSIDCTVQIMKNEGFMALMKG 887
            + A+ FAK+  +GG + A+S   V  ++  +  L     S +  + +Q+ G++D   +  K  G +  +RG + + +     +   F F D  K + L G D           + A G     TS    YP+D  R R+      +GQ  +++G  DC  +I K++G   L +G
Sbjct:    3 EQAISFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGALSFWRGNMANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGQEREFRGLADCLKKIFKSDGLKGLYQG 176          
BLAST of slc25a-30 vs. Ensembl Medaka
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:101168097])

HSP 1 Score: 97.0561 bits (240), Expect = 1.825e-22
Identity = 75/254 (29.53%), Postives = 117/254 (46.06%), Query Frame = 3
Query:   90 DLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKK--TDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL-------------GSDAGVMSSFA--LGYGVT-VTSGLISYPIDTIRRRMMM 797
            D  +  +F   G A   +KT  AP++RVK+L+Q Q    K       + GV    +   K EG++  ++GN A  +R FP  A+ F   DK K L + +   T     + A ++A        +++F Y LD  R RLA  V    +     ++G+V+V++   + +G+ G YRG   + +G+  Y G  F  + TLK L L               D  V+ S    L  GV    +  +SYP+D  RRRM +
Sbjct:   10 DYHWLRSFVAGGVAGCCAKTTIAPLDRVKILLQGQSPHYK-------HLGVFSTLLNVPKKEGILGLYKGNGAMMVRIFPYGAIQFMAFDKYKKLLNTRVGITGHVHRLMAGSMAGLT-----AVMFTYPLDVVRARLAFQVTGHHR-----YSGIVNVFQSVYRMEGVSGFYRGLTPTLIGMAPYAGLSFFTFGTLKSLGLKHFPEKLGRPSSDNPDVLVLKSHINLLCGGVAGAFAQTVSYPLDVTRRRMQL 246          
BLAST of slc25a-30 vs. Ensembl Medaka
Match: ENSORLT00000022227.2 (calcium-binding mitochondrial carrier protein SCaMC-2-A [Source:NCBI gene;Acc:101160000])

HSP 1 Score: 96.6709 bits (239), Expect = 1.098e-21
Identity = 81/273 (29.67%), Postives = 126/273 (46.15%), Query Frame = 3
Query:  123 GCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNG-VIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLL------GSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAV----KYKGSIDCTVQIMKNEGFMALMKGAGANILR 908
            G A  +S+T  AP++R+K+++Q  G         R  N  ++   ++  K  G    WRGN  N I+  P  AL F   ++IK L      DK  +   +   +G  AG M+   +Y ++  +TRLA          S Q++G+ D  K+ L  +G+   Y+G++ + +GI+ Y G     Y+TLK   L       +D GV+   A G   +    L SYP+  +R RM     QAV    K         QI++NEG   L +G   N L+
Sbjct:  195 GGAGAVSRTCTAPLDRLKVMMQVYG--------SRTNNMCIMSGLMQMIKEGGTRSLWRGNGVNIIKIAPESALKFMAYEQIKRLIG---NDKETVSILERFVAGSLAGVMAQSAIYPMEVLKTRLA-------LRKSGQYSGISDCAKQILGREGLGAFYKGYIPNMLGIIPYAGIDLAVYETLKNTYLQRNGAHSADPGVLVLLACGTVSSTCGQLASYPLALVRTRM---QAQAVTDSHKQLTMTGLFRQILQNEGPAGLYRGLAPNFLK 446          
BLAST of slc25a-30 vs. Planmine SMEST
Match: SMESG000044697.1 (SMESG000044697.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 305/305 (100.00%), Postives = 305/305 (100.00%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFRK 977
            MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASGGAAGAMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRGVAGAGVLAGFDKFKDLYVSFRK
Sbjct:    1 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASGGAAGAMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRGVAGAGVLAGFDKFKDLYVSFRK 305          
BLAST of slc25a-30 vs. Planmine SMEST
Match: SMESG000022161.1 (SMESG000022161.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 305/305 (100.00%), Postives = 305/305 (100.00%), Query Frame = 3
Query:   63 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRXXXXXXXXXXFDKFKDLYVSFRK 977
            MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASGGAAGAMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRGVAGAGVLAGFDKFKDLYVSFRK
Sbjct:    1 MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASGGAAGAMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANILRGVAGAGVLAGFDKFKDLYVSFRK 305          
BLAST of slc25a-30 vs. Planmine SMEST
Match: SMESG000074820.1 (SMESG000074820.1)

HSP 1 Score: 93.5893 bits (231), Expect = 9.829e-21
Identity = 76/277 (27.44%), Postives = 132/277 (47.65%), Query Frame = 3
Query:  114 GLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNF-AFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLIS--------YPIDTIRRRMMMTSGQAVKYKGSI---DCTVQIMKNEGFMALMKGAGANILR 908
            G++GC   +S+TA AP++R+K+ +Q  G            +G+I+         G+   WRGN  NCI+  P  A+ F A++   K + +  + +   +   +   +G  AGA +   +Y ++  +TR+           S Q++ + D  KK   ++GI   +RG+V + +GI+ Y G     Y+T K L L S     S+    Y V++ SG +S        YP+  +R ++   S    K  G I   + +  I+KNEG +   +G G N+L+
Sbjct:  192 GIAGC---VSRTATAPLDRLKVTMQAHGAKAAN-------HGIINAIKYMVNEGGVSSLWRGNGVNCIKIAPESAIKFLAYESYKKLIVNFTQNETGNVTLGEKFVAGAMAGATAQTLIYPMEVLKTRMC-------LRKSGQYSSIFDCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKNLYLKSINHDKSASTPIY-VSLCSGAVSSVCGQVATYPLALVRTKLQAMS----KSDGKISMKNVSRDIIKNEGVLGFYRGIGPNMLK 446          
BLAST of slc25a-30 vs. Planmine SMEST
Match: SMESG000069729.1 (SMESG000069729.1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.102e-18
Identity = 74/286 (25.87%), Postives = 115/286 (40.21%), Query Frame = 3
Query:   90 DLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVA-------SXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISY----PIDTIRRRMMM---TSGQAVKYKGSIDCTVQIMKNEGFMALMKGAGANIL 905
            + SF       G A ++  T   PI+ VK  +QNQ   +K       YNG+ DC  +TFK+EG    +RG+  N     P +A+     D  +    P  T K      + +A              M LL +   D  RTR+     ++K  +SR       +    LK  GI GLY+G   + +  V +   YF  +     L    + G  + F   +G    +G I+     P D ++ R+       G+  ++ G  DC  +    EG+ A  KGA   I+
Sbjct:    8 NFSFLPKILNGGIAGIVGVTCVYPIDLVKTRLQNQQSGVKL------YNGMFDCAKKTFKSEGFFKMYRGSAVNLFLITPEKAIKLVGNDFFRYHLKP--TGKPLNPLREMIAGGGAGACQIIVTTPMELLKIQLQDEGRTRIKGQTGATKASASR-------IALNLLKEKGIFGLYKGMGATFLRDVTFSAIYFPLFANFNKLGPQRENGKGTVFYWSFGSGCLAGCIASLSVNPFDVVKTRLQTLKKIEGEQ-EFTGIFDCFKKTFTTEGWKAFFKGASCRIM 277          
BLAST of slc25a-30 vs. Planmine SMEST
Match: SMESG000016412.1 (SMESG000016412.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.500e-15
Identity = 69/271 (25.46%), Postives = 110/271 (40.59%), Query Frame = 3
Query:  111 FGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQGGLDR----PYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDKIKALFDPKKTDKSAMVFAKNVASXXXXXXMSLLFVYSLDYCRTRLANDVKSSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGFYDTLKPLLLGSDA---GVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSG-----QAVKYKGSIDCTVQIMKNEGFMALMKG 887
            F   G A++I++    PI+  K  +Q QGE++K   +       YNG+I       K EG+   +RG  A  IR      +     DK+K +       +S    + N+A    AG  S       D  + RL +      K +  Q +  +  + +T+  +G  GLY+  + +     +  G     YD  K  L+        V   FA           +S P++ IR R+M  S         KYK ++DC  + ++NE   AL KG
Sbjct:    7 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGES---ISNNIACAVVAGVTSSTIANPTDVIKIRLQS------KSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKG 268          
The following BLAST results are available for this feature:
BLAST of slc25a-30 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A69.049e-8652.20solute carrier family 25 member 6 [Source:HGNC Sym... [more]
SLC25A51.851e-8553.24solute carrier family 25 member 5 [Source:HGNC Sym... [more]
SLC25A48.412e-8452.05solute carrier family 25 member 4 [Source:HGNC Sym... [more]
SLC25A311.603e-8051.88solute carrier family 25 member 31 [Source:HGNC Sy... [more]
SLC25A41.404e-6056.63solute carrier family 25 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ant-1.33.465e-8050.87Adenine Nucleotide Translocator; Mitochondrial ade... [more]
ant-1.48.690e-8050.52Adenine Nucleotide Translocator; Mitochondrial ade... [more]
ant-1.15.505e-7951.85Adenine Nucleotide Translocator [Source:UniProtKB... [more]
ant-1.15.505e-7951.85Adenine Nucleotide Translocator [Source:UniProtKB... [more]
ant-1.15.505e-7951.85Adenine Nucleotide Translocator [Source:UniProtKB... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sesB8.317e-8450.99gene:FBgn0003360 transcript:FBtr0073424[more]
sesB8.317e-8450.99gene:FBgn0003360 transcript:FBtr0073422[more]
sesB1.462e-8351.16gene:FBgn0003360 transcript:FBtr0346384[more]
sesB1.462e-8351.16gene:FBgn0003360 transcript:FBtr0073423[more]
sesB1.462e-8351.16gene:FBgn0003360 transcript:FBtr0073421[more]
back to top
BLAST of slc25a-30 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a61.278e-8753.24solute carrier family 25 member 6 [Source:ZFIN;Acc... [more]
slc25a61.973e-8753.24solute carrier family 25 member 6 [Source:ZFIN;Acc... [more]
slc25a51.441e-8452.54solute carrier family 25 member 5 [Source:ZFIN;Acc... [more]
slc25a41.042e-8252.22solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
slc25a41.042e-8252.22solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epha105.218e-8452.22EPH receptor A10 [Source:Xenbase;Acc:XB-GENE-58935... [more]
eprs13.206e-8251.88glutamyl-prolyl-tRNA synthetase 1 [Source:Xenbase;... [more]
slc25a169.552e-2431.64solute carrier family 25 member 16 [Source:NCBI ge... [more]
slc25a246.308e-2327.44solute carrier family 25 (mitochondrial carrier; p... [more]
slc25a248.069e-2327.44solute carrier family 25 (mitochondrial carrier; p... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a51.878e-8553.24solute carrier family 25 (mitochondrial carrier, a... [more]
Slc25a41.919e-8552.56solute carrier family 25 (mitochondrial carrier, a... [more]
Slc25a311.258e-8051.54solute carrier family 25 (mitochondrial carrier; a... [more]
Slc25a311.258e-8051.54solute carrier family 25 (mitochondrial carrier; a... [more]
Slc25a252.043e-2026.28solute carrier family 25 (mitochondrial carrier, p... [more]
back to top
BLAST of slc25a-30 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18238|ADT3_YEAST2.956e-12265.64ADP,ATP carrier protein 3 OS=Saccharomyces cerevis... [more]
sp|P18239|ADT2_YEAST5.899e-12065.97ADP,ATP carrier protein 2 OS=Saccharomyces cerevis... [more]
sp|O49447|ADT3_ARATH1.537e-11768.40ADP,ATP carrier protein 3, mitochondrial OS=Arabid... [more]
sp|P02723|ADT_NEUCR4.159e-11763.58ADP,ATP carrier protein OS=Neurospora crassa (stra... [more]
sp|P27080|ADT_CHLRE2.030e-11665.41ADP,ATP carrier protein OS=Chlamydomonas reinhardt... [more]
back to top
BLAST of slc25a-30 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKC30.000e+0100.00Slc25a-30 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0H3YJB14.851e-17082.24Slc25a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267FYQ01.552e-16982.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
T1FNQ61.249e-16582.30Uncharacterized protein OS=Helobdella robusta OX=6... [more]
R7U7C22.791e-16481.76Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031288.19.743e-8652.74ADP/ATP translocase 2 [Source:NCBI gene;Acc:103047... [more]
slc25a51.050e-8452.20ADP/ATP translocase 2 [Source:NCBI gene;Acc:103035... [more]
slc25a51.263e-8452.20ADP/ATP translocase 2 [Source:NCBI gene;Acc:103035... [more]
ENSAMXT00000041476.13.070e-8452.20ADP/ATP translocase 2 [Source:NCBI gene;Acc:103047... [more]
slc25a45.916e-8352.22ADP/ATP translocase 1 [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a42.699e-8551.54solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
slc25a47.120e-7150.97solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
ENSPMAT00000004577.13.607e-2225.27pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
slc25a23a3.243e-2127.21solute carrier family 25 member 23a [Source:ZFIN;A... [more]
slc25a161.471e-1729.12solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AAC34.256e-12465.64Mitochondrial inner membrane ADP/ATP translocator;... [more]
PET98.495e-12265.97Major ADP/ATP carrier of the mitochondrial inner m... [more]
AAC15.931e-11358.00Mitochondrial inner membrane ADP/ATP translocator;... [more]
YPR011C_mRNA1.017e-2128.37Mitochondrial transporter; major substrates are ad... [more]
OAC13.349e-1728.36Mitochondrial inner membrane transporter; transpor... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470684.134e-16880.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353366.052e-16078.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302861.454e-12382.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344261.158e-3232.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353378.672e-2528.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-30 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040922.13.697e-8652.54ADP/ATP translocase 3 [Source:NCBI gene;Acc:101163... [more]
SLC25A62.466e-8552.20ADP/ATP translocase 2 [Source:NCBI gene;Acc:101171... [more]
ENSORLT00000008528.25.650e-8052.85ADP/ATP translocase 3 [Source:NCBI gene;Acc:101163... [more]
slc25a161.825e-2229.53solute carrier family 25 member 16 [Source:NCBI ge... [more]
ENSORLT00000022227.21.098e-2129.67calcium-binding mitochondrial carrier protein SCaM... [more]
back to top
BLAST of slc25a-30 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044697.10.000e+0100.00SMESG000044697.1[more]
SMESG000022161.10.000e+0100.00SMESG000022161.1[more]
SMESG000074820.19.829e-2127.44SMESG000074820.1[more]
SMESG000069729.11.102e-1825.87SMESG000069729.1[more]
SMESG000016412.12.500e-1525.46SMESG000016412.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029899
GenBankAKN21598.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029899 ID=SMED30029899|Name=slc25a-30|organism=Schmidtea mediterranea sexual|type=transcript|length=1097bp
AGTGTTAACTTTCCTTTCGTTAATTTTAGTTTCACTTTTGTTGTACTACC
TGACATATTAAAATGAGTGAAGGTGGAAAGTATATAAAAGACTTGTCATT
TGCTGAGAATTTTGGACTCAGTGGATGTGCCGCAGTTATTTCTAAAACAG
CAGCTGCTCCAATCGAGCGAGTGAAACTATTAGTGCAAAATCAAGGAGAA
ATGATCAAGCAGGGAGGACTTGATAGACCATACAATGGTGTCATTGATTG
CACAGTAAGGACATTTAAAACTGAAGGATTGGTACCATTTTGGAGAGGCA
ATTTAGCCAATTGCATCAGATACTTTCCAACTCAAGCTTTAAACTTTGCT
TTTAAAGATAAAATCAAAGCATTATTTGATCCAAAAAAAACTGACAAGTC
TGCGATGGTATTTGCTAAAAATGTTGCTAGTGGAGGAGCTGCTGGTGCAA
TGTCATTATTATTTGTTTACTCACTGGATTATTGCAGAACAAGATTAGCC
AATGATGTCAAATCAAGTAAAAAAGGATCGTCGAGACAGTTCAATGGAAT
GGTTGATGTTTACAAAAAAACATTAAAATCCGATGGAATCGTGGGATTAT
ATCGTGGATTTGTGATTTCTTGTGTCGGTATAGTTGTATATAGAGGATGC
TACTTTGGTTTTTACGATACTCTGAAACCATTGCTACTTGGCAGTGATGC
GGGTGTAATGTCAAGTTTTGCGCTAGGATATGGTGTAACAGTTACATCAG
GGCTTATATCATATCCCATTGATACCATTCGACGAAGAATGATGATGACA
TCTGGACAAGCAGTCAAATATAAAGGATCTATTGATTGTACTGTGCAAAT
TATGAAAAACGAAGGATTTATGGCCTTAATGAAAGGAGCTGGAGCAAATA
TTTTGCGTGGTGTAGCAGGAGCTGGTGTCCTGGCTGGTTTTGATAAATTC
AAAGATTTGTATGTATCTTTCAGGAAATAGACGTACCAATCTAGGAATAT
ATTTAGATAGTTTACAATAAATTTTGGATTTTTTATTGCGATATAGCTTT
GTTCTTATTTTAGTTATTAAAATTATTTTTTACTTCTTAAAAAAAAA
back to top

protein sequence of SMED30029899-orf-1

>SMED30029899-orf-1 ID=SMED30029899-orf-1|Name=SMED30029899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=306bp
MSEGGKYIKDLSFAENFGLSGCAAVISKTAAAPIERVKLLVQNQGEMIKQ
GGLDRPYNGVIDCTVRTFKTEGLVPFWRGNLANCIRYFPTQALNFAFKDK
IKALFDPKKTDKSAMVFAKNVASGGAAGAMSLLFVYSLDYCRTRLANDVK
SSKKGSSRQFNGMVDVYKKTLKSDGIVGLYRGFVISCVGIVVYRGCYFGF
YDTLKPLLLGSDAGVMSSFALGYGVTVTSGLISYPIDTIRRRMMMTSGQA
VKYKGSIDCTVQIMKNEGFMALMKGAGANILRGVAGAGVLAGFDKFKDLY
VSFRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR002067Mit_carrier
IPR002113Aden_trnslctor
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 16..29
score: 42.51
coord: 130..148
score: 66.61
coord: 29..43
score: 76.17
coord: 180..198
score: 61.35
coord: 222..244
score: 56.59
coord: 79..99
score: 78.92
IPR002113Adenine nucleotide translocator 1PRINTSPR00927ADPTRNSLCASEcoord: 218..234
score: 47.29
coord: 13..25
score: 35.26
coord: 57..78
score: 48.82
coord: 90..102
score: 86.84
coord: 115..128
score: 65.71
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 7..304
e-value: 2.0E-103
score: 347.1
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 10..294
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 213..300
e-value: 3.1E-14
score: 52.7
coord: 117..210
e-value: 9.7E-25
score: 86.3
coord: 10..106
e-value: 8.9E-20
score: 70.4
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 15..104
score: 22.127
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 213..299
score: 20.175
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 115..207
score: 21.869
NoneNo IPR availablePANTHERPTHR45635:SF15coord: 12..299
NoneNo IPR availablePANTHERPTHR45635FAMILY NOT NAMEDcoord: 12..299
NoneNo IPR availableTMHMMTMhelixcoord: 214..236
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 177..199