1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase

Overview
Name1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase
Smed IDSMED30029890
Length (bp)5190
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30029890) t-SNE clustered cells

Violin plots show distribution of expression levels for 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30029890) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30029890) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (SMED30029890) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029890

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029890SMESG000024212.1 SmedASXL_015064SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029890SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029890SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029890SMESG000024212.1 SMESG000033570.1 dd_Smed_v4_9324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029890SMESG000024212.1 SMESG000033570.1 dd_Smed_v6_9324_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30029890SMESG000024212.1 OX_Smed_1.0.10847ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 272/476 (57.14%), Postives = 357/476 (75.00%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+W+SE  E  V +  LI+ ++SG   KD K+L+ L+   K+++++E R + +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  + N N KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ F++EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G  LPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 558.14 bits (1437), Expect = 3.264e-173
Identity = 297/614 (48.37%), Postives = 408/614 (66.45%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S V                 +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       ++M + +   IQ + S        +  ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANTAKANVTPQSSSELR-----PTTTAALASGV-----------------EAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 272/476 (57.14%), Postives = 357/476 (75.00%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+W+SE  E  V +  LI+ ++SG   KD K+L+ L+   K+++++E R + +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  + N N KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ F++EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G  LPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 558.525 bits (1438), Expect = 2.375e-173
Identity = 297/614 (48.37%), Postives = 408/614 (66.45%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S V                 +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       ++M + +   IQ + S        +  ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  555 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANTAKANVTPQSSSELR-----PTTTAALASGV-----------------EAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1143          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 272/476 (57.14%), Postives = 357/476 (75.00%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+W+SE  E  V +  LI+ ++SG   KD K+L+ L+   K+++++E R + +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  + N N KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ F++EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G  LPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 558.525 bits (1438), Expect = 2.375e-173
Identity = 297/614 (48.37%), Postives = 408/614 (66.45%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S V                 +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       ++M + +   IQ + S        +  ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  555 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANTAKANVTPQSSSELR-----PTTTAALASGV-----------------EAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1143          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 272/476 (57.14%), Postives = 357/476 (75.00%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+W+SE  E  V +  LI+ ++SG   KD K+L+ L+   K+++++E R + +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  + N N KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ F++EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G  LPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 558.14 bits (1437), Expect = 2.137e-173
Identity = 297/614 (48.37%), Postives = 408/614 (66.45%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S V                 +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       ++M + +   IQ + S        +  ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANTAKANVTPQSSSELR-----PTTTAALASGV-----------------EAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 272/476 (57.14%), Postives = 357/476 (75.00%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+W+SE  E  V +  LI+ ++SG   KD K+L+ L+   K+++++E R + +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  + N N KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ F++EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G  LPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 558.14 bits (1437), Expect = 2.137e-173
Identity = 297/614 (48.37%), Postives = 408/614 (66.45%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S V                 +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       ++M + +   IQ + S        +  ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANTAKANVTPQSSSELR-----PTTTAALASGV-----------------EAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 495/1072 (46.18%), Postives = 699/1072 (65.21%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQS-NIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKT-ADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQ-EPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKK--YLHEKKSSAKDLTSLMVGDESAE-----IEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSS-LFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQST-DGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKL 3460
            +K ++F W+  I  EL  G++FD YDDE   LE+N  V++DE GFFL W  E  +A V DM  I + ++G   KD +++ +L+ +  S  I +RT+ I+   D VN+ +   + +  ++       +  +  + +  ++CP TQL K+   L + VN   KIP+KL+ KTF+SG+ EK+V + L +L L  +K   ++D    TFEKF  L N ICPRT++Q+LF  LS  K+YLT +R+I FLNE QRDPRLNEIL+P+ +   +  +L  +E +   +  G++S D F R+LMSDEN PVFLDR+++  DMDQPL HYYINSSHNTYLTGRQ+ GKSS ++YRQVLL+GCRC+ELDCWDG G+++ EPIITHGKAMC+D+ F+DV+  IRD AF  S +PV LSFENHCSK  Q K+AKYC ++ G+ LL+KP E   L+ GV LPSP +L+ KILIKNKRL  + E+ QLD FL+ +  L ++ E+ E P+++  +  +   + ++++D+   + +       LK +    SK+   S +S +  +P  +S+ +  +       +++ +    ME S +E     + K   +  E  S +  L   M    S +      +++++ +   Y +T  TTN+HP LSSLVNY  PVKF GF++       FHMSSFSE+  LG++K  A E VNYNK Q SRIYP+G RVDSSNFLPQIFWNAGCQMV+LNFQ+ D+ MQLN G+FEYN  SGY+LKP+F+RR +R FDPFSESP+DGVIAA C V++ISGQFLS++KIGTYVEV+MYGLPTDTIRKE +T+V+P NGLNP+Y ED  FVFRKV+LP+LAVLR  V++E GK +GQR+LPLDGLQ G+RHISLRS+ N    LS  LF +I + TYVPD  +  VDAL+DPRA +S ++ + + +A+MG + S+I D+ P+T ++  +  K+   +  S+ D   +N + G  +   T+ + S+     +R+ N    P     FK D I  E+  + L   K   K LKR  KE  +L+K+  K+ + + K    + +KL
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLR-EGKLDEEDELNETPEVVGEDSVSPREMPAKENDEAHPELKQNFIAKNLKGFGF--SKKQPDSSTSLLTASPTPSSSSMAMSNANNPFSSSTLNSPQPMERSRSEKRSFRQKKGGVFGDELHSDSAALIDFMRTASSRKKKPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDV-PNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASST----IRSPNEQPQPVAVDKFKVDPI--EV--DDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQQTNVDKL 1060          

HSP 2 Score: 56.6102 bits (135), Expect = 1.784e-7
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 3671 KVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            K++S+ Q  Q   L+L  + E K++   QTK SME  +++  D   + KAERDRR++EL + N K F+++R+   MK  +
Sbjct: 1183 KLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQK 1262          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 493/1063 (46.38%), Postives = 695/1063 (65.38%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQS-NIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKT-ADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQ-EPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKK--YLHEKKSSAKDLTSLMVGDESAE-----IEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSS-LFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQST-DGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLK 3433
            +K ++F W+  I  EL  G++FD YDDE   LE+N  V++DE GFFL W  E  +A V DM  I + ++G   KD +++ +L+ +  S  I +RT+ I+   D VN+ +   + +  ++       +  +  + +  ++CP TQL K+   L + VN   KIP+KL+ KTF+SG+ EK+V + L +L L  +K   ++D    TFEKF  L N ICPRT++Q+LF  LS  K+YLT +R+I FLNE QRDPRLNEIL+P+ +   +  +L  +E +   +  G++S D F R+LMSDEN PVFLDR+++  DMDQPL HYYINSSHNTYLTGRQ+ GKSS ++YRQVLL+GCRC+ELDCWDG G+++ EPIITHGKAMC+D+ F+DV+  IRD AF  S +PV LSFENHCSK  Q K+AKYC ++ G+ LL+KP E   L+ GV LPSP +L+ KILIKNKRL  + E+ QLD FL+ +  L ++ E+ E P+++  +  +   + ++++D+   + +       LK +    SK+   S +S +  +P  +S+ +  +       +++ +    ME S +E     + K   +  E  S +  L   M    S +      +++++ +   Y +T  TTN+HP LSSLVNY  PVKF GF++       FHMSSFSE+  LG++K  A E VNYNK Q SRIYP+G RVDSSNFLPQIFWNAGCQMV+LNFQ+ D+ MQLN G+FEYN  SGY+LKP+F+RR +R FDPFSESP+DGVIAA C V++ISGQFLS++KIGTYVEV+MYGLPTDTIRKE +T+V+P NGLNP+Y ED  FVFRKV+LP+LAVLR  V++E GK +GQR+LPLDGLQ G+RHISLRS+ N    LS  LF +I + TYVPD  +  VDAL+DPRA +S ++ + + +A+MG + S+I D+ P+T ++  +  K+   +  S+ D   +N + G  +   T+ + S+     +R+ N    P     FK D I  E+  + L   K   K LKR  KE  +L+K+  K+ + + K
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLR-EGKLDEEDELNETPEVVGEDSVSPREMPAKENDEAHPELKQNFIAKNLKGFGF--SKKQPDSSTSLLTASPTPSSSSMAMSNANNPFSSSTLNSPQPMERSRSEKRSFRQKKGGVFGDELHSDSAALIDFMRTASSRKKKPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDV-PNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASST----IRSPNEQPQPVAVDKFKVDPI--EV--DDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQK 1051          

HSP 2 Score: 56.6102 bits (135), Expect = 1.896e-7
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 3671 KVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            K++S+ Q  Q   L+L  + E K++   QTK SME  +++  D   + KAERDRR++EL + N K F+++R+   MK  +
Sbjct: 1195 KLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQK 1274          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 495/1100 (45.00%), Postives = 699/1100 (63.55%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQS-NIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTA-----------------------------DVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQ-EPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKK--YLHEKKSSAKDLTSLMVGDESAE-----IEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSS-LFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQST-DGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKL 3460
            +K ++F W+  I  EL  G++FD YDDE   LE+N  V++DE GFFL W  E  +A V DM  I + ++G   KD +++ +L+ +  S  I +RT+ I+   D VN+ +   + +  ++       +  +  + +  ++CP TQL K+   L + VN   KIP+KL+ KTF+SG+ EK+V + L +L L  +K                               ++D    TFEKF  L N ICPRT++Q+LF  LS  K+YLT +R+I FLNE QRDPRLNEIL+P+ +   +  +L  +E +   +  G++S D F R+LMSDEN PVFLDR+++  DMDQPL HYYINSSHNTYLTGRQ+ GKSS ++YRQVLL+GCRC+ELDCWDG G+++ EPIITHGKAMC+D+ F+DV+  IRD AF  S +PV LSFENHCSK  Q K+AKYC ++ G+ LL+KP E   L+ GV LPSP +L+ KILIKNKRL  + E+ QLD FL+ +  L ++ E+ E P+++  +  +   + ++++D+   + +       LK +    SK+   S +S +  +P  +S+ +  +       +++ +    ME S +E     + K   +  E  S +  L   M    S +      +++++ +   Y +T  TTN+HP LSSLVNY  PVKF GF++       FHMSSFSE+  LG++K  A E VNYNK Q SRIYP+G RVDSSNFLPQIFWNAGCQMV+LNFQ+ D+ MQLN G+FEYN  SGY+LKP+F+RR +R FDPFSESP+DGVIAA C V++ISGQFLS++KIGTYVEV+MYGLPTDTIRKE +T+V+P NGLNP+Y ED  FVFRKV+LP+LAVLR  V++E GK +GQR+LPLDGLQ G+RHISLRS+ N    LS  LF +I + TYVPD  +  VDAL+DPRA +S ++ + + +A+MG + S+I D+ P+T ++  +  K+   +  S+ D   +N + G  +   T+ + S+     +R+ N    P     FK D I  E+  + L   K   K LKR  KE  +L+K+  K+ + + K    + +KL
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPARVINRSMGKKFRNFYKCSRGRKRKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLR-EGKLDEEDELNETPEVVGEDSVSPREMPAKENDEAHPELKQNFIAKNLKGFGF--SKKQPDSSTSLLTASPTPSSSSMAMSNANNPFSSSTLNSPQPMERSRSEKRSFRQKKGGVFGDELHSDSAALIDFMRTASSRKKKPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDV-PNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASST----IRSPNEQPQPVAVDKFKVDPI--EV--DDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQKQQQTNVDKL 1088          

HSP 2 Score: 56.6102 bits (135), Expect = 2.104e-7
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 3671 KVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            K++S+ Q  Q   L+L  + E K++   QTK SME  +++  D   + KAERDRR++EL + N K F+++R+   MK  +
Sbjct: 1211 KLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQK 1290          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 919.072 bits (2374), Expect = 0.000e+0
Identity = 493/1091 (45.19%), Postives = 695/1091 (63.70%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQS-NIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTA-----------------------------DVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQ-EPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKK--YLHEKKSSAKDLTSLMVGDESAE-----IEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSS-LFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQST-DGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLK 3433
            +K ++F W+  I  EL  G++FD YDDE   LE+N  V++DE GFFL W  E  +A V DM  I + ++G   KD +++ +L+ +  S  I +RT+ I+   D VN+ +   + +  ++       +  +  + +  ++CP TQL K+   L + VN   KIP+KL+ KTF+SG+ EK+V + L +L L  +K                               ++D    TFEKF  L N ICPRT++Q+LF  LS  K+YLT +R+I FLNE QRDPRLNEIL+P+ +   +  +L  +E +   +  G++S D F R+LMSDEN PVFLDR+++  DMDQPL HYYINSSHNTYLTGRQ+ GKSS ++YRQVLL+GCRC+ELDCWDG G+++ EPIITHGKAMC+D+ F+DV+  IRD AF  S +PV LSFENHCSK  Q K+AKYC ++ G+ LL+KP E   L+ GV LPSP +L+ KILIKNKRL  + E+ QLD FL+ +  L ++ E+ E P+++  +  +   + ++++D+   + +       LK +    SK+   S +S +  +P  +S+ +  +       +++ +    ME S +E     + K   +  E  S +  L   M    S +      +++++ +   Y +T  TTN+HP LSSLVNY  PVKF GF++       FHMSSFSE+  LG++K  A E VNYNK Q SRIYP+G RVDSSNFLPQIFWNAGCQMV+LNFQ+ D+ MQLN G+FEYN  SGY+LKP+F+RR +R FDPFSESP+DGVIAA C V++ISGQFLS++KIGTYVEV+MYGLPTDTIRKE +T+V+P NGLNP+Y ED  FVFRKV+LP+LAVLR  V++E GK +GQR+LPLDGLQ G+RHISLRS+ N    LS  LF +I + TYVPD  +  VDAL+DPRA +S ++ + + +A+MG + S+I D+ P+T ++  +  K+   +  S+ D   +N + G  +   T+ + S+     +R+ N    P     FK D I  E+  + L   K   K LKR  KE  +L+K+  K+ + + K
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPARVINRSMGKKFRNFYKCSRGRKRKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLR-EGKLDEEDELNETPEVVGEDSVSPREMPAKENDEAHPELKQNFIAKNLKGFGF--SKKQPDSSTSLLTASPTPSSSSMAMSNANNPFSSSTLNSPQPMERSRSEKRSFRQKKGGVFGDELHSDSAALIDFMRTASSRKKKPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDV-PNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASST----IRSPNEQPQPVAVDKFKVDPI--EV--DDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQK 1079          

HSP 2 Score: 56.6102 bits (135), Expect = 2.038e-7
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 3671 KVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            K++S+ Q  Q   L+L  + E K++   QTK SME  +++  D   + KAERDRR++EL + N K F+++R+   MK  +
Sbjct: 1223 KLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQK 1302          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Match: egl-8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 [Source:UniProtKB/Swiss-Prot;Acc:G5EBH0])

HSP 1 Score: 479.559 bits (1233), Expect = 6.142e-152
Identity = 244/528 (46.21%), Postives = 341/528 (64.58%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQS-NIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEK-----------------------------TADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQ-EPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGED 1771
            +K ++F W+  I  EL  G++FD YDDE   LE+N  V++DE GFFL W  E  +A V DM  I + ++G   KD +++ +L+ +  S  I +RT+ I+   D VN+ +   + +  ++       +  +  + +  ++CP TQL K+   L + VN   KIP+KL+ KTF+SG+ EK+V + L +L L  +K                               ++D    TFEKF  L N ICPRT++Q+LF  LS  K+YLT +R+I FLNE QRDPRLNEIL+P+ +   +  +L  +E +   +  G++S D F R+LMSDEN PVFLDR+++  DMDQPL HYYINSSHNTYLTGRQ+ GKSS ++YRQVLL+GCRC+ELDCWDG G+++ EPIITHGKAMC+D+ F+DV+  IRD AF  S +PV LSFENHCSK  Q K+AKYC ++ G+ LL+KP E   L+ GV LPSP +L+ KILIKNKRL  + E+ QLD FL+ +  L ++ E+ E P+++ GED
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPARVINRSMGKKFRNFYKCSRGRKRKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLR-EGKLDEEDELNETPEVV-GED 527          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0343599)

HSP 1 Score: 533.487 bits (1373), Expect = 1.823e-165
Identity = 259/494 (52.43%), Postives = 354/494 (71.66%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFD-FYDDEL----NILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNI---EDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLE 1735
            +K YEF W   +P EL  G +FD ++++E     N  E + L KVDE+GFFL WKSE  +  V ++  +SD+++G   KD K+L ++  K  +NI   + R+L I  N+D++N+     I  D+     W+  +R + HN+KA NICPM  L+KHW+RL   V  + KIP+K +AKTFASG+ EKLV+  +K+  LP +K A +   QFTF+KFY L + +CPR DI++LF S+++GK D+++ ++ I+F+N+ QRDPR+NEILYP         I++ YEL+  +K   ++S+D F RYLMSDENAPVFLDRLD + +MDQPLAHYYINSSHNTYL+GRQ  GKSSV+MYRQ LLAGCRCVELDCW+GKG+D+EPI+THG A C++ILF+D I AI DCAFV+S YPV LSFENHC++ QQYK+AKYC++  G+ LL +P+  H L+ G+PLP P KLK KILIKNKR+  E EK++L+++LKG+     D E
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPE 495          

HSP 2 Score: 467.618 bits (1202), Expect = 2.005e-141
Identity = 245/585 (41.88%), Postives = 352/585 (60.17%), Query Frame = 2
Query: 2156 HTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            ++  TTNVHP+LSS+VNYAQP+KF GF+   EK    +MSSF+E+A + ++K  +I+ VNYNK Q+SRIYP+G R DSSN++PQ+FWNAGCQMV+LNFQSSDL MQLNQG+FEYN   GY+LKP+FMRR+++ FDPF+++P+DGVIAA C VK+I+GQFLS+KK+GTYVEVDM+GLP+DT++KEFRTR+V  NGLNP+Y ED  FVFRKV+LPDLAVLR GV+EE+GK++GQR+LPLDGLQ G+RH+SLR+E NFP +L  LF  I L  YVPDGF  F+  LSDPR      + + + M  +G E                                         Q     +      + + +   LV+ P   +  + +  F+++  + + E  T+    K+  KE +++QK Q   I++L+K    S + + +    + SI  + K    M I  +++   +ML    ++ Q+  K                          ++  +Q  Q K L     R++K+++ +Q K S +  + V  D   + K E+DRRLRE    N KRF+++++   +K  R
Sbjct:  539 YSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIE----------------------------------------EQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTL---RKKHAKERTSVQKTQNAAIDKLIKGK--SKDDIRNDANIKNSINDQTKQWTDM-IARHRKEEWDMLRQHVQDSQDAMKA-------------------------LMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGR 1051          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0100670)

HSP 1 Score: 533.487 bits (1373), Expect = 1.823e-165
Identity = 259/494 (52.43%), Postives = 354/494 (71.66%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFD-FYDDEL----NILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNI---EDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLE 1735
            +K YEF W   +P EL  G +FD ++++E     N  E + L KVDE+GFFL WKSE  +  V ++  +SD+++G   KD K+L ++  K  +NI   + R+L I  N+D++N+     I  D+     W+  +R + HN+KA NICPM  L+KHW+RL   V  + KIP+K +AKTFASG+ EKLV+  +K+  LP +K A +   QFTF+KFY L + +CPR DI++LF S+++GK D+++ ++ I+F+N+ QRDPR+NEILYP         I++ YEL+  +K   ++S+D F RYLMSDENAPVFLDRLD + +MDQPLAHYYINSSHNTYL+GRQ  GKSSV+MYRQ LLAGCRCVELDCW+GKG+D+EPI+THG A C++ILF+D I AI DCAFV+S YPV LSFENHC++ QQYK+AKYC++  G+ LL +P+  H L+ G+PLP P KLK KILIKNKR+  E EK++L+++LKG+     D E
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPE 495          

HSP 2 Score: 467.618 bits (1202), Expect = 2.005e-141
Identity = 245/585 (41.88%), Postives = 352/585 (60.17%), Query Frame = 2
Query: 2156 HTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            ++  TTNVHP+LSS+VNYAQP+KF GF+   EK    +MSSF+E+A + ++K  +I+ VNYNK Q+SRIYP+G R DSSN++PQ+FWNAGCQMV+LNFQSSDL MQLNQG+FEYN   GY+LKP+FMRR+++ FDPF+++P+DGVIAA C VK+I+GQFLS+KK+GTYVEVDM+GLP+DT++KEFRTR+V  NGLNP+Y ED  FVFRKV+LPDLAVLR GV+EE+GK++GQR+LPLDGLQ G+RH+SLR+E NFP +L  LF  I L  YVPDGF  F+  LSDPR      + + + M  +G E                                         Q     +      + + +   LV+ P   +  + +  F+++  + + E  T+    K+  KE +++QK Q   I++L+K    S + + +    + SI  + K    M I  +++   +ML    ++ Q+  K                          ++  +Q  Q K L     R++K+++ +Q K S +  + V  D   + K E+DRRLRE    N KRF+++++   +K  R
Sbjct:  539 YSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIE----------------------------------------EQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTL---RKKHAKERTSVQKTQNAAIDKLIKGK--SKDDIRNDANIKNSINDQTKQWTDM-IARHRKEEWDMLRQHVQDSQDAMKA-------------------------LMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGR 1051          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0100671)

HSP 1 Score: 533.487 bits (1373), Expect = 1.823e-165
Identity = 259/494 (52.43%), Postives = 354/494 (71.66%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFD-FYDDEL----NILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNI---EDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLE 1735
            +K YEF W   +P EL  G +FD ++++E     N  E + L KVDE+GFFL WKSE  +  V ++  +SD+++G   KD K+L ++  K  +NI   + R+L I  N+D++N+     I  D+     W+  +R + HN+KA NICPM  L+KHW+RL   V  + KIP+K +AKTFASG+ EKLV+  +K+  LP +K A +   QFTF+KFY L + +CPR DI++LF S+++GK D+++ ++ I+F+N+ QRDPR+NEILYP         I++ YEL+  +K   ++S+D F RYLMSDENAPVFLDRLD + +MDQPLAHYYINSSHNTYL+GRQ  GKSSV+MYRQ LLAGCRCVELDCW+GKG+D+EPI+THG A C++ILF+D I AI DCAFV+S YPV LSFENHC++ QQYK+AKYC++  G+ LL +P+  H L+ G+PLP P KLK KILIKNKR+  E EK++L+++LKG+     D E
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPE 495          

HSP 2 Score: 467.618 bits (1202), Expect = 2.005e-141
Identity = 245/585 (41.88%), Postives = 352/585 (60.17%), Query Frame = 2
Query: 2156 HTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            ++  TTNVHP+LSS+VNYAQP+KF GF+   EK    +MSSF+E+A + ++K  +I+ VNYNK Q+SRIYP+G R DSSN++PQ+FWNAGCQMV+LNFQSSDL MQLNQG+FEYN   GY+LKP+FMRR+++ FDPF+++P+DGVIAA C VK+I+GQFLS+KK+GTYVEVDM+GLP+DT++KEFRTR+V  NGLNP+Y ED  FVFRKV+LPDLAVLR GV+EE+GK++GQR+LPLDGLQ G+RH+SLR+E NFP +L  LF  I L  YVPDGF  F+  LSDPR      + + + M  +G E                                         Q     +      + + +   LV+ P   +  + +  F+++  + + E  T+    K+  KE +++QK Q   I++L+K    S + + +    + SI  + K    M I  +++   +ML    ++ Q+  K                          ++  +Q  Q K L     R++K+++ +Q K S +  + V  D   + K E+DRRLRE    N KRF+++++   +K  R
Sbjct:  539 YSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIE----------------------------------------EQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTL---RKKHAKERTSVQKTQNAAIDKLIKGK--SKDDIRNDANIKNSINDQTKQWTDM-IARHRKEEWDMLRQHVQDSQDAMKA-------------------------LMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGR 1051          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0070651)

HSP 1 Score: 525.013 bits (1351), Expect = 2.116e-162
Identity = 257/494 (52.02%), Postives = 351/494 (71.05%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFD-FYDDEL----NILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNI---EDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLE 1735
            +K YEF W   +P EL  G +FD ++++E     N  E + L KVDE+GFFL WKSE  +  V ++  +SD+++G   KD K+L ++  K  +NI   + R+L I  N+D++N+     I  D+     W  +LR + HN +A N+CP   L KHW+RL   V  + KIP+K +AKTFASG+ EKLV+  +K+  LP +K A +   QFTF+KFY L + +CPR DI++LF S+++GK D+++ ++ I+F+N+ QRDPR+NEILYP         I++ YEL+  +K   ++S+D F RYLMSDENAPVFLDRLD + +MDQPLAHYYINSSHNTYL+GRQ  GKSSV+MYRQ LLAGCRCVELDCW+GKG+D+EPI+THG A C++ILF+D I AI DCAFV+S YPV LSFENHC++ QQYK+AKYC++  G+ LL +P+  H L+ G+PLP P KLK KILIKNKR+  E EK++L+++LKG+     D E
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKSWQKNLRLITHNNRATNVCPRVNLMKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPE 495          

HSP 2 Score: 467.233 bits (1201), Expect = 2.377e-141
Identity = 245/585 (41.88%), Postives = 352/585 (60.17%), Query Frame = 2
Query: 2156 HTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            ++  TTNVHP+LSS+VNYAQP+KF GF+   EK    +MSSF+E+A + ++K  +I+ VNYNK Q+SRIYP+G R DSSN++PQ+FWNAGCQMV+LNFQSSDL MQLNQG+FEYN   GY+LKP+FMRR+++ FDPF+++P+DGVIAA C VK+I+GQFLS+KK+GTYVEVDM+GLP+DT++KEFRTR+V  NGLNP+Y ED  FVFRKV+LPDLAVLR GV+EE+GK++GQR+LPLDGLQ G+RH+SLR+E NFP +L  LF  I L  YVPDGF  F+  LSDPR      + + + M  +G E                                         Q     +      + + +   LV+ P   +  + +  F+++  + + E  T+    K+  KE +++QK Q   I++L+K    S + + +    + SI  + K    M I  +++   +ML    ++ Q+  K                          ++  +Q  Q K L     R++K+++ +Q K S +  + V  D   + K E+DRRLRE    N KRF+++++   +K  R
Sbjct:  539 YSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIE----------------------------------------EQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTL---RKKHAKERTSVQKTQNAAIDKLIKGK--SKDDIRNDANIKNSINDQTKQWTDM-IARHRKEEWDMLRQHVQDSQDAMKA-------------------------LMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGR 1051          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Match: norpA (gene:FBgn0262738 transcript:FBtr0301475)

HSP 1 Score: 525.013 bits (1351), Expect = 2.116e-162
Identity = 257/494 (52.02%), Postives = 351/494 (71.05%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFD-FYDDEL----NILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNI---EDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLE 1735
            +K YEF W   +P EL  G +FD ++++E     N  E + L KVDE+GFFL WKSE  +  V ++  +SD+++G   KD K+L ++  K  +NI   + R+L I  N+D++N+     I  D+     W  +LR + HN +A N+CP   L KHW+RL   V  + KIP+K +AKTFASG+ EKLV+  +K+  LP +K A +   QFTF+KFY L + +CPR DI++LF S+++GK D+++ ++ I+F+N+ QRDPR+NEILYP         I++ YEL+  +K   ++S+D F RYLMSDENAPVFLDRLD + +MDQPLAHYYINSSHNTYL+GRQ  GKSSV+MYRQ LLAGCRCVELDCW+GKG+D+EPI+THG A C++ILF+D I AI DCAFV+S YPV LSFENHC++ QQYK+AKYC++  G+ LL +P+  H L+ G+PLP P KLK KILIKNKR+  E EK++L+++LKG+     D E
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKSWQKNLRLITHNNRATNVCPRVNLMKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPE 495          

HSP 2 Score: 467.233 bits (1201), Expect = 2.377e-141
Identity = 245/585 (41.88%), Postives = 352/585 (60.17%), Query Frame = 2
Query: 2156 HTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            ++  TTNVHP+LSS+VNYAQP+KF GF+   EK    +MSSF+E+A + ++K  +I+ VNYNK Q+SRIYP+G R DSSN++PQ+FWNAGCQMV+LNFQSSDL MQLNQG+FEYN   GY+LKP+FMRR+++ FDPF+++P+DGVIAA C VK+I+GQFLS+KK+GTYVEVDM+GLP+DT++KEFRTR+V  NGLNP+Y ED  FVFRKV+LPDLAVLR GV+EE+GK++GQR+LPLDGLQ G+RH+SLR+E NFP +L  LF  I L  YVPDGF  F+  LSDPR      + + + M  +G E                                         Q     +      + + +   LV+ P   +  + +  F+++  + + E  T+    K+  KE +++QK Q   I++L+K    S + + +    + SI  + K    M I  +++   +ML    ++ Q+  K                          ++  +Q  Q K L     R++K+++ +Q K S +  + V  D   + K E+DRRLRE    N KRF+++++   +K  R
Sbjct:  539 YSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIE----------------------------------------EQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTL---RKKHAKERTSVQKTQNAAIDKLIKGK--SKDDIRNDANIKNSINDQTKQWTDM-IARHRKEEWDMLRQHVQDSQDAMKA-------------------------LMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGR 1051          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:100537538])

HSP 1 Score: 530.406 bits (1365), Expect = 1.049e-163
Identity = 249/450 (55.33%), Postives = 321/450 (71.33%), Query Frame = 2
Query:  371 ILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKH--QLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLK 1705
            + E NC  KVDE GFFL+WKSE  E  V +  LI+ ++    +KD KVL  L+   K +SN+EDR + I   +D VNL  +  + ++      W   LRS+  N +A N+CPMT L+KHW+RL  L NVN +IP++ + +TFASG+ EK +FQ+LK+L LP  K  ++    FTF+KFY+L   ICPRTDI+ LF      K DYL+ ++ + FLN+ QRDPRLNEIL+P+ N      I+  YE        G +S D F R+LMSDENAPVFLDRL+++Q+MD PL+HY+INSSHNTYLTGRQF GKSSV++YRQVLL GCRCVELDCWDGKG+DQEPIITHGKAMC+D+LF+DVI  I++ AF+TS YPV LSFENHC+K QQYK+A+YCE++ G+ LL +P+E    ++E G PLPSP  LK KILIKN+RL  E EK QL+ F K
Sbjct:    5 VFESNCFFKVDESGFFLTWKSEGKEGQVLEFSLINSIRDASALKDPKVLCALEASGKCESNLEDRIICICSGTDLVNLSFMYMVTQNPTTAKEWTDGLRSLIQNTRANNVCPMTCLRKHWMRLSFLTNVNGQIPVRSITRTFASGKTEKGIFQALKDLGLPSGKNDEIQREIFTFDKFYSLTQKICPRTDIEVLFKKFKGDKGDYLSVEQFVHFLNDNQRDPRLNEILFPFFNSKCAFQIIQRYEPVKALVCAGLLSCDGFCRFLMSDENAPVFLDRLEVYQEMDHPLSHYFINSSHNTYLTGRQFGGKSSVEIYRQVLLTGCRCVELDCWDGKGEDQEPIITHGKAMCTDVLFKDVIQGIKETAFLTSEYPVILSFENHCTKHQQYKLARYCEDIFGDLLLKQPLEDFPPKMEPGCPLPSPNDLKGKILIKNRRLKPEVEKKQLEDFRK 454          

HSP 2 Score: 517.309 bits (1331), Expect = 7.937e-159
Identity = 290/624 (46.47%), Postives = 399/624 (63.94%), Query Frame = 2
Query: 2108 SAEIE--KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFE-EITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHK-------------------KKTENQMKID-MNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            SAE E   D+  V  +Y + + TTN+HPYLS+++NYAQ VKF GF+   EK    +MSSF+E+  LG+++ +AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN + G++LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y  ++ FVFRKVILPDLAVLR+ V+++  KLIGQR+LPLDGLQ+G+RHISLR+E N P  L+++FC I L TYVPDGF + VDALSDP+  +S  E +   M  MG E S+I D+       NKK+   +           + M     ++S   +            EN+  S  +  +  D ++   ++T + L +TKT +K +K+Q KE + L+K+  K    L  SHS   ++  +   K+K  + K                   +  E QMK   MN +S  ++L + +    E +++   H   EQ +   +  Q  E   K+L   Q  Q   L L+ +R+ KEM   Q K+SME+++ +  D + +NKAER+RR+REL   N ++FL +R+   MK  +
Sbjct:  523 SAEEENVADELAVIQSYTYVAATTNIHPYLSNIINYAQAVKFTGFDEAEEKNIHHNMSSFNESVGLGYLRTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGFLLKPDFMRRPDRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNAEA-FVFRKVILPDLAVLRVAVYDDNNKLIGQRILPLDGLQSGYRHISLRNEYNKPLPLATVFCNIILKTYVPDGFGAIVDALSDPKKFLSICEKRTDQMRAMGIEASDIADVPSDVWKGNKKRKTNQ-----------AGMMMKPQKDSDRPR------------ENMPISSKEVCEPADSSVLTPQLTIDDLKQTKTFLKLIKKQQKEVNALKKKHAKAHAALRSSHSAQLDRTVAQHEKEKHTLEKQLHKNTSRKVSESSSLEMSRDIEQQMKTAVMNHKS--KVLRIIDVYASECSEMLRWHSAEEQTVVEQHLLQQCEQLHKLLMLEQEQQTHQLTLLHERQSKEMRTNQAKTSMESSKAISQDKSIKNKAERERRVRELNSTNTRKFLTERKRLAMKQTK 1120          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: plcb3 (phospholipase C, beta 3 (phosphatidylinositol-specific) [Source:ZFIN;Acc:ZDB-GENE-030616-594])

HSP 1 Score: 350.132 bits (897), Expect = 3.880e-99
Identity = 221/579 (38.17%), Postives = 326/579 (56.30%), Query Frame = 2
Query: 2171 TNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHIS----REEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAK---RFLDQRR 3886
             N    +S+LVNY +PVKF  F +  +++  F MSSF ET  +  +KN   E V YNK Q+SRIYP+G RVDSSN++PQ+FWN GCQMVALNFQ+ DLAMQLN G FEYN   GY+LKPEFMRR+++ FDPF+   +DG++A T +VKIISGQFL++KK+G YVEVDM+GLP DT RK +RT+    N L+P++ +D  FVF KV+LP LA LR+ V+EE GK IG R+LP+  L+ G+ +I L++E N P  L SL     +  Y+P+    + +AL++P  H+S    RE   L LM +                      T+    +++  DGTDS+    +        + S+     V   +L   P+  K+   + + + I PES++E K    YLK        L K+Q KE  EL K H    +K+ +   +QK++ +++ +E Q K    ++ I+   SL +   ++      N L+ E   ++   ++     L VL Q QL   K        EVK+ H +      EAN+  + D     +A + ++L+++CD   K   + LD++R
Sbjct:  564 VNATEEMSTLVNYIEPVKFKSFEVAAKRKKFFEMSSFVETKGMDTLKNSPTEFVEYNKKQMSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLAMQLNMGVFEYNGRCGYLLKPEFMRRTDKHFDPFTTDIVDGIVANTVKVKIISGQFLNDKKVGVYVEVDMFGLPADTKRK-YRTKTSNNNSLDPVW-DDETFVFNKVVLPTLASLRVAVYEENGKFIGHRILPVSALRPGYHYICLKNELNQPLMLPSLLVYTEVQDYIPNEHQEYAEALTNPIKHLSLLAQRESQLLALMED---------------------PTEGGPTKQEEGDGTDSSC---VTSADPIFPLPSSPTLPSVPT-DLNPPPSGQKEDLVNNVLKVIEPESVDELKQHNSYLK--------LLKKQCKEFKELSKKH---LKKMLALSKEQKTLFNQQSSELQRKRSQIEKRIR--TSLKKNGSEDSVHRELNELDLELQKQMEQFREEHMQKLLVLRQGQLQMEK--------EVKQFHLK------EANQ-KLKDIAIECQAAQIKKLKDVCDKEKKELQKMLDRKR 1087          

HSP 2 Score: 348.206 bits (892), Expect = 1.581e-98
Identity = 193/457 (42.23%), Postives = 276/457 (60.39%), Query Frame = 2
Query:  311 NIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKS-EAYVYDMPLISDVKSGV---KIKDEKVLSQL-QDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHC-SKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKR 1660
            ++ E LK+G+ F  +D+E N       ++VD  GFFL W    S EA + DM  I D ++G      KD+++   L   K   N + R L +   +D VN+  L F          W   L  +  N+ + N    T L K + +L L V  + KIP+K + K F+   ++K V  +L+   L   +   + P  FT+E F N LN + PR +++ +F  L S+GK +L+ D+++ F+N  QRD RLNE+LYP   R+ V+ +++ YE N  +  + +IS+  F +YL  +EN  V  +RLD+  DM+QPL+HY+INSSHNTYLT  Q  G SSV+MYRQVLL GCRC+ELDCW G+  ++EPIITHG  M ++I F+DVI AI + AF TSPYP+ LSFENH  S  QQ K+A+YC  + G+ LL  P++K+ L  G  LPSP++L  KILIKNK+
Sbjct:   17 SVNEVLKRGSKFIKWDEEANSTPSLITLRVDPNGFFLYWTGGTSMEAEILDMSHIRDTRTGKFAKTPKDQRIREMLFSGKADGNSDSRLLTVVYGNDLVNISFLNFQAVQDGYCKLWTDELFKLATNMLSQNASRNTFLLKAYTKLKLQVTQDGKIPVKNILKMFS---DKKRVEMALEHCGLIFNRVDGIKPDDFTWEMFQNFLNKLSPRPEVERIFVDLGSKGKPFLSLDQLMDFINRKQRDSRLNEVLYPPLKRDQVRQLMEKYETNTSQLERDQISLMSFTKYLGGEENTVVPPERLDIIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCRCIELDCWKGRPPEEEPIITHGFTMTTEIPFKDVIEAIAESAFKTSPYPLILSFENHVDSAKQQAKMAEYCRSMFGDALLIDPLDKYPLVPGQQLPSPQELLGKILIKNKK 470          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: plcb3 (phospholipase C, beta 3 (phosphatidylinositol-specific) [Source:ZFIN;Acc:ZDB-GENE-030616-594])

HSP 1 Score: 350.132 bits (897), Expect = 3.937e-99
Identity = 221/579 (38.17%), Postives = 326/579 (56.30%), Query Frame = 2
Query: 2171 TNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHIS----REEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAK---RFLDQRR 3886
             N    +S+LVNY +PVKF  F +  +++  F MSSF ET  +  +KN   E V YNK Q+SRIYP+G RVDSSN++PQ+FWN GCQMVALNFQ+ DLAMQLN G FEYN   GY+LKPEFMRR+++ FDPF+   +DG++A T +VKIISGQFL++KK+G YVEVDM+GLP DT RK +RT+    N L+P++ +D  FVF KV+LP LA LR+ V+EE GK IG R+LP+  L+ G+ +I L++E N P  L SL     +  Y+P+    + +AL++P  H+S    RE   L LM +                      T+    +++  DGTDS+    +        + S+     V   +L   P+  K+   + + + I PES++E K    YLK        L K+Q KE  EL K H    +K+ +   +QK++ +++ +E Q K    ++ I+   SL +   ++      N L+ E   ++   ++     L VL Q QL   K        EVK+ H +      EAN+  + D     +A + ++L+++CD   K   + LD++R
Sbjct:  564 VNATEEMSTLVNYIEPVKFKSFEVAAKRKKFFEMSSFVETKGMDTLKNSPTEFVEYNKKQMSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLAMQLNMGVFEYNGRCGYLLKPEFMRRTDKHFDPFTTDIVDGIVANTVKVKIISGQFLNDKKVGVYVEVDMFGLPADTKRK-YRTKTSNNNSLDPVW-DDETFVFNKVVLPTLASLRVAVYEENGKFIGHRILPVSALRPGYHYICLKNELNQPLMLPSLLVYTEVQDYIPNEHQEYAEALTNPIKHLSLLAQRESQLLALMED---------------------PTEGGPTKQEEGDGTDSSC---VTSADPIFPLPSSPTLPSVPT-DLNPPPSGQKEDLVNNVLKVIEPESVDELKQHNSYLK--------LLKKQCKEFKELSKKH---LKKMLALSKEQKTLFNQQSSELQRKRSQIEKRIR--TSLKKNGSEDSVHRELNELDLELQKQMEQFREEHMQKLLVLRQGQLQMEK--------EVKQFHLK------EANQ-KLKDIAIECQAAQIKKLKDVCDKEKKELQKMLDRKR 1087          

HSP 2 Score: 348.206 bits (892), Expect = 1.810e-98
Identity = 193/457 (42.23%), Postives = 276/457 (60.39%), Query Frame = 2
Query:  311 NIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKS-EAYVYDMPLISDVKSGV---KIKDEKVLSQL-QDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHC-SKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKR 1660
            ++ E LK+G+ F  +D+E N       ++VD  GFFL W    S EA + DM  I D ++G      KD+++   L   K   N + R L +   +D VN+  L F          W   L  +  N+ + N    T L K + +L L V  + KIP+K + K F+   ++K V  +L+   L   +   + P  FT+E F N LN + PR +++ +F  L S+GK +L+ D+++ F+N  QRD RLNE+LYP   R+ V+ +++ YE N  +  + +IS+  F +YL  +EN  V  +RLD+  DM+QPL+HY+INSSHNTYLT  Q  G SSV+MYRQVLL GCRC+ELDCW G+  ++EPIITHG  M ++I F+DVI AI + AF TSPYP+ LSFENH  S  QQ K+A+YC  + G+ LL  P++K+ L  G  LPSP++L  KILIKNK+
Sbjct:   17 SVNEVLKRGSKFIKWDEEANSTPSLITLRVDPNGFFLYWTGGTSMEAEILDMSHIRDTRTGKFAKTPKDQRIREMLFSGKADGNSDSRLLTVVYGNDLVNISFLNFQAVQDGYCKLWTDELFKLATNMLSQNASRNTFLLKAYTKLKLQVTQDGKIPVKNILKMFS---DKKRVEMALEHCGLIFNRVDGIKPDDFTWEMFQNFLNKLSPRPEVERIFVDLGSKGKPFLSLDQLMDFINRKQRDSRLNEVLYPPLKRDQVRQLMEKYETNTSQLERDQISLMSFTKYLGGEENTVVPPERLDIIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCRCIELDCWKGRPPEEEPIITHGFTMTTEIPFKDVIEAIAESAFKTSPYPLILSFENHVDSAKQQAKMAEYCRSMFGDALLIDPLDKYPLVPGQQLPSPQELLGKILIKNKK 470          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: plch1 (phospholipase C, eta 1 [Source:ZFIN;Acc:ZDB-GENE-060503-398])

HSP 1 Score: 320.472 bits (820), Expect = 4.606e-91
Identity = 251/750 (33.47%), Postives = 370/750 (49.33%), Query Frame = 2
Query:  803 NEKLVFQSLKELN--LPCEKT------ADVDPSQ--FTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYL-LTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDG-ALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQ-ETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSG-----TTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKK----------IGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEE--TGK-LIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITL 2959
            N + ++Q L ++N  LP  K       AD D  Q   TFE+F     M+  R D+  L    S+ KD+LT + +  FL   Q+   +               I++ +E++   K  G + ++ F  Y+ S           +++QDMDQP+ +Y+I SSHNTYLTG Q    S  DMY  VL AGCRCVE+DCWDG   D EP++ HG  + S I F+ VI  I   AFV + +PV LS ENHCS  QQ KIA++ +E+ G+ L + + + K   +    LPSP  LK KIL+K KRLP          +L       ++ E+++D      ED   L   +S        ++    +++ L      G K+   SFS        I + +   + G+ +    NS   + K +S +  S +  KHK++    KS  K         +S E E D Q      +   G     T  +   LS LV +   V         E   C ++ SFSE  A   + + A   + +N+ QLSRIYP   R+DSSNF PQ +WN GCQ+VALN+Q+    MQLN+ +F  N  SGY+LKP  M  S+ AF+P S+ P+         +KIISGQ L +            I  +VEV++ GLP D  +++  TRVV  NG NP++ E  +F      +P++A++R  V++    G+  +GQR +    L  G+RH+ L  EG      +S+F  IT+
Sbjct:  123 NMEEIYQLLHKMNVNLPRRKVKQMFQEADTDDQQGTLTFEEFTVFYKMMSLRRDLFLLLMCFSDKKDHLTAEELGNFLRVEQKMSSVTP--------ECCLDIINKFEVSEENKQNGVLGIEGFTNYMRSPACDVFNPQHHEINQDMDQPICNYFIASSHNTYLTGDQLLSHSKTDMYAWVLQAGCRCVEVDCWDGP--DGEPMVQHGYTLTSKITFKSVIETINKYAFVNNEFPVILSIENHCSIQQQKKIAQHLKEIFGDKLDVGEALNKDPKQ----LPSPNLLKGKILLKGKRLPS---------YLSADA---EEGEVSDDDSADEIEDDFKLKNSTSNGPSQHQVESHIRKKLDSLMKESQIGDKEDTDSFS--------IRALLRATHEGLQRNLRKNSKDGMKKSQSRSFISNL--KHKRH---SKSRLKC--------QSVETEDDSQQEPSGGQFNRGGRRRKTIKLSRDLSDLVVFTNSVA--SQECLDEGSPC-NVLSFSEARAQNLVHHRAERFLTFNQRQLSRIYPSAYRIDSSNFNPQTYWNVGCQLVALNYQTEGRMMQLNRAKFMVNGGSGYVLKPSLM--SKGAFNPLSDEPLPANPKKQLVIKIISGQQLPKPPDSMLGDRGEIIDPFVEVEIIGLPVDCCKEQ--TRVVDDNGFNPVWEETLSFTLH---MPEVALVRFLVWDHDPIGRDFVGQRTIAFSSLMPGYRHVYL--EG---MTEASIFVHITV 810          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Match: CABZ01072157.1 (pep chromosome:GRCz11:17:2348540:2386569:-1 gene:ENSDARG00000090381.3 transcript:ENSDART00000121614.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01072157.1)

HSP 1 Score: 306.99 bits (785), Expect = 5.880e-89
Identity = 153/300 (51.00%), Postives = 205/300 (68.33%), Query Frame = 2
Query: 2120 EKDDQTVGMNYRHTSGT-TNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVP-ANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDP 3013
            E+D++ +  +   T+G     +  +S+LVNY QP KF+ F    +K  CF +SSF ET     +  +A++ V YNK QLSRIYP+G RVDSSN+ PQ FW+AGCQ VALN+Q+ D  MQLN   FE+N  +GY+LK + MRRS++ FDPF +  +D +IA+T  +KI SGQFLS+K + T VEV++ GLP D  RK +RT++   ANG+NP + E+  F+F KV+LP++A LR+ V EE GK IG R++PLD LQTGF+HI LRSE N P  L SLF  I +  YVP  FA F DAL +P
Sbjct:  124 EQDEEKMKNSDEGTAGQEVTAYEEMSALVNYVQPNKFISFENAAKKNRCFVISSFVETKGESLIAKNAVDWVEYNKRQLSRIYPKGTRVDSSNYSPQPFWSAGCQFVALNYQTMDFPMQLNMALFEFNGRTGYLLKHDVMRRSDKKFDPFCDR-IDTIIASTLTIKIYSGQFLSDKAVKTGVEVELIGLPKDPKRK-YRTKMSSTANGINPDWNEEP-FIFEKVLLPEMAYLRLVVQEEGGKFIGHRIIPLDALQTGFQHIGLRSESNMPLMLPSLFVHIEMKDYVPAAFADFSDALFNP 420          

HSP 2 Score: 51.9878 bits (123), Expect = 7.043e-6
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 2
Query: 1514 QQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKR 1660
            QQ K+A YC  + G+ LL   ++K+ L+ G P+PSP +L  KILIKNK+
Sbjct:   12 QQEKMANYCRTIFGDALLIDLLDKYPLKPGQPIPSPSELMGKILIKNKK 60          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 275/485 (56.70%), Postives = 359/485 (74.02%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLD----MFLKGQT 1714
            +K+YEF W++ +P  ++ GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++ G   KD K+LS L+   K +  ++ + L +   +D VN+     + + +++   WV  L+S+ HN +A N+ PMT LKKHW++L  L N++ KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++PS FTF+KFY L   ICPRTD ++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++TYE +   K  G+IS   F RYLMSDENAPVFLDRL+L+Q+M+ PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI+D AFVTS YPV LSFENHCSK QQYK++KYCEE+ G+ LL+K +E H L+ G PLPSP  LK KILIKNKRL  E EK QL+    M   G+T
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEALKSMMEAGET 486          

HSP 2 Score: 533.487 bits (1373), Expect = 2.226e-164
Identity = 290/634 (45.74%), Postives = 405/634 (63.88%), Query Frame = 2
Query: 2039 HKKYLHEKKSSAKDLT---SLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLK-------SHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            H ++    + S+ DL+   +  +  + A   +D+Q    +Y++   TTN+HP+LSS++NYAQPVKF GF +  E+   F+MSSF+E+  LG++K  A+E VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y  D  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ P+ ++ N K+ K    +   T  + S ++      S T    +     K ++  LV +P                 +   + K I    K+  KE S +QK Q  ++++++        SH  + EK     G       KK+TEN++++ +      ++  +  ++ +E  ++       EQ L+ ++  Q  E   ++L  +   Q + L+L   RE KEM   Q K SME  + +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  511 HPEFKFGSELSSDDLSQKEAANIAKKGAITVEDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY-NDEPFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PADNTKNDKKGKTSNAKTNVTPQSSSEVR-----PSVTAAPGAGTENKKGKSSRLVSAP-------------AFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGASNCHEMKKETENKIQV-LTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1123          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 275/485 (56.70%), Postives = 359/485 (74.02%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLD----MFLKGQT 1714
            +K+YEF W++ +P  ++ GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++ G   KD K+LS L+   K +  ++ + L +   +D VN+     + + +++   WV  L+S+ HN +A N+ PMT LKKHW++L  L N++ KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++PS FTF+KFY L   ICPRTD ++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++TYE +   K  G+IS   F RYLMSDENAPVFLDRL+L+Q+M+ PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI+D AFVTS YPV LSFENHCSK QQYK++KYCEE+ G+ LL+K +E H L+ G PLPSP  LK KILIKNKRL  E EK QL+    M   G+T
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEALKSMMEAGET 486          

HSP 2 Score: 532.717 bits (1371), Expect = 7.669e-164
Identity = 285/603 (47.26%), Postives = 392/603 (65.01%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLK-------SHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HP+LSS++NYAQPVKF GF +  E+   F+MSSF+E+  LG++K  A+E VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y  D  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ P+ ++ N K+ K    +   T  + S ++      S T    +     K ++  LV +P                 +   + K I    K+  KE S +QK Q  ++++++        SH  + EK     G       KK+TEN++++ +      ++  +  ++ +E  ++       EQ L+ ++  Q  E   ++L  +   Q + L+L   RE KEM   Q K SME  + +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  555 EDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY-NDEPFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PADNTKNDKKGKTSNAKTNVTPQSSSEVR-----PSVTAAPGAGTENKKGKSSRLVSAP-------------AFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGASNCHEMKKETENKIQV-LTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1136          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 275/485 (56.70%), Postives = 359/485 (74.02%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLD----MFLKGQT 1714
            +K+YEF W++ +P  ++ GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++ G   KD K+LS L+   K +  ++ + L +   +D VN+     + + +++   WV  L+S+ HN +A N+ PMT LKKHW++L  L N++ KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++PS FTF+KFY L   ICPRTD ++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++TYE +   K  G+IS   F RYLMSDENAPVFLDRL+L+Q+M+ PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI+D AFVTS YPV LSFENHCSK QQYK++KYCEE+ G+ LL+K +E H L+ G PLPSP  LK KILIKNKRL  E EK QL+    M   G+T
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEALKSMMEAGET 486          

HSP 2 Score: 535.028 bits (1377), Expect = 1.505e-164
Identity = 286/614 (46.58%), Postives = 394/614 (64.17%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKI-------DMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQ-----------LQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HP+LSS++NYAQPVKF GF +  E+   F+MSSF+E+  LG++K  A+E VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y  D  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ P+ ++ N K+            G  SN K  +  +SS+          +VR  ++  +P    + K      ++  E L + K  +K  K+Q KE + L+K+ +KE + + K      +K+ +   K+K + H++  E  +K        +M + +  ++  LT  ++ +   +   H      +      + +      LSQ           +   Q + L+L   RE KEM   Q K SME  + +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  555 EDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY-NDEPFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PADNTKNDKK------------GKTSNAKTNVTPQSSS----------EVR-PSVTAAPGAGTENKKAIDIPQVKVEELKQMKAFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEK-VSHERTLEKSIKKKGASNCHEMKKETENKIQVLTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1142          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 275/485 (56.70%), Postives = 359/485 (74.02%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLD----MFLKGQT 1714
            +K+YEF W++ +P  ++ GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++ G   KD K+LS L+   K +  ++ + L +   +D VN+     + + +++   WV  L+S+ HN +A N+ PMT LKKHW++L  L N++ KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++PS FTF+KFY L   ICPRTD ++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++TYE +   K  G+IS   F RYLMSDENAPVFLDRL+L+Q+M+ PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI+D AFVTS YPV LSFENHCSK QQYK++KYCEE+ G+ LL+K +E H L+ G PLPSP  LK KILIKNKRL  E EK QL+    M   G+T
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEALKSMMEAGET 486          

HSP 2 Score: 533.102 bits (1372), Expect = 4.054e-164
Identity = 290/634 (45.74%), Postives = 405/634 (63.88%), Query Frame = 2
Query: 2039 HKKYLHEKKSSAKDLT---SLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLK-------SHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            H ++    + S+ DL+   +  +  + A   +D+Q    +Y++   TTN+HP+LSS++NYAQPVKF GF +  E+   F+MSSF+E+  LG++K  A+E VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y  D  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ P+ ++ N K+ K    +   T  + S ++      S T    +     K ++  LV +P                 +   + K I    K+  KE S +QK Q  ++++++        SH  + EK     G       KK+TEN++++ +      ++  +  ++ +E  ++       EQ L+ ++  Q  E   ++L  +   Q + L+L   RE KEM   Q K SME  + +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  511 HPEFKFGSELSSDDLSQKEAANIAKKGAITVEDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY-NDEPFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PADNTKNDKKGKTSNAKTNVTPQSSSEVR-----PSVTAAPGAGTENKKGKSSRLVSAP-------------AFLKQQKKQQKEIAALKKKHLKEHSVVQKLQCTQVDKIVAQFDKEKVSHERTLEKSIKKKGASNCHEMKKETENKIQV-LTSDHKSKVKDIVAQHTKEFTEMVKAQNAEEQTLRDVHLSQQCELLKELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1123          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:Xenbase;Acc:XB-GENE-982398])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 275/485 (56.70%), Postives = 359/485 (74.02%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLD----MFLKGQT 1714
            +K+YEF W++ +P  ++ GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++ G   KD K+LS L+   K +  ++ + L +   +D VN+     + + +++   WV  L+S+ HN +A N+ PMT LKKHW++L  L N++ KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++PS FTF+KFY L   ICPRTD ++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++TYE +   K  G+IS   F RYLMSDENAPVFLDRL+L+Q+M+ PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI+D AFVTS YPV LSFENHCSK QQYK++KYCEE+ G+ LL+K +E H L+ G PLPSP  LK KILIKNKRL  E EK QL+    M   G+T
Sbjct:    2 AKVYEFNWQKAVPSFMQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRYGAVPKDPKILSALEAVGKAEQELDGKILCVCCGTDLVNISFTYMVAESAELAKQWVEGLKSITHNFRANNVSPMTCLKKHWMKLTFLTNISGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPSAFTFDKFYELTQKICPRTDTEELFKKINGDKSDYLTVDQLVSFLNEHQRDPRLNEILFPFFDAKRAMQIIETYEPDEELKKAGQISSHGFCRYLMSDENAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKYQQYKMSKYCEEIFGDLLLSKALESHPLDTGRPLPSPNDLKRKILIKNKRLKAEVEKKQLEALKSMMEAGET 486          

HSP 2 Score: 523.472 bits (1347), Expect = 5.509e-161
Identity = 278/596 (46.64%), Postives = 378/596 (63.42%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HP+LSS++NYAQPVKF GF +  E+   F+MSSF+E+  LG++K  A+E VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y  D  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ P+ ++ N K+            G  SN K  +  +SS+          +VR  ++  +P    + K      ++  E L + K  +K  K+Q KE + L+K+ +K + +++  H+    ++          +  +  E Q   D++     E+L                                     ++L  +   Q + L+L   RE KEM   Q K SME  + +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  555 EDEQAWMASYKYVGATTNIHPFLSSMINYAQPVKFQGFKVAEERNIHFNMSSFNESVGLGYLKTHALEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY-NDEPFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PADNTKNDKK------------GKTSNAKTNVTPQSSS----------EVR-PSVTAAPGAGTENKKAIDIPQVKVEELKQMKAFLKQQKKQQKEIAALKKKHLK-VKDIVAQHTKEFTEM----------VKAQNAEEQTLRDVHLSQQCELLK------------------------------------ELLRGIHAQQMQQLKLTHDRESKEMKANQAKLSMENCKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1078          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 274/476 (57.56%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++     KD K+L+ L+   K+++++E R L +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  L N   KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ FT+EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G PLPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 553.518 bits (1425), Expect = 6.857e-172
Identity = 294/614 (47.88%), Postives = 407/614 (66.29%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRSIQEMLSLT-----------EKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S                   +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       +++ + +  ++ +LT            ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANPAKANVTPQSSSELR-----PTTTAALGSG-----------------QEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEIKKETEIKIQTLTTDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 274/476 (57.56%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++     KD K+L+ L+   K+++++E R L +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  L N   KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ FT+EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G PLPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 553.518 bits (1425), Expect = 6.857e-172
Identity = 294/614 (47.88%), Postives = 407/614 (66.29%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRSIQEMLSLT-----------EKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S                   +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       +++ + +  ++ +LT            ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANPAKANVTPQSSSELR-----PTTTAALGSG-----------------QEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEIKKETEIKIQTLTTDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 274/476 (57.56%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++     KD K+L+ L+   K+++++E R L +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  L N   KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ FT+EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G PLPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 509.99 bits (1312), Expect = 1.879e-157
Identity = 252/467 (53.96%), Postives = 332/467 (71.09%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK 3523
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S                   +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANPAKANVTPQSSSELR-----PTTTAALGSG-----------------QEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMK 984          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb4 (phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI:107464])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 274/474 (57.81%), Postives = 355/474 (74.89%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLD 1693
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++     KD K+L+ L+   K+++++E R L +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  L N   KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ FT+EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G PLPSP  LK KILIKNKRL  E EK QL+
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLE 475          

HSP 2 Score: 481.871 bits (1239), Expect = 9.386e-149
Identity = 219/329 (66.57%), Postives = 271/329 (82.37%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTS 3109
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+   TS
Sbjct:  555 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTS 882          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Match: Plcb1 (phospholipase C, beta 1 [Source:MGI Symbol;Acc:MGI:97613])

HSP 1 Score: 373.629 bits (958), Expect = 1.638e-107
Identity = 189/420 (45.00%), Postives = 260/420 (61.90%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAI--FEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHS 3442
            +S+LVNY QPVKF  F I  ++   F MSSF ET  L  +    +E V YNK QLSRIYP+G RVDSSN++PQ+FWNAGCQMVALNFQ+ DLAMQ+N G +EYN  SGY LKPEFMRR ++ FDPF+E  +DG++A T  VKIISGQFLS+KK+GTYVEVDM+GLP DT RK F+T+    N +NP++ E+   VF+KV+LP LA LRI  +EE GK IG R+LP+  ++ G+ +I LR+E N P  L ++F  I +  YVPD +A  ++ALS+P  +++  E + K +A +  E  E          + K+    E      ++   +  + G+N  +S      +           V +P K++D     +   E  T E L + K+ VK  K+  KE  +L KR  K+  EL+K H+
Sbjct:  540 MSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVW-EEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEE---------EVKKEADPGETSSEAPSETRTTPAENGVNHTASLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHT 949          

HSP 2 Score: 372.859 bits (956), Expect = 3.237e-107
Identity = 190/450 (42.22%), Postives = 277/450 (61.56%), Query Frame = 2
Query:  314 IPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIK---DEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKP-QQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILI 1648
            + + LKKG  F  +DD+  I+    +++ D  GFF  W  +  E  + D+ L+ D + G   K   D K+   L      ++E R + +    D VN+  L  +    ++   W   + S+  N+ A N+     L+K + +L L V    +IPLK + + F++ R  K V  +L+  +LP  +   +    FT + +   LN +CPR +I ++F+   ++ K YLT D+M+ F+N  QRDPRLNEILYP   +  VQ +++ YE N     +G++SVD F RYL  +EN  V  ++LDL++DM QPL+HY+INSSHNTYLT  Q  G SSV+MYRQVLL+GCRCVELDCW G+  ++EP+ITHG  M ++I F++VI AI +CAF TSP+P+ LSFENH   P QQ K+A+YC  + G+ LL +P+EK+ LE+GVPLPSP  L YKIL+
Sbjct:   18 VSDSLKKGTKFVKWDDDSTIV-TPIILRTDPQGFFFYWTDQNKETELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADR--KRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILV 464          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q15147|PLCB4_HUMAN (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 272/476 (57.14%), Postives = 357/476 (75.00%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+W+SE  E  V +  LI+ ++SG   KD K+L+ L+   K+++++E R + +   +D VN+     + ++ ++   WV  LRS+ HN +A N+ PMT LKKHW++L  + N N KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ F++EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G  LPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 558.14 bits (1437), Expect = 1.026e-172
Identity = 297/614 (48.37%), Postives = 408/614 (66.45%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S V                 +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       ++M + +   IQ + S        +  ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANTAKANVTPQSSSELR-----PTTTAALASGV-----------------EAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q9QW07|PLCB4_RAT (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus OX=10116 GN=Plcb4 PE=1 SV=2)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 273/476 (57.35%), Postives = 355/476 (74.58%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQD--KTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++ +P  L++GA+FD Y++E  + E NCL KVDEFGFFL+WKSE  E  V +  LI+ ++     KD K+L+ L+   K+++++E R L +   +D VN+     + ++ +I   WV  LRS+ HN +A N+ PMT LKKHW++L  L N + KIP++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ FT+EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQY+++KYCE++ G+ LL + +E H LE G  LPSP  LK KILIKNKRL  E EK QL+  
Sbjct:    2 AKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRLAAIPKDPKILAALESVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEITKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTSGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYQMSKYCEDLFGDLLLKQALESHPLEPGRLLPSPNDLKRKILIKNKRLKPEVEKKQLEAL 477          

HSP 2 Score: 553.132 bits (1424), Expect = 8.088e-171
Identity = 294/614 (47.88%), Postives = 407/614 (66.29%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   +  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + S                   +  K   +  ++  E L + K  +K+LK+Q KE ++L+K+  KE + + K H    +K+ +   K+KS  H+K  E  MK       +++ + +   IQ + S        +  ++ +E +++   H   EQ ++ L+  Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  543 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQLRAMGIETSDIADV-PSDTSKNDKKGKANPAKANVTPQSSSELR-----PTTTAALGSG-----------------QEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKST-HEKILEKAMKKKGGSNCLEIKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 1131          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q07722|PLCB4_BOVIN (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (Fragment) OS=Bos taurus OX=9913 GN=PLCB4 PE=1 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 1.011e-173
Identity = 294/614 (47.88%), Postives = 406/614 (66.12%), Query Frame = 2
Query: 2123 KDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMK-------IDMNQRS---IQEMLS--------LTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +D+Q    +Y++   TTN+HPYLS+++NYAQPVKF GF++  E+   ++MSSF+E+  LG++K  AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWN+GCQMV+LN+Q+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+S FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF   VDALSDP+  +S  E +   M  MG ETS+I D+ PS +S N K+ K    +   T  + S ++      ++T  + + +                 +  K   +  ++  E L + K  +K+LK+Q KE S+L+K+  KE + + K H    +K+ +   K+K + H+K  E  MK       ++M + +   IQ + S        +  ++ +E + +   H   EQ ++ L   Q  E   K+L      Q + L+L   RE KEM   Q K SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MK ++
Sbjct:  391 EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNSGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEES-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADV-PSDTSKNDKKGKANTAKANVTPQSSSELR-----PTTTAALGAGL-----------------EAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELSSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEK-LTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSDMINTHSAEEQEIRDLLLSQQCELLRKLLISAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSK 979          

HSP 2 Score: 440.654 bits (1132), Expect = 1.834e-131
Identity = 203/313 (64.86%), Postives = 248/313 (79.23%), Query Frame = 2
Query:  764 PLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            P++ + +TFASG+ EK++FQ+LKEL LP  K  +++P+ FT+EKFY L   ICPRTDI+DLF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K QG IS D F RYLMSDENAPVFLDRL+L+Q+MD PLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLLAGCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSK QQYK++KYCE++ G+ LL + +E H LE G PLPSP  LK KILIK +    E EK QL+  
Sbjct:    1 PVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKQGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKKQTTETEVEKKQLEAL 313          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|P13217|PIPA_DROME (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=norpA PE=1 SV=4)

HSP 1 Score: 525.013 bits (1351), Expect = 2.121e-161
Identity = 257/494 (52.02%), Postives = 351/494 (71.05%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFD-FYDDEL----NILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNI---EDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLE 1735
            +K YEF W   +P EL  G +FD ++++E     N  E + L KVDE+GFFL WKSE  +  V ++  +SD+++G   KD K+L ++  K  +NI   + R+L I  N+D++N+     I  D+     W  +LR + HN +A N+CP   L KHW+RL   V  + KIP+K +AKTFASG+ EKLV+  +K+  LP +K A +   QFTF+KFY L + +CPR DI++LF S+++GK D+++ ++ I+F+N+ QRDPR+NEILYP         I++ YEL+  +K   ++S+D F RYLMSDENAPVFLDRLD + +MDQPLAHYYINSSHNTYL+GRQ  GKSSV+MYRQ LLAGCRCVELDCW+GKG+D+EPI+THG A C++ILF+D I AI DCAFV+S YPV LSFENHC++ QQYK+AKYC++  G+ LL +P+  H L+ G+PLP P KLK KILIKNKR+  E EK++L+++LKG+     D E
Sbjct:    2 TKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKSWQKNLRLITHNNRATNVCPRVNLMKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPE 495          

HSP 2 Score: 467.233 bits (1201), Expect = 2.383e-140
Identity = 245/585 (41.88%), Postives = 352/585 (60.17%), Query Frame = 2
Query: 2156 HTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            ++  TTNVHP+LSS+VNYAQP+KF GF+   EK    +MSSF+E+A + ++K  +I+ VNYNK Q+SRIYP+G R DSSN++PQ+FWNAGCQMV+LNFQSSDL MQLNQG+FEYN   GY+LKP+FMRR+++ FDPF+++P+DGVIAA C VK+I+GQFLS+KK+GTYVEVDM+GLP+DT++KEFRTR+V  NGLNP+Y ED  FVFRKV+LPDLAVLR GV+EE+GK++GQR+LPLDGLQ G+RH+SLR+E NFP +L  LF  I L  YVPDGF  F+  LSDPR      + + + M  +G E                                         Q     +      + + +   LV+ P   +  + +  F+++  + + E  T+    K+  KE +++QK Q   I++L+K    S + + +    + SI  + K    M I  +++   +ML    ++ Q+  K                          ++  +Q  Q K L     R++K+++ +Q K S +  + V  D   + K E+DRRLRE    N KRF+++++   +K  R
Sbjct:  539 YSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDP-FVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIE----------------------------------------EQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTL---RKKHAKERTSVQKTQNAAIDKLIKGK--SKDDIRNDANIKNSINDQTKQWTDM-IARHRKEEWDMLRQHVQDSQDAMKA-------------------------LMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGR 1051          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Match: sp|G5EBH0|PLCB_CAEEL (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans OX=6239 GN=egl-8 PE=1 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 2.266e-144
Identity = 244/528 (46.21%), Postives = 341/528 (64.58%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQS-NIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTA-----------------------------DVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQ-EPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGED 1771
            +K ++F W+  I  EL  G++FD YDDE   LE+N  V++DE GFFL W  E  +A V DM  I + ++G   KD +++ +L+ +  S  I +RT+ I+   D VN+ +   + +  ++       +  +  + +  ++CP TQL K+   L + VN   KIP+KL+ KTF+SG+ EK+V + L +L L  +K                               ++D    TFEKF  L N ICPRT++Q+LF  LS  K+YLT +R+I FLNE QRDPRLNEIL+P+ +   +  +L  +E +   +  G++S D F R+LMSDEN PVFLDR+++  DMDQPL HYYINSSHNTYLTGRQ+ GKSS ++YRQVLL+GCRC+ELDCWDG G+++ EPIITHGKAMC+D+ F+DV+  IRD AF  S +PV LSFENHCSK  Q K+AKYC ++ G+ LL+KP E   L+ GV LPSP +L+ KILIKNKRL  + E+ QLD FL+ +  L ++ E+ E P+++ GED
Sbjct:    2 AKEFQFNWKPTIIPELLHGSVFDRYDDESTCLELNAQVRIDENGFFLRWLIEGKDAVVLDMGQIWEARTGGLPKDGRIMFELEQRGASETIAERTIWITHGQDLVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQLMKYHTWLTMNVNERRKIPIKLIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPARVINRSMGKKFRNFYKCSRGRKRKEREELDVDILTFEKFQRLYNKICPRTEVQELFVKLSGQKEYLTKERLINFLNEEQRDPRLNEILFPFFDSQRIVALLKKHENDIKYQEDGKMSGDGFLRFLMSDENPPVFLDRIEMFMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPIITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVVLSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFEDAPLDPGVSLPSPNRLRKKILIKNKRLKTDIERHQLDQFLR-EGKLDEEDELNETPEVV-GED 527          

HSP 2 Score: 461.455 bits (1186), Expect = 2.506e-135
Identity = 233/440 (52.95%), Postives = 310/440 (70.45%), Query Frame = 2
Query: 2120 EKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSS-LFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQST-DGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLK 3433
            +++++ +   Y +T  TTN+HP LSSLVNY  PVKF GF++       FHMSSFSE+  LG++K  A E VNYNK Q SRIYP+G RVDSSNFLPQIFWNAGCQMV+LNFQ+ D+ MQLN G+FEYN  SGY+LKP+F+RR +R FDPFSESP+DGVIAA C V++ISGQFLS++KIGTYVEV+MYGLPTDTIRKE +T+V+P NGLNP+Y ED  FVFRKV+LP+LAVLR  V++E GK +GQR+LPLDGLQ G+RHISLRS+ N    LS  LF +I + TYVPD  +  VDAL+DPRA +S ++ + + +A+MG + S+I D+ P+T ++  +  K+   +  S+ D   +N + G  +   T+ + S+     +R+ N    P     FK D I  E+  + L   K   K LKR  KE  +L+K+  K+ + + K
Sbjct:  735 KEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEANNLHFHMSSFSESTGLGYLKQSAPEFVNYNKRQSSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDRTFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDP-FVFRKVVLPELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSEQKKRQEALAHMGVDDSDIPDV-PNTRNMALRHVKQPPRQNGSSADLLANNGQTGSARGDQTSSMASST----IRSPNEQPQPVAVDKFKVDPI--EV--DDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQK 1164          

HSP 3 Score: 56.9954 bits (136), Expect = 2.107e-6
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 3671 KVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            K++S+ Q  Q   L+L  + E K++   QTK SME  +++  D   + KAERDRR++EL + N K F+++R+   MK  +
Sbjct: 1308 KLMSEAQKNQMLALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEKNLKMFVEERKRLAMKAQK 1387          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A4Z2CYF8 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Schistosoma japonicum OX=6182 GN=EWB00_006501 PE=4 SV=1)

HSP 1 Score: 1308.51 bits (3385), Expect = 0.000e+0
Identity = 656/1227 (53.46%), Postives = 855/1227 (69.68%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDL-EIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGM-NYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKK-KTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            MTSDIAKRQRTVPS+K +EF W+R +PE L+ G  FD YD+E  ILE NC V+VD+ GFF+ W+SE +++   ++  ISDV+SG K KDEK+ +Q+Q+++  +  DR + I    D VN++    + KD +  +FW+ SLRS+ HN KAAN+CPMTQL+KHWLRL L VN  N+IP++++ KTFASGRNE++V+QSLK+LNLP  K  D+DP++F FEKFY L + ICPRTDI+DLF SLS+GK+++  D+MI FLNETQRDPRLNEILYP++N+ +++YI + YE     K+  EIS++CFYRYLMSD+NA VFLD+LD++QDMDQPL+HYYINSSHNTYL GRQF GKSSV++YRQVLLAGCRC+ELDCWDG+G+DQEPIITHGKAMCSDILF+DVIYAIRD AFV S  PV +SFENHCSK QQYK+AKYCEE+LG+ LLTKP++ + LE GVPLP PEKLK KILIKNKRL  E EK QL++FLKGQTD  Q+  E+ EDPDL    D                                             VP     N ++    IG    +T               S   +   + L    SSA +L  L +  E   +  +++ + M +Y +T  T+++HP LSS +NYAQPVKF GF++  ++    HMSSFSET ALG +KN AIE VNYNK Q+SRIYPRGNRVDSSN++PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN N GY+LKPEFMRR ER FDPFSESPMDGVIAATCEVKIISGQFLS++K+GTYVEVDMYGLPTDTIRKEFRTRVVP NGLNP+Y +D+ FVFRKV+LPDLAVLR  V+E+TGKLIGQRVLPLDGLQ G+RHISLR+EGNFP +L +LFC+++L+TYVP+G    VDALSDPRA +S+EE ++K +A+MG ++SEI D+ PST   N K+    +    ++     +    ++       ++SN  +   + ++  + P      + D I++              K +K+Q KE   LQKRQ K+   +L++H++ T+KL +   K++S   +    EN     +      +M  L  ++  + + L    +    +L L      K+  +K++ ++Q  Q++ LR++Q REVKEM  QQTK+S+E++R V+ D   RNKAERDRR+REL DYN KRF+DQR+ Q  +H++
Sbjct:    1 MTSDIAKRQRTVPSAKAFEFIWKRPVPEVLQSGEHFDRYDEEAGILEPNCFVRVDKDGFFIYWQSENNDSQQLELSQISDVRSGTKPKDEKLTAQIQERSGKSW-DRIVTICSGLDLVNINYTHMVAKDVETASFWIQSLRSLTHNTKAANVCPMTQLRKHWLRLTLTVNARNRIPVRVIMKTFASGRNERIVYQSLKDLNLPHGKNDDIDPNEFPFEKFYELYHKICPRTDIEDLFKSLSKGKNHIHADKMIEFLNETQRDPRLNEILYPFANKQTIKYIQENYETQEEFKNTDEISIECFYRYLMSDDNACVFLDKLDIYQDMDQPLSHYYINSSHNTYLIGRQFGGKSSVEIYRQVLLAGCRCIELDCWDGRGEDQEPIITHGKAMCSDILFKDVIYAIRDTAFVASDCPVIMSFENHCSKQQQYKLAKYCEEILGDMLLTKPLDNYPLEPGVPLPPPEKLKRKILIKNKRLKPEAEKQQLELFLKGQTDAIQEENEVTEDPDLTIDRDDG-----------------------------------------DGVPGNKPNNGDLSSTTIGGGGSDTTI-------------SLSTIPTPQTLSTCTSSA-ELKRLQLKKEEGNLTAEEEQIMMAHYHYTGATSSIHPLLSSFINYAQPVKFQGFDVAEDENIHHHMSSFSETMALGLLKNQAIEFVNYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRPERQFDPFSESPMDGVIAATCEVKIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGDDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQAGYRHISLRTEGNFPLSLPTLFCQVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADV-PSTG--NAKRVGGVVGGSGTSGQLSGSALSSVSGSGDVANVSSNSTKKDDKKDDPKFDPISISLLQTDKIYQ--------------KLIKKQAKELEILQKRQEKDAVTMLRNHTIITDKLNTSHAKERSSTKRSINKENGQNAALEDTHRNQMCELVRQHTDQWSNLKSTQMKEVYDLVLSFFDTRKDLLVKIMKEVQEEQKRELRIIQDREVKEMKAQQTKASIESSRSVMNDRKLRNKAERDRRIRELNDYNTKRFIDQRKLQAQRHDK 1154          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A074ZXA5 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Opisthorchis viverrini OX=6198 GN=T265_05106 PE=4 SV=1)

HSP 1 Score: 1298.88 bits (3360), Expect = 0.000e+0
Identity = 657/1228 (53.50%), Postives = 839/1228 (68.32%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDL-EIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMV--GDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHK-KKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            MTSDIAKRQRTVPS+K +EF WRR +P+ L+ GA FD  D+E   LE +C V+VD  GFF+ WK+E S++ + ++  ISDV++G K K+EK+++Q+Q++      DR + I    D VN+     I  + +   +W+  LRS+ HN KA N+CPMTQL+KHW+RL L VN  NKIP++++ KTFASGRNE++VFQSLKEL LP  K   ++P+ F FEKFY L + ICPRTDI+DLF SLS   D L  D+MI FLNETQRDPRLNEILYP++NR +++YI + YE     K+   +S++CFYRYLMSD NA VFLDRLD++Q+MDQPL+HYYINSSHNTYL+GRQF GKSSV+MYRQVLLAGCRC+ELDCWDG+G+DQEPIITHGKAMC+DILF+DVIYAIRD AFVTS YPV +SFENHCSK QQYK+AKYCE++LG+ LLTKPI+   LE G PLP PEKLK KILIKNKRL  E EK QL++FLKGQTD  Q+  +IAEDPDL    DG                                        F S + + P   S   E+    L  E+   S      SSN  +              SS+ DL  L +  G+ +AE   ++Q + + Y+HT  T+++HP LSS +NY QPVKF GF++  EK   FHMSSFSET +LG MKN AIE VNYNK Q+SRIYPRGNRVDSSN++PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN N GY+LKPEFMRR ER FDPFSESPMDGVIAATCEVKIISGQFLS++K+GTYVEVDMYGLPTDTIRKEFRTRVVP NGLNP+Y ED+ FVFRKV+LPDLAVLR  V+EETGKLIGQRV+PLDGLQ G+RHISLR+EGNFP +L +LFC++ L+TYVP+G    VDALSDPRA +S+EE ++K +A+MG ++SEI D+ P+T++     +            T++    G  +E                                   F+ I+   L   K   K LK+Q+KE   +Q+RQ K+   +L++H++ T+KL +   K++S   +  K EN     +      ++  L  +   +   L    +    +L L   +  KE  L+++ ++Q  Q++ LR+VQ+REVKEM  QQTK+S+E++R V+ D   +NKAERDRR+REL DYN KRF+DQR+ Q  + ++
Sbjct:    1 MTSDIAKRQRTVPSAKAFEFNWRRPVPDVLQNGAFFDRLDEETGTLETDCFVRVDPDGFFIYWKTENSDSQLLELSQISDVRAGSKPKEEKLIAQIQERGPGKSWDRIVTICSGLDLVNIIYTHMIAPEPETAAYWIQQLRSLTHNTKAVNVCPMTQLRKHWIRLTLSVNPKNKIPVRVIMKTFASGRNERVVFQSLKELGLPHGKNDVIEPAAFPFEKFYELYHKICPRTDIEDLFKSLSNNTDVLHADKMIEFLNETQRDPRLNEILYPFANRQTIKYIQENYETQEEYKNTDMLSIECFYRYLMSDNNACVFLDRLDVYQEMDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQVLLAGCRCIELDCWDGRGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEYPVIMSFENHCSKHQQYKLAKYCEDILGDMLLTKPIDGFPLEPGAPLPPPEKLKRKILIKNKRLKPEAEKQQLELFLKGQTDAIQEENDIAEDPDLTVDVDG---------------------------------------KFGSLLLHEPSARSCYSESGTKGLNGESGLSS------SSNTPAP---------PSGGSSSADLKRLQMKKGNLTAE---EEQMMMVQYQHTGATSSIHPLLSSFINYVQPVKFQGFDVAEEKNLHFHMSSFSETISLGLMKNQAIEYVNYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRLERQFDPFSESPMDGVIAATCEVKIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGEDAVFVFRKVVLPDLAVLRFAVYEETGKLIGQRVIPLDGLQAGYRHISLRTEGNFPLSLPTLFCQVNLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADV-PTTTAKRTPASGAAAASGPPGAATEAGDASGAKKEEKKDD----------------------------PKFDPISLSLLQTDKNYQKLLKKQSKELELVQRRQDKDATAMLRNHTVVTDKLNTTHAKERSSTKRPSKKENGQSSVLEATQKSQLCELMRQQADQWTNLKVAQMKEICDLVLGYIEVRKELLLRIMKEVQEEQKRELRIVQEREVKEMRAQQTKASIESSRSVMNDRKLKNKAERDRRIRELNDYNTKRFIDQRKIQAQRQDK 1142          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A4S2KEP2 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Opisthorchis felineus OX=147828 GN=CRM22_011021 PE=4 SV=1)

HSP 1 Score: 1294.64 bits (3349), Expect = 0.000e+0
Identity = 653/1226 (53.26%), Postives = 836/1226 (68.19%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDL-EIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHK-KKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            MTSDIAKRQRTVPS+K +EF WRR +P+ L+ GA FD  D+E   LE +C V+VD  GFF+ WK+E +++ + ++  ISDV++G K KDEK+++Q+Q++      DR + I    D VN+     I  + +   +W+  LRS+ HN KA N+CPMTQL+KHW+RL L VN  NKIP++++ KTFASGRNE++VFQSLKEL LP  K   ++P+ F FEKFY L + ICPRTDI+DLF SLS   D L  D+MI FLNETQRDPRLNEILYP++NR +++YI + YE     K+   +S++CFYRYLMSD NA VFLDRLD++Q+MDQPL+HYYINSSHNTYL+GRQF GKSSV+MYRQVLLAGCRC+ELDCWDG+G+DQEPIITHGKAMC+DILF+DVIYAIRD AFVTS YPV +SFENHCSK QQYK+AKYCE++LG+ LLTKPI+   LE G  LP PEKLK KILIKNKRL  E EK QL++FLKGQTD  Q+  +IAEDPDL    DG  +                         + +      R  +S S                G+  +   S S  T    S   S+  +K    L  KK           G+ +AE   ++Q + + Y+HT  T+++HP LSS +NY QPVKF GF++  EK   FHMSSFSET +LG MKN AIE VNYNK Q+SRIYPRGNRVDSSN++PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN N GY+LKPEFMRR ER FDPFSESPMDGVIAATCEVKIISGQFLS++K+GTYVEVDMYGLPTDTIRKEFRTRVVP NGLNP+Y ED+ FVFRKV+LPDLAVLR  V+EETGKLIGQRV+PLDGLQ G+RHISLR+EGNFP +L +LFC++ L+TYVP+G    VDALSDPRA +S+EE ++K +A+MG ++SEI D+ P+T++     +            T++    G  +E                                   F+ I+   L   K   K LK+Q+KE   +Q+RQ K+   +L++H++ T+KL +   K++S   +  K EN     +      ++  L  +   +   L    +    +L L   +  KE  L+++ ++Q  Q++ LR+VQ+REVKEM  QQTK+S+E++R V+ D   +NKAERDRR+REL DYN KRF+DQR+ Q  + ++
Sbjct:    1 MTSDIAKRQRTVPSAKAFEFNWRRPVPDVLQNGAFFDRLDEETGTLETDCFVRVDPDGFFIYWKTENTDSQLLELSQISDVRAGSKPKDEKLIAQIQERGPGKSWDRIVTICSGLDLVNIIYTHMIAPEPETAAYWIQQLRSLTHNTKAVNVCPMTQLRKHWIRLTLSVNPKNKIPVRVIMKTFASGRNERVVFQSLKELGLPHGKNDVIEPAAFPFEKFYELYHKICPRTDIEDLFKSLSNNTDVLHADKMIEFLNETQRDPRLNEILYPFANRQTIKYIQENYETQEEYKNTDMLSIECFYRYLMSDNNACVFLDRLDVYQEMDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQVLLAGCRCIELDCWDGRGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEYPVIMSFENHCSKHQQYKLAKYCEDILGDMLLTKPIDGFPLEPGASLPPPEKLKRKILIKNKRLKPEAEKQQLELFLKGQTDAIQEENDIAEDPDLTVDVDGKFD-------------------------WLLLHGPSARACYSES-------------GTKGLNGESGLSSSSNTPAPPSGGSSSADLKR---LQMKKEE---------GNLTAE---EEQIMMVQYQHTGATSSIHPLLSSFINYVQPVKFQGFDVAEEKNLHFHMSSFSETISLGLMKNQAIEYVNYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRLERQFDPFSESPMDGVIAATCEVKIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGEDAVFVFRKVVLPDLAVLRFAVYEETGKLIGQRVIPLDGLQAGYRHISLRTEGNFPLSLPTLFCQVNLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADV-PTTTAKRTPASGVAAASGPPGAATEAGDASGAKKEEKKDD----------------------------PKFDPISLSLLQTDKNYQKLLKKQSKELELVQRRQDKDATAMLRNHTVVTDKLNTTHAKERSSTKRPSKKENGQSSVLEATQKSQLCELMRQQADQWTNLKVTQMKEICDLVLGYIEVRKELLLRIMKEVQEEQKRELRIVQEREVKEMRAQQTKASIESSRSVMNDRKLKNKAERDRRIRELNDYNTKRFIDQRKIQAQRQDK 1144          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A0X3P0N3 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Schistocephalus solidus OX=70667 GN=TR168281 PE=4 SV=1)

HSP 1 Score: 1287.71 bits (3331), Expect = 0.000e+0
Identity = 649/1230 (52.76%), Postives = 849/1230 (69.02%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDK-TQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTD-LTQDLEIAEDPDLIA---GEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKS-IMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            M+SDIAKRQRTVPS+K+Y+F WRR +P  L++GA FD +D+E  I+E+ C ++VDE GFFL WKSE +E  V ++  +SDV+ G K KDEKV+S L ++     +++R + +    D VN+    F+    ++  +W+ S+R + HN KA N+CPMTQL+KHWLR+ L VN   KIP+++V KTFASGRNE+++FQSLKEL LP  K  +V+PS+FTFE+FY L + ICPRTDI++LF SLS GK  +++++M+ FLNE QRDPRLNEILYPY+NR +++YI + YE      SQ  ++++CFYRYLMSD+NAPVFLDRLD++QDMDQPL HYYINSSHNTYL GRQF GKSSV++YRQVLLAGCRC+ELDCWDGKGDDQEPIITHGKAMC+DILF+DVIYA+RD AFVTS  PV +SFENHCSK QQ+K+AKYCE++LG+ LLTKPI+KH LE G PLPSPEKLK KIL+KNKRL  + EK QL++FLKGQTD + ++ E ++  D IA   GE G LN                                        ++P  P+      E      K    S + I  +  S   S++  +  +   ++  + K+  SL V +E A + +        Y +T  TT +HP LSS+VNYAQ VKF GF++  E+   FH+SSF+E  ALG +K    E V YNK Q+SRIYPRGNRVDSSN++PQIFWNAGCQMVALNFQ+ DLAMQLNQGRFEYN N G++LKPEFMRR ER FDPFSESPMDGVIAATCEV+IISGQFLS++K+GTYVEVDMYGLPTDTIRKEFRTRVVP NGLNP+Y ED+ FVFRKV+LPDLAVLR  V+E+TGKLIGQRVLPLDGLQ+G+RHISLR+EGNFP +L +LFC+++L+TYVP+G    VDALSDPRA +S+EE ++K +A+MG ++SEI D+  +T SL +        R   T  +      GI++ + T+   SNV            + +K ++ ++D  F  I+   L   K   K +K+Q K+   L++R  KE + +L++H++ T+KL +   K  + I    +  N +   +      EM  L  +   + + L    +    +L L      KE  LKVL +    Q++ L+ +Q+RE KEM  QQTK S+E+NR V+ D   +NKAERDRR+REL DYN KRF+DQR+AQ  ++ R
Sbjct:    1 MSSDIAKRQRTVPSAKVYDFVWRRPVPPALREGAYFDRFDEETGIVELGCFLRVDEDGFFLFWKSEANEGQVLELSQVSDVRQGCKPKDEKVVSILTERFANRPLDERVMTVCSGLDLVNISYTNFVASTPEVAAWWIQSVRGLTHNTKAQNVCPMTQLRKHWLRITLTVNPRGKIPVRVVTKTFASGRNERIIFQSLKELGLPSGKNDEVEPSEFTFERFYELYHKICPRTDIEELFKSLSNGKPTISHEKMMEFLNEVQRDPRLNEILYPYANRQTIRYIQEAYEPQEKSASQDGLTLECFYRYLMSDDNAPVFLDRLDIYQDMDQPLCHYYINSSHNTYLIGRQFGGKSSVEIYRQVLLAGCRCIELDCWDGKGDDQEPIITHGKAMCTDILFKDVIYAVRDTAFVTSDCPVIMSFENHCSKHQQFKLAKYCEDILGDLLLTKPIDKHPLEPGYPLPSPEKLKRKILVKNKRLTPDVEKHQLELFLKGQTDPIQEETESSDLADTIACVDGEVGPLN------------------------------------DLDPTMPPKPLDIDPHPET-----KSRPGSGTTINTLSPSG--SSLPCRLSEAEMKRLVNKKEEGSLTVEEEQAMLAQ--------YHYTGATTAIHPLLSSMVNYAQAVKFQGFDVAEERNLSFHVSSFNENRALGLIKCYCTEFVVYNKRQMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGRFEYNGNCGFLLKPEFMRRPERQFDPFSESPMDGVIAATCEVRIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGEDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQSGYRHISLRTEGNFPLSLPTLFCRVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMGIDSSEIADVPATTKSLKRSGQS----RVGVTVNSSCPSSCGIDRPAGTSTSASNV------------NSSKKEEKREDPKFPGISLGMLRNDKNYRKLVKKQAKDLELLRRRHEKEASTMLRAHTILTDKLNAAHAKASAGIKAAAQKSNGVNSQLKDLQKSEMSDLVRQQTDQWSSLKAQQMKEVHHLVLTFMDARKELLLKVLREAHEDQKRELKQIQERENKEMKAQQTKISIESNRTVLGDRKLKNKAERDRRIRELNDYNTKRFIDQRKAQAQRNER 1163          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Match: A0A0R3U5L3 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2018 PE=4 SV=2)

HSP 1 Score: 1281.93 bits (3316), Expect = 0.000e+0
Identity = 660/1295 (50.97%), Postives = 855/1295 (66.02%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQS---NIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQ-DLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKL---------------------------MANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGI--------------------------NQESSTTKINS------NVYQIKVRNENLVYSPNKSK--DFK-DDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQ-----KSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            M+SDIAKRQRTVPSSK Y+F WRR +P  L++G  FD +D+E   LE+ C ++VDE GFFL WKS+ +E  V ++  +SDV+ G+K KDEK+++ L ++  S   N+++  + +    D VN+    F+    ++ + W+ S+R + HN KA N+CPMTQL+KHWLRL L VN   KIP+++V KTFASGRNE+++FQSLKEL LP  K  +V+PS+FTFE+FY L + ICPRTDI++LF +LS GK+ LT ++MI FLNE QRDPRLNEILYPY+NR +++YI +TYE      S   +S+  FYRYLMSD+NAPVFLDRLD+ QDMDQPL HYYINSSHNTYL GRQF GKSSV++YRQVLLAGCRC+ELDCWDGKG+DQEPIITHGKAMCSDILF+DVIYA+RD AFVTS YP+ +SFENHCSK QQYK+AKYCE++LG+ LLTKP++K+ LEAGVPLPSPEKLK KILIKNKRL  + EK QL++F+KGQ D  Q D ++AEDPD +   D  +  ++                       +I    +T+    S   N    +  +  + IG L  ET     ITK  S  AE                                   ++Q +   Y +T  T  +HP LSS+VNYAQPVKF GF++  ++   +HMSSFSET ALG MKN+AIE VNYNK Q+SRIYPRGNRV+SSN++PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN N GY+LKPEFMRR ER FDPFSESPMDGVIAATCEV+IISGQFLS++K+GTYVEVDMYGLPTDTIRKEFRTRVVP NGLNP+Y ED+ FVFRKV+LPDLAVLR  V+E+TGKLIGQRVLPLDGLQ+G+RHISLR+EGNFP +L +LFC+++L+TYVP+G    VDALSDPRA +S+EE ++K                            +A+MG ++SEI D+  S++ L     ++ +     ++   +N   G+                          +Q+S+ + + S          + V       S N +K  D K +D  F  I+   L   K   K +K+Q KE   LQ+R  KE   +L++H+L T+KL S   K       S+    +  N +   M +  I +M  L  +   E +KL +  +N    L L      K+  LK+L      Q++ L+ +Q+RE K+M  QQ K S+++NR V+ D   +NKAERDRR+REL DYN KRF+DQR+AQ  +++R
Sbjct:    1 MSSDIAKRQRTVPSSKAYDFVWRRPVPAALREGTYFDRFDEETGTLELGCFLRVDEDGFFLFWKSDVNEGQVLELSQVSDVRHGMKPKDEKLVATLTERVSSIGKNLDEHIVTVCSGLDLVNISYTNFVATSPEVASLWIQSVRGLTHNTKAQNVCPMTQLRKHWLRLTLTVNPRGKIPVRVVTKTFASGRNERIIFQSLKELGLPSGKNDEVEPSEFTFERFYELYHKICPRTDIEELFKTLSNGKETLTIEKMIEFLNEVQRDPRLNEILYPYANRQTIRYIQETYESRDENTSSDTLSLKGFYRYLMSDDNAPVFLDRLDICQDMDQPLCHYYINSSHNTYLIGRQFGGKSSVEIYRQVLLAGCRCIELDCWDGKGEDQEPIITHGKAMCSDILFKDVIYAVRDTAFVTSDYPLIMSFENHCSKHQQYKLAKYCEDILGDMLLTKPLDKYPLEAGVPLPSPEKLKRKILIKNKRLEPDVEKHQLELFMKGQADPVQEDDDVAEDPDPVVTPDCDVGPMNG----------------------DIDPHPETKLRPGSGQINVLSTSLPLSSSLIGKL-SETEMKRLITKKGSLTAE-----------------------------------EEQAMLAQYHYTGATKTIHPLLSSMVNYAQPVKFQGFDVAEDENVHYHMSSFSETVALGLMKNEAIEFVNYNKRQMSRIYPRGNRVESSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKPEFMRRPERQFDPFSESPMDGVIAATCEVRIISGQFLSDRKVGTYVEVDMYGLPTDTIRKEFRTRVVPNNGLNPVYGEDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQSGYRHISLRTEGNFPLSLPTLFCRVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQVGILLEPVALLLLHMFTIPISVTSHLKLASMGIDSSEIDDVPTSSTKLAAMLKQRPMGMGNLSNAPSANSAAGLLPSGVGSVAAASSAGLTLPGVGASADHQKSTGSTVVSPSANPLTSGGVGVSGATSGPSANSAKKEDKKAEDPKFPPISLSMLRSDKNYRKLVKKQAKELEALQRRHEKEAAAMLRAHTLLTDKLNSSHAKAIASSTSSLRSTPQKMNGINTPMKEAHIAQMNDLVRQQTDEWSKLKYTQMNEIHGLVLTFMDARKDLLLKILRDAHDEQKRLLKQIQERENKDMKAQQIKISLDSNRNVMNDPRLKNKAERDRRIRELKDYNTKRFIDQRKAQAQRNDR 1237          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:103022380])

HSP 1 Score: 1145.57 bits (2962), Expect = 0.000e+0
Identity = 604/1231 (49.07%), Postives = 810/1231 (65.80%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINR-LKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMH-------KKKTENQMKIDMNQRSIQ----------EMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +K YEF W++++P+ L++GA+FD  D++  + E +CL KVDEFGFFL+WKSE  E  V +  LI+ V+ G   KD K+LS L+   K ++++E   + +    D VNL  +  +  ++     W+  L+SV HN KA N+CPMT LKKHW+RL  L NVN KIP++ + +TF SG+ EK +FQ+LKEL LP  K  ++D S FTF+ FY L   ICPRTDI++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +   V  I++ YE +   K +G +S D F RYLMSDENAPVFLDRLD+ QDMDQPLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLL+GCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSKPQQYK+AKYCE++ GE LL +P+E   +E   PLPSP  LK KILIKNKRL  E E+ QL+ F +                    E G ++V   +D++++D +     E+N  +K+         + +  +SV    I +  I E +                 E++ A+ T +           S A DL +   G ++ E    +Q +  +Y++   TTN+HPYLS++VNYAQPVKF  F I  EK    +MSSF+E+  LG++K +AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN   GY+ KP+FMRRS+R FDPFSE+P+DGVIAATC V++ SGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP Y E+  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF + VDALSDP+  +S  E +   M  +G ETS+I D+ P+ SS N K+ K   ++   T  T S+M     Q S+ T+ NS                  S+  KD A+  ++T E L + K+ VK +K+Q KE + L+KR  K+ N + KSH    +K+ +   K+K  +        KK+ EN       + +I+          ++  +  ++ +E +++  +H   EQ +K  +  Q  E   K+LS +Q  Q   L+LV +R+ KEM   Q K+SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MKH++
Sbjct:    2 TKSYEFNWQKHVPDFLQEGAVFDRLDEDPFVFESSCLFKVDEFGFFLTWKSEGKEGQVLECSLINSVRVGAVPKDPKILSSLEAAGKNEADLEGCIICVCSGPDLVNLSFMYMVADNADTAKKWLEGLKSVIHNFKANNVCPMTCLKKHWMRLSFLTNVNGKIPVRGITRTFGSGKTEKGIFQALKELGLPSGKNDEIDHSMFTFDVFYALTQKICPRTDIEELFKKINGDKTDYLTVDQLVSFLNENQRDPRLNEILFPFYDPKRVMQIIEKYERDEDLKKKGRMSSDGFCRYLMSDENAPVFLDRLDMCQDMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKPQQYKMAKYCEDIFGELLLKQPLEGFPIEPARPLPSPNDLKRKILIKNKRLKPEVEQKQLESFKRHM------------------EAGEMSVQGGDDENEEDMENADSKEVNSDMKTRNTSEEPSEQDTQENSVKKDKIPDDEITEIS-----------------EATEADVTDL-----------SEASDLDNKKKGGDAPEDADAEQQLIASYKYEGATTNIHPYLSAMVNYAQPVKFQSFEIAEEKNIHHNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGACGYLQKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSIAEKRADQMRALGIETSDIADV-PNESSKNDKKGKVNQVKANVTPQTSSDM----GQTSTATQNNS------------------SETKKDSALVNQVTIEDLKQMKSYVKLIKKQQKELNALKKRHAKDHNAMQKSHCTQVDKMVAQHDKEKFTLEKLLEKAIKKRGENNCSELKKETAIKVENLTTDHKAKVKDIVAQHTKEWSEMINSHSTEEQEMKDAHVTQQCEHLKKLLSSVQEQQTMQLKLVHERQSKEMKANQAKTSMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKHSK 1162          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:103022380])

HSP 1 Score: 1141.33 bits (2951), Expect = 0.000e+0
Identity = 602/1231 (48.90%), Postives = 810/1231 (65.80%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINR-LKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMH-------KKKTENQMKIDMNQRSIQ----------EMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +K YEF W++++P+ L++GA+FD  D++  + E +CL KVDEFGFFL+WKSE  E  V +  LI+ V+ G   KD K+LS L+   K ++++E   + +    D VNL  +  +  ++     W+  L+SV HN KA N+CPMT LKKHW+RL  L NVN KIP++ + +TF SG+ EK +FQ+LKEL LP  K  ++D S FTF+ FY L   ICPRTDI++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +   V  I++ YE +   K +G +S D F RYLMSDENAPVFLDRLD+ QDMDQPLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLL+GCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSKPQQYK+AKYCE++ GE LL +P+E   +E   PLPSP  LK KILIKNKRL  E E+ QL+ F +                    E G ++V   +D++++D +     E+N  +K+         + +  +SV    I +  I E +                 E++ A+ T + +     ++KK           GD   + + + Q +  +Y++   TTN+HPYLS++VNYAQPVKF  F I  EK    +MSSF+E+  LG++K +AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN   GY+ KP+FMRRS+R FDPFSE+P+DGVIAATC V++ SGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP Y E+  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF + VDALSDP+  +S  E +   M  +G ETS+I D+ P+ SS N K+ K   ++   T  T S+M     Q S+ T+ NS                  S+  KD A+  ++T E L + K+ VK +K+Q KE + L+KR  K+ N + KSH    +K+ +   K+K  +        KK+ EN       + +I+          ++  +  ++ +E +++  +H   EQ +K  +  Q  E   K+LS +Q  Q   L+LV +R+ KEM   Q K+SME ++ +  D + +NKAER+RR+REL   N K+FL++R+   MKH++
Sbjct:    2 TKSYEFNWQKHVPDFLQEGAVFDRLDEDPFVFESSCLFKVDEFGFFLTWKSEGKEGQVLECSLINSVRVGAVPKDPKILSSLEAAGKNEADLEGCIICVCSGPDLVNLSFMYMVADNADTAKKWLEGLKSVIHNFKANNVCPMTCLKKHWMRLSFLTNVNGKIPVRGITRTFGSGKTEKGIFQALKELGLPSGKNDEIDHSMFTFDVFYALTQKICPRTDIEELFKKINGDKTDYLTVDQLVSFLNENQRDPRLNEILFPFYDPKRVMQIIEKYERDEDLKKKGRMSSDGFCRYLMSDENAPVFLDRLDMCQDMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKPQQYKMAKYCEDIFGELLLKQPLEGFPIEPARPLPSPNDLKRKILIKNKRLKPEVEQKQLESFKRHM------------------EAGEMSVQGGDDENEEDMENADSKEVNSDMKTRNTSEEPSEQDTQENSVKKDKIPDDEITEIS-----------------EATEADVTDLSEASDLDNKKKG----------GDAPEDADAEQQLIA-SYKYEGATTNIHPYLSAMVNYAQPVKFQSFEIAEEKNIHHNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGACGYLQKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSIAEKRADQMRALGIETSDIADV-PNESSKNDKKGKVNQVKANVTPQTSSDM----GQTSTATQNNS------------------SETKKDSALVNQVTIEDLKQMKSYVKLIKKQQKELNALKKRHAKDHNAMQKSHCTQVDKMVAQHDKEKFTLEKLLEKAIKKRGENNCSELKKETAIKVENLTTDHKAKVKDIVAQHTKEWSEMINSHSTEEQEMKDAHVTQQCEHLKKLLSSVQEQQTMQLKLVHERQSKEMKANQAKTSMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKHSK 1162          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 [Source:NCBI gene;Acc:103033015])

HSP 1 Score: 1092.41 bits (2824), Expect = 0.000e+0
Identity = 586/1233 (47.53%), Postives = 794/1233 (64.40%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGS---KQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKI------DMNQRSIQEMLSLTEKNE-----------QEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +K YEF W+R +P+ L++GA FD +D++    E NC  +VD FGFF++WKSE  E  V +  LI+ ++S    KD K+LS L+   KT+S++E R + I   +D VNL  +  + +D  I   W  SLRS+ HN +A N+CPMT L+KHW+RL  L NVN KIP++ + +TFASG+ EK++FQ+LK+L LP  K  +++P  FTFEKFY+L   ICPRTDI+ LF  L  E  D+L  D+++ FLNE QRDPRLNEIL+P+ +    + I+++YE +   + +G +S D F RYLMSDENAPVFLDRL+L+Q+MDQPLAHY+I+SSHNTYLTGRQF G+SSV+MYRQVLL+GCRCVELDCWDGKG+DQEPIITHGKAMC+D+LF+DVI AI + AFV+S +PV LSFENHCS+ QQYK+A+YCE++ G+ LL +P++   LE G PLPSP  LK KILIKN+RL  E EK QL+ F K                    E G +N+ ++  +D++++DA     ++      ICG     QT  S    VP     N + + A + +L Q        T +E++  E                + K      V DE A I+        +Y + + TTN+HPYLS+++NYAQ VKFLGF    E     +MSSF+E+  LG+++ +AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF + VDALSDP+  +S  E +   M  MG ET EI D+ P+ S             ++S  G  + +K    Q S  T+  S+        +N    P K      D    ++T E L + K  +K  K+Q KE + L+K+Q K    L +SH    +K+     K+K ++ K+  +N+ K+      +M +    +M ++T  ++           +E  ++   H    Q L+  +  Q  E   K++   Q  Q + L  + +R+ KEM   Q KSSM   R +  D + +NKAER+RR+REL   N ++FL +R+   M  ++
Sbjct:    2 AKAYEFNWQRAVPDCLQEGAYFDRFDEDPFAFESNCFFRVDAFGFFITWKSEGKEGQVLECSLINSIRSTSVPKDPKILSALEATGKTESDLEGRIICICSGADLVNLSFMYIVAQDISIAKQWTDSLRSLIHNSRANNVCPMTCLRKHWMRLSFLTNVNGKIPVRSITRTFASGKTEKVIFQALKDLGLPSGKNDELEPDAFTFEKFYSLSQKICPRTDIEVLFKKLCGEKSDFLNTDQLVSFLNENQRDPRLNEILFPFYDSKRARQIIESYETDEKLQKKGLMSCDGFSRYLMSDENAPVFLDRLELYQEMDQPLAHYFISSSHNTYLTGRQFGGRSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDVLFKDVIQAIEETAFVSSEFPVILSFENHCSRHQQYKLARYCEDIFGDTLLRQPLDDFPLEPGQPLPSPNDLKRKILIKNRRLKPEVEKKQLEHFRKHM------------------EAGDVNMSTNMSEDENEEDAGCADLVDEAHPERICGRLVISQTN-SSEGDVPAADKGNKDEV-AGLEVLAQ--------TPLEAACQE----------------NGKKACEPGVADEQALIQ--------SYTYVAATTNIHPYLSNIINYAQAVKFLGFEEAEETNIHHNMSSFNESVGLGYLRTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSICEKRTDQMRAMGIETWEIADV-PNDSC------------KRSKKGKANQVKSLSPQRSLETRSTSS-------GQNASTFPKKDT----DTTMPQVTVEDLKQMKEYLKLAKKQVKELNALKKKQTKAHTALQRSHCTQMDKVVVQHEKEKRVLEKQLEKNKKKVSESNCCEMGREIEMKMKTITADHKTKVKDAAAAHAREWAEMMKAHSAEIQELRDQHVLQQCEQLRKLMLMTQEQQTQQLTHLHERQCKEMRANQAKSSMANGRAISQDKSIKNKAERERRVRELNSNNTRKFLTERKRLAMGQSK 1157          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 [Source:NCBI gene;Acc:103033015])

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 581/1235 (47.04%), Postives = 781/1235 (63.24%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKG--QTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGS---KQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKI------DMNQRSIQEMLSLTEKNE-----------QEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +K YEF W+R +P+ L++GA FD +D++    E NC  +VD FGFF++WKSE                     KD K+LS L+   KT+S++E R + I   +D VNL  +  + +D  I   W  SLRS+ HN +A N+CPMT L+KHW+RL  L NVN KIP++ + +TFASG+ EK++FQ+LK+L LP  K  +++P  FTFEKFY+L   ICPRTDI+ LF  L  E  D+L  D+++ FLNE QRDPRLNEIL+P+ +    + I+++YE +   + +G +S D F RYLMSDENAPVFLDRL+L+Q+MDQPLAHY+I+SSHNTYLTGRQF G+SSV+MYRQVLL+GCRCVELDCWDGKG+DQEPIITHGKAMC+D+LF+DVI AI + AFV+S +PV LSFENHCS+ QQYK+A+YCE++ G+ LL +P++   LE G PLPSP  LK KILIKN+RL  E EK QL+ F K     D+     ++ED +    ED   ++V                  +      ICG     QT  S    VP     N + + A + +L Q        T +E++  E                + K      V DE A I+        +Y + + TTN+HPYLS+++NYAQ VKFLGF    E     +MSSF+E+  LG+++ +AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN + GY+LKP+FMRR +R FDPFSE+P+DGVIAATC V++ISGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP+Y E+  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF + VDALSDP+  +S  E +   M  MG ET EI D+ P+ S             ++S  G  + +K    Q S  T+  S+        +N    P K      D    ++T E L + K  +K  K+Q KE + L+K+Q K    L +SH    +K+     K+K ++ K+  +N+ K+      +M +    +M ++T  ++           +E  ++   H    Q L+  +  Q  E   K++   Q  Q + L  + +R+ KEM   Q KSSM   R +  D + +NKAER+RR+REL   N ++FL +R+   M  ++
Sbjct:    2 AKAYEFNWQRAVPDCLQEGAYFDRFDEDPFAFESNCFFRVDAFGFFITWKSEG--------------------KDPKILSALEATGKTESDLEGRIICICSGADLVNLSFMYIVAQDISIAKQWTDSLRSLIHNSRANNVCPMTCLRKHWMRLSFLTNVNGKIPVRSITRTFASGKTEKVIFQALKDLGLPSGKNDELEPDAFTFEKFYSLSQKICPRTDIEVLFKKLCGEKSDFLNTDQLVSFLNENQRDPRLNEILFPFYDSKRARQIIESYETDEKLQKKGLMSCDGFSRYLMSDENAPVFLDRLELYQEMDQPLAHYFISSSHNTYLTGRQFGGRSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDVLFKDVIQAIEETAFVSSEFPVILSFENHCSRHQQYKLARYCEDIFGDTLLRQPLDDFPLEPGQPLPSPNDLKRKILIKNRRLKPEVEKKQLEHFRKHMEAGDVNMSTNMSEDEN---EEDAGCDLV------------------DEAHPERICGRLVISQTN-SSEGDVPAADKGNKDEV-AGLEVLAQ--------TPLEAACQE----------------NGKKACEPGVADEQALIQ--------SYTYVAATTNIHPYLSNIINYAQAVKFLGFEEAEETNIHHNMSSFNESVGLGYLRTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSICEKRTDQMRAMGIETWEIADV-PNDSC------------KRSKKGKANQVKSLSPQRSLETRSTSS-------GQNASTFPKKDT----DTTMPQVTVEDLKQMKEYLKLAKKQVKELNALKKKQTKAHTALQRSHCTQMDKVVVQHEKEKRVLEKQLEKNKKKVSESNCCEMGREIEMKMKTITADHKTKVKDAAAAHAREWAEMMKAHSAEIQELRDQHVLQQCEQLRKLMLMTQEQQTQQLTHLHERQCKEMRANQAKSSMANGRAISQDKSIKNKAERERRVRELNSNNTRKFLTERKRLAMGQSK 1136          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:103022380])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 278/476 (58.40%), Postives = 354/476 (74.37%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQ--DKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMF 1699
            +K YEF W++++P+ L++GA+FD  D++  + E +CL KVDEFGFFL+WKSE  E  V +  LI+ V+ G   KD K+LS L+   K ++++E   + +    D VNL  +  +  ++     W+  L+SV HN KA N+CPMT LKKHW+RL  L NVN KIP++ + +TF SG+ EK +FQ+LKEL LP  K  ++D S FTF+ FY L   ICPRTDI++LF  ++  K DYLT D+++ FLNE QRDPRLNEIL+P+ +   V  I++ YE +   K +G +S D F RYLMSDENAPVFLDRLD+ QDMDQPLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLL+GCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSKPQQYK+AKYCE++ GE LL +P+E   +E   PLPSP  LK KILIKNKRL  E E+ QL+ F
Sbjct:    2 TKSYEFNWQKHVPDFLQEGAVFDRLDEDPFVFESSCLFKVDEFGFFLTWKSEGKEGQVLECSLINSVRVGAVPKDPKILSSLEAAGKNEADLEGCIICVCSGPDLVNLSFMYMVADNADTK--WLEGLKSVIHNFKANNVCPMTCLKKHWMRLSFLTNVNGKIPVRGITRTFGSGKTEKGIFQALKELGLPSGKNDEIDHSMFTFDVFYALTQKICPRTDIEELFKKINGDKTDYLTVDQLVSFLNENQRDPRLNEILFPFYDPKRVMQIIEKYERDEDLKKKGRMSSDGFCRYLMSDENAPVFLDRLDMCQDMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKPQQYKMAKYCEDIFGELLLKQPLEGFPIEPARPLPSPNDLKRKILIKNKRLKPEVEQKQLESF 475          

HSP 2 Score: 499.975 bits (1286), Expect = 1.855e-154
Identity = 258/474 (54.43%), Postives = 330/474 (69.62%), Query Frame = 2
Query: 2087 SLMVGDESAE--IEKD-DQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHK 3499
            S+  GD+  E  +E D +Q +  +Y++   TTN+HPYLS++VNYAQPVKF  F I  EK    +MSSF+E+  LG++K +AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN   GY+ KP+FMRRS+R FDPFSE+P+DGVIAATC V++ SGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP Y E+  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC I L TYVPDGF + VDALSDP+  +S  E +   M  +G ETS+I D+ P+ SS N K+ K   ++   T  T S+M     Q S+ T+ NS+  +    N+   YS                         + VK +K+Q KE + L+KR  K+ N + KSH    +K+ +   K+K  + K
Sbjct:  485 SVQGGDDENEEDMENDAEQQLIASYKYEGATTNIHPYLSAMVNYAQPVKFQSFEIAEEKNIHHNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGACGYLQKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLSIAEKRADQMRALGIETSDIADV-PNESSKNDKKGKVNQVKANVTPQTSSDM----GQTSTATQNNSSETKKGEENQCTDYS-----------------------IVSYVKLIKKQQKELNALKKRHAKDHNAMQKSHCTQVDKMVAQHDKEKFTLEK 929          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: PLCB4 (phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGNC:9059])

HSP 1 Score: 521.546 bits (1342), Expect = 1.145e-168
Identity = 272/594 (45.79%), Postives = 375/594 (63.13%), Query Frame = 2
Query: 2117 IEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXX----------------------XXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDR 3832
            +E +D  V   Y++T GTTN+HPYLS+LVNYAQPVKF  F +  E+   ++MSSF+E+  LG++K  AIELVNYNK Q+SRIYPRG RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN   G++LKP+FMRR +R FDPFSE+P+DGVIA TC V++ISGQFLS++++GTYVEVDMYGLPTDTIRKEFRTR+VP NGLNPLY ++  FVFRKVILPDLAVLRI VF+++ KLIGQR+LPLDGLQTG+RHISLR+EGN P +L ++FC I L TYVPDGF  FVDALSDP+  +S+ E +   M  MG E S+I D+  S  S+N+                           ++T + +     + VR+       N      D+ +   +  ++L  +K+ +K LK+Q KE + L+K   K    L K+++   +K+ S   +++S + K     Q +  + ++       L ++ E+   +L   H    Q                        +  +  Q  E    +L+     Q + L+L  +R+ K++   Q K SME ++++  D + +NKAER+R
Sbjct:    2 VESEDAWVSA-YKYTGGTTNIHPYLSALVNYAQPVKFQNFVVAEERNIHYNMSSFNESVGLGYLKTGAIELVNYNKRQMSRIYPRGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGFCGFLLKPDFMRRPDRTFDPFSETPVDGVIAGTCSVQVISGQFLSDRQVGTYVEVDMYGLPTDTIRKEFRTRLVPNNGLNPLYNQEP-FVFRKVILPDLAVLRIAVFDDSNKLIGQRILPLDGLQTGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDFVDALSDPKRFLSQAEKRANQMQAMGIEASDIGDVPESRGSVNRG--------------------------AATPQTSVTCTPVTVRS----LGNNAIGSTPDEPLVPPVCVDTLRHSKSFLKLLKKQEKEMTLLKKAHAKAQASLQKTYTGQGDKVTSQYERERSSILK-----QTEKTLAKKGEGHCAGLQKETEKRVEELTVEHQRKTQALQAERAREQAALQAQQARRQEEARTAHAAQQDELVRALLAGAHEQQIRQLQLTHERDTKQLEGTQAKQSMEESKLISQDRSIKNKAERER 558          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: PLCB1 (phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGNC:15917])

HSP 1 Score: 360.147 bits (923), Expect = 3.592e-105
Identity = 202/495 (40.81%), Postives = 286/495 (57.78%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDS--------NMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAI------FEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKT-ENQMK----------IDMNQRSIQEMLSLTEKN-EQEKNK 3595
            +S+LVNY QPVKF  F    +K   + MSSF ET  +  +    +E V YNK QLSRIYP+G RVDSSN++PQ+FWNAGCQ+VALN+Q+ DLAMQLN G FEYN  SGY+LKPEFMRRS++ FDPFS++ +DG+IA T  VK+ISGQFLS+KK+G +VEVDM+GLP DT RK ++T+  P N +NP++ E+  FVF+KV+LP LA LR+  FE+ GK +G R++P+  ++ G+RHI LR+E N   AL ++   I +  YVPD FA   +AL++P  ++S  E + + +A +      I +    T+ +           R + DG  S            G  Q S  T              + V SP K    KDD +       E +T E + + K ++K   +Q+KE  +L KR  K I EL K        L++ L K    M    + E ++            +M Q+  +EML + +++ E EK +
Sbjct:  512 MSNLVNYVQPVKFTTFEAARKKNRSYEMSSFVETKGMEQLTKCPVEFVEYNKCQLSRIYPKGTRVDSSNYMPQVFWNAGCQLVALNYQTMDLAMQLNIGMFEYNRRSGYILKPEFMRRSDKHFDPFSDNTVDGIIANTVSVKVISGQFLSDKKVGCFVEVDMFGLPVDTKRKIYKTKTAPGNSINPVWDEEP-FVFKKVVLPTLACLRVAAFEDGGKFLGHRIMPVSAIRPGYRHICLRNESNQALALPAILVYIQVKDYVPDAFADLTEALANPIRYVSLMEQRAQQLAAL------IGEFDEGTAEV-----------RMAHDGPISMPPAPHKVAAPPGAPQGSGPT--------------DTVKSPAKPPPQKDDVLASILRGVEALTVEQIKQHKAVLKLQFKQHKEAKDLSKRHQKRIAELAKEQMARLSDLQAELKKCHPTMSPSASLEGELSALEGQGGRQITEMKQQQQEEMLHMRQEHCELEKAR 974          

HSP 2 Score: 337.421 bits (864), Expect = 2.246e-97
Identity = 166/366 (45.36%), Postives = 233/366 (63.66%), Query Frame = 2
Query:  539 QSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKP-QQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKL 1630
            +  +E +T+ +   SDFVNL  L F+    +I   W T +  +  N+   N      L K + +L L +N ++KIP+K + + FA+ R  + V  +L+   LP  +   + P++F  + F   +  ICPR +I  +F  + +  + YLT D+   F+N  QRDPRLNEILYP    + VQ +++ YE N     +G ISV  F ++L  DEN+ +  +++DL  DM QPL+HY+INSSHNTYL   Q  G SSV+MYRQ LLAGCRCVELDCW G+  D+EP+ITHG  M ++ILF+DVI AI+DCAF TSP+PV LSFENH   P QQ K+A+YC  + G+ LL  P+EK+ LE+G+PLPSP+ L
Sbjct:   15 EGRLEQKTVTVVFGSDFVNLTFLNFVAFSEEIAKEWATGIFQLASNLLYHNSSRDIFLDKLYTKLTLQLNQDSKIPVKNICRLFAADR--RRVETALESCGLPNGRNDAIYPAEFGPDVFRLFIKSICPRPEIDGIFAEVGARSRPYLTVDQFTEFINNCQRDPRLNEILYPPLKPSQVQLMIEKYEPNASLAKKGHISVGGFLKFLQGDENSAIPAEKIDLSDDMMQPLSHYFINSSHNTYLMAGQLAGSSSVEMYRQALLAGCRCVELDCWKGRTADEEPVITHGFTMTTEILFKDVIEAIKDCAFKTSPFPVILSFENHVDSPKQQAKMAEYCRTIFGDALLMDPLEKYLLESGIPLPSPQDL 378          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: PLCB1 (phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGNC:15917])

HSP 1 Score: 333.954 bits (855), Expect = 5.743e-95
Identity = 159/293 (54.27%), Postives = 210/293 (71.67%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPA-NGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANM 3064
            +S+LVNY QP+KF  F    ++   + MSSF E+  +  +    +E V YNK QLSRIYP+G RVDSSN++PQ+FWNAGCQMVALN+Q+ DLAMQLN G FEYN  SGY+LKPEFMRR+++ FDPF++  +DGVIA T  VK+ISGQFLS++K+ TYVEVDM+GLP DT RK ++TR     N +NP++ ED  FVF KV+LP LA LRIGVFEE GK IG R+LP+  ++ GF HI LR+E N P +L ++F  I +  YVP  F +F+  LS+P  +    E + K + ++
Sbjct:  510 MSNLVNYVQPIKFDSFEDAKKRNRNYEMSSFVESKGMEQLTKCPVEFVEYNKTQLSRIYPKGTRVDSSNYMPQVFWNAGCQMVALNYQTLDLAMQLNMGIFEYNCRSGYLLKPEFMRRADKQFDPFTQDIIDGVIANTISVKVISGQFLSDRKVSTYVEVDMFGLPVDTKRK-YKTRTSKDNNSINPVWEEDP-FVFDKVVLPSLASLRIGVFEEGGKFIGHRILPVSAIRPGFHHICLRNESNQPLSLPAIFVFIQVKDYVPVAFENFISGLSNPIMYQGLMEQRAKQLESL 800          

HSP 2 Score: 326.25 bits (835), Expect = 1.854e-92
Identity = 167/381 (43.83%), Postives = 239/381 (62.73%), Query Frame = 2
Query:  497 IKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKD--YLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKP-QQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKL 1630
            ++D K   Q++  T   +E RT+ +    D VN+  L F      +   W   L ++  N+ A N      L K + +L L  N  +K+P++ + + F +  ++K V  +L    LP  +  ++    FT+E FY+ +N +CPRTDI  +F     G+    +T ++   F+N  QRDPRLNE+L+P    + VQ ++D +E   + K +G+ISV  F RYL  +EN  V  ++LDL++DM QPL+HY+INSSHNTYLTG Q +G SSV+MYRQ LLAGCRCVELDCW G+  D++PIITHG  M ++I F++VI AI + AF TSPYPV LSFENH   P QQ K+A+YC  + G+ LL   ++K+ LE+GVPLPSPE+L
Sbjct:    2 VQDTKFRDQVEGFTGVGMESRTITVVHGPDLVNISFLNFTALTESVAKVWTDELFTLATNLLAQNSSRDKFLNKAYTKLKLQSNTEDKVPVRSILRMFPT--DKKKVENALMSCELPSGRNDNIPIETFTYEAFYSFVNKLCPRTDIDSIFAERYGGQASAXMTVEQFTDFINSKQRDPRLNEVLFPPMKTHQVQALIDKFESTNLAK-KGQISVLGFLRYLNGEENGIVPPEKLDLNEDMTQPLSHYFINSSHNTYLTGGQLKGNSSVEMYRQSLLAGCRCVELDCWKGRTADEDPIITHGFTMTTEIPFKEVIDAIAETAFKTSPYPVVLSFENHVDSPKQQAKMAEYCRLMFGDALLVDVLDKYPLESGVPLPSPEEL 379          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: PLCD4 (phospholipase C delta 4 [Source:HGNC Symbol;Acc:HGNC:9062])

HSP 1 Score: 196.438 bits (498), Expect = 6.862e-53
Identity = 114/266 (42.86%), Postives = 159/266 (59.77%), Query Frame = 2
Query:  887 FEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLD-LHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMY--RQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVP---LPSPEKLKYKILIKNKRLP 1666
            F  FY LL     R ++Q LF+SLS     L+   +  FL + QR+    E+ +     +S   I + +EL+ + +S   +++D F RYL S + + ++  R D +  DM +PL+HY+I+SSHNTYL   Q RG SS + Y   +    GCRCVELDCWDG+  + EP+I HG  + S ILF DVI  I   AF  S YPV LS ENHCS  QQ  +A++ + +LG+ LLT P+      AG+P   LPSPE+L+ K+L+K KRLP
Sbjct:   58 FVVFYKLLTQ---RDELQALFSSLSGDGSVLSRGELAAFLRDFQREEGCEELRFAEELASS---ITERHELSNIARSLSVMTLDGFVRYLTSPDGS-LWDQRHDSIGHDMTRPLSHYFISSSHNTYLMEDQLRGPSSTEAYISSRAFRKGCRCVELDCWDGQ--NGEPVIYHGHTLTSKILFSDVIRTIEKYAFQVSDYPVILSIENHCSVAQQAVLARHMQSILGDKLLTAPL------AGLPSSQLPSPEQLRGKVLVKGKRLP 308          

HSP 2 Score: 169.088 bits (427), Expect = 9.084e-44
Identity = 99/269 (36.80%), Postives = 145/269 (53.90%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSE-------KKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEE----TGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLS 2962
            LS+ V Y + V+F GF+ P ++   + +SSF+ET A   ++ D  E V +N  QLSR+YP G R DSSN+ PQ FWN GCQ+VALNFQ++   M L+ G F  N   GY+LKP F+     AF P +  P  G+      +K+ISGQ L +         I   V V+++G+P D  R E  T+ +  NG NP + E  +F    + +P++A+LR  V +         + Q  +    L+ G+RHI L S        SSLF  + ++
Sbjct:  361 LSNCVVYCRSVQFPGFSRPRDQASAWDISSFTETKARKLLREDGNEFVRHNTLQLSRVYPAGRRTDSSNYNPQEFWNVGCQIVALNFQTAGDEMDLHDGHFRQNGGCGYVLKPAFLCDPTTAFQPENPQPGIGLHTVRLTIKVISGQQLPKVPHSNKGSIIDPLVRVEVHGVPLDNARYE--TKYIDNNGFNPQWNEILSF---NINVPEVALLRFVVEDHDTATPNDFVAQYSIAFSSLRQGYRHIPLLSRDGTRVEPSSLFIHVKIA 624          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Match: plcd3b (phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GENE-081222-2])

HSP 1 Score: 189.119 bits (479), Expect = 1.236e-49
Identity = 110/261 (42.15%), Postives = 150/261 (57.47%), Query Frame = 2
Query:  890 EKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLD-LHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVP---LPSPEKLKYKILIKNKR 1660
            ++F  L   +  R D+  LF  LS     L   R+ +FL + Q +           + +    I+  +E     +S+G +++D F RYL S + + ++  R D +  DM QPL+HY+I+SSHNTYLT  Q RG SS + Y + L+ GCRCVELDCWDG   D EP+I HG  + S ILFRDVI +I   AF  S YPV LS ENHC+  QQ  +A++   +LGE L+T P+       G P   LPSPE+LK K LIK K+
Sbjct:  197 DEFVQLFRKLTRRDDVATLFKRLSPDGIGLPAARLAQFLQDEQHED---------DSEHRAACIIAEHEPLDEGRSKGLMTLDGFVRYLTSPDGS-LWDQRHDSVSHDMTQPLSHYFISSSHNTYLTDDQLRGPSSTEAYVKSLMRGCRCVELDCWDGA--DGEPVIYHGYTLTSQILFRDVITSIAHEAFKASAYPVILSLENHCNVEQQIVMARHLRSILGERLVTAPL------PGRPPTQLPSPEELKGKFLIKAKK 439          

HSP 2 Score: 151.754 bits (382), Expect = 1.598e-37
Identity = 97/269 (36.06%), Postives = 138/269 (51.30%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKK-------IGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGV--FEETGK--LIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLS 2962
            LS  V Y   V F G       +    M SFSET  +G ++      V YN   LSR YP G RV S N+ P   WNAGCQ+VALNFQ+    M L  G F  N   GY+LKP F+R     FDP + +   G       + +ISGQ L +++       I   V V+++G+  DT  +E  T     NGLNP++ E+  F+F ++ +P+LA++R  V  ++ T +   IGQ  LP   L+ G+RH+ L S        ++LF  I ++
Sbjct:  491 LSDCVIYCSGVHFEGLERAESHQKGNEMCSFSETKTMGLIETQGNAFVRYNMQHLSRTYPSGTRVGSGNYNPHDMWNAGCQIVALNFQTPGKEMDLYDGLFRQNGGCGYVLKPSFLRDPHTDFDPGNPARGTGRHPVKLAITVISGQQLPKERNSRRGSIIDPLVSVEVHGVRGDTAVRE--THHQENNGLNPVWKEE--FLF-QLTVPELALIRFVVKDYDVTSRNDFIGQFSLPFSCLRQGYRHVHLLSLDGRSLFPATLFVHIRIT 754          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Yeast
Match: PLC1 (Phospholipase C; hydrolyzes phosphatidylinositol 4,5-biphosphate (PIP2) to generate the signaling molecules inositol 1,4,5-triphosphate (IP3) and 1,2-diacylglycerol (DAG); involved in regulating many cellular processes; Plc1p and inositol polyphosphates are required for acetyl-CoA homeostasis which regulates global histone acetylation [Source:SGD;Acc:S000006189])

HSP 1 Score: 125.176 bits (313), Expect = 2.857e-29
Identity = 68/161 (42.24%), Postives = 96/161 (59.63%), Query Frame = 2
Query: 1217 QPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGE--YLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLD 1693
            +PL HY+I SSHNTYL G+Q     SV+ Y QVL  GCRCVE+D WDG+     P++ HG  + S I  + VI  I+  AF+TSPYP+ +S E +C+K  Q   +    EVL E  Y +    +K        LPSP +LK+KIL+K+K+  + T  + ++
Sbjct:  384 KPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQGCRCVEIDIWDGENG---PVVCHG-FLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQKLASLIMREVLAEQLYFVGTRTDK--------LPSPRELKHKILLKSKKTSEATRGLSVN 532          

HSP 2 Score: 90.1225 bits (222), Expect = 1.995e-18
Identity = 79/283 (27.92%), Postives = 129/283 (45.58%), Query Frame = 2
Query: 2219 VKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELV--NYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNN-------SGYMLKPEFMR---RSERAFDPFSESPMDGVIAATCEVKIISGQFL--------SEKKIGTYVEVDMY--GLPTDTIRKEFRTRVVP---------ANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISL-RSEGNFPCALSSLFCKITLSTYV 2971
            +KF  F++P E +   H  S +E      +K+  ++L    +N+  L R+YP   R  SSNF P  FW AG QMVA N+Q++D+  QLN   F+  ++       SGY+LKP+ +       +      E   +G    T +++I+S Q L        S     ++V+V+ +    PT  I  +  TR+            NG NP++  + +   +     DL  ++  V  E  + I    L L+ L+ G+RHI L   EG        +FC + + T +
Sbjct:  596 IKFRNFSLP-ESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPVVTKAKMIPLIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDKGTRISATEASTKSSQGNGFNPIWDAEVSITLKDT---DLTFIKFMVISEETQ-IASVCLKLNYLRMGYRHIPLFNMEGE-----QYIFCTLFIHTQI 868          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO42237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S279])

HSP 1 Score: 400.208 bits (1027), Expect = 1.462e-117
Identity = 202/453 (44.59%), Postives = 281/453 (62.03%), Query Frame = 2
Query:  302 WRRNIPEELKKGALFDFYDDEL-------NILEVNCLVKVDEFGFFLSWKSEKS-EAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLK 1633
            W   +P +L+ G L   +D+         N L +N    VD+ GFFL+W+S+   E    ++  IS+V+ GV  KD+KV   LQ      +E+R   +  N++ V+ + L      S++   WV  LR + HN++  N   +TQL K +++  L  +   KI +K + K   +G+ E LV  +L+ L LPC K   + P  FTFE FY L   +CPR +I +L      G+   LT  +++ F+N+ QRDPRLNEIL+P+ +      ++  YE       +  I V+   RYL+S++N  +   RL+L  DM+QPL+HY+INSSHNTYL GRQF G+SSV+MYRQ L+AGCRC+ELDCWDG+ D  EPIITHG AMC+ ILF+DVI AIRD AF TS +PV LSFENHCSK QQYK+A YC ++LG+ L+TKP+E   LE G PLPSP +L+
Sbjct:    8 WEVYVPLKLQSGTLLSRWDEASFLNKEPNNKLRINT-TYVDKCGFFLAWRSQDDKEGSSIEISNISEVRLGVLPKDQKVRESLQRTGADPLEERGFTVVYNTNLVDCNYLHLFASTSRVAKEWVEGLRPLLHNVRLDNCSVLTQLHKQYVKAGLHKDALGKISVKSICKALYAGKFESLVLDALQALGLPCSKNDKITPEDFTFEHFYQLYLKVCPRLEIMELCVEWGGGRAPILTATQLVNFMNKEQRDPRLNEILFPFCDNEKALSLIWKYEKQMDMLQRDRICVNGLTRYLLSEDNLLIMPGRLNLSDDMNQPLSHYFINSSHNTYLVGRQFGGRSSVEMYRQCLIAGCRCIELDCWDGQND--EPIITHGNAMCTKILFKDVIEAIRDSAFQTSDFPVILSFENHCSKHQQYKMACYCMDILGDMLVTKPLESCPLEEGRPLPSPNQLR 457          

HSP 2 Score: 387.497 bits (994), Expect = 3.719e-113
Identity = 218/615 (35.45%), Postives = 345/615 (56.10%), Query Frame = 2
Query: 2105 ESAEIEKDD-QTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFET---SEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHK------KKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLK-----------VLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRR 3886
            ++A +  DD   +  ++   S T N++P LSSLVNY QPV F GF+   ++   + MSSF+E+   G ++   ++ V YNK Q+SRIYPRG+RVDSSN++PQ+FWN GCQMV+LNFQ+ DL   LNQG+FE+N  SGY+LKP+ MRR +R FDPF+ESP+DG + A   +K+ISGQ+LS+KKI T VEVDMYGLPTDTIRK+++T+   +NGLN LY +  + VFR+V+LP++A+LR  V ++  ++I QRV+PLD +Q G+RH+ LR+E + P  L++LF  ITL  YVP+G+ + VD L++P       + +   M   G +    + +  + P     +K+ ++      + T                   IN  ++  K +   + + P              I+ E L + KT  K +KRQ KE   +QK+  KE   + ++H+   EKL +   + K    K      K+  +     +     +++  L++   ++  K+     +   ++      +    Y +            L Q    Q K   +  +RE  E+  +QTK S+EA + +  D   +NK ER+R+L++L  +N K+F+++R+
Sbjct:  537 DAASLTPDDVADIMASFPTQSTTGNINPLLSSLVNYIQPVPFQGFDESEKRNLFYQMSSFNESTGFGLVRATPLDFVKYNKRQMSRIYPRGSRVDSSNYMPQVFWNVGCQMVSLNFQTPDLPFHLNQGKFEFNGRSGYILKPDLMRRDDRMFDPFTESPIDGYVGAYVAIKVISGQYLSDKKITTVVEVDMYGLPTDTIRKKYKTKSSTSNGLNTLY-DGEHMVFRRVVLPEMALLRFAVIDDNDRIIAQRVVPLDSIQAGYRHVPLRTENDTPIPLATLFVHITLRCYVPEGYGAIVDELAEPIKFQCAADKRAAQMVVFGIDENVRARVIQVEPRLLQHSKEHSRSVGFSLKPT-------------------INEQLFIGKYKIVPIEFIP--------------ISLEELKKDKTYRKVIKRQQKESEVIQKKYSKERVMMQRAHTSELEKLITSYDEIKQAAQKTYERATKRCGDDRAKALKAVYDKKIAYLSQSQREKAQKVLATQTDEWTSMISRQIAEEIAIYEQHAETQICVLQAALDQAHEIQLKETVIKHERENSEIKKRQTKQSIEAGKSIFMDKTIKNKEERERKLKQLDRHNLKQFVEERQ 1117          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO43813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXP6])

HSP 1 Score: 377.867 bits (969), Expect = 2.052e-113
Identity = 176/298 (59.06%), Postives = 220/298 (73.83%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSE 3082
            LS LVNY QPV F  F++  ++   + MSSF ET A   +K   +E VNYNK QLSRIYP+G RV S N++PQIFWNAGCQ+VALNFQ+ DLAM LN G FEYN   GY+LKP FMRRS+R FDPF+ES +DG+IA    VK+ISGQ L+EKK+GTYVEV+MYGLP DT+RK++RT+VVP NG+NP+Y +D  F F+KV+LP LAVLRI V+EE+GKLIGQR+LP+DGL  G+RHI LR++ N P  L  LF  I    YVP GF  F +AL DP A  S+E+ + + +A +  E  E
Sbjct:  450 LSELVNYFQPVHFKSFDVSAKRNRSYEMSSFVETVATTQLKEKPVEFVNYNKRQLSRIYPKGTRVGSENYMPQIFWNAGCQLVALNFQTLDLAMMLNLGIFEYNGRCGYILKPSFMRRSDRTFDPFAESTVDGIIAGAVHVKVISGQLLTEKKVGTYVEVEMYGLPADTVRKKYRTKVVPNNGINPVY-DDDPFEFKKVVLPSLAVLRIAVYEESGKLIGQRILPVDGLNPGYRHIKLRNDCNLPLTLPVLFVHIITKDYVPSGFEDFANALCDPIAFQSQEDKRQQQLAALLDEEDE 746          

HSP 2 Score: 365.54 bits (937), Expect = 4.495e-109
Identity = 176/393 (44.78%), Postives = 253/393 (64.38%), Query Frame = 2
Query:  494 KIKDEKVLSQLQDKTQSN-IEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNE--KLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKR 1660
            +++D+++   L   +  + + ++ + I   ++ V+L  + F+   S +   W  SL  + HN+   N CP T LKK + ++C+    + K+ +K V K  +S   E  K +  +L+ + LP  K   +   +F+F+ F+   N +C R DI  +F  + ++ K Y+  ++++ F+N  QRDPRLNEILYPY N    + I+  YE N     +G  SV    RYLMS++NAP+  DRL LHQDM QP++HY+INSSHNTYLTG Q  GKSSV+MYRQ LLAGCRC+ELDCWDGK +DQEP+ITHG  +C++I F+DVI AI +CAF TS YPV LSFENHC+  QQ K+A YC  + G+ LL+KP++ + LE G PLP  + L  KI+IKNK+
Sbjct:    1 RLQDQRLRDSLNIGSDEDPLTEKAITIVHGANMVDLMYVTFVSSSSTMARQWTDSLVKITHNLLEINECPTTFLKKQYTKICVQTTQDGKVSVKNVIKYISSSSKEDRKRIQDALQSVGLPHGKNDAISLEKFSFDIFWEFYNRLCNRQDIDKIFTEIGTKKKPYMVTEQLVDFINNNQRDPRLNEILYPYCNEEKAREIIRKYEPNQDFVKKGHFSVQGLTRYLMSEDNAPIHPDRLSLHQDMTQPISHYFINSSHNTYLTGHQLTGKSSVEMYRQTLLAGCRCIELDCWDGKTEDQEPVITHGMTLCTEISFKDVIEAIAECAFKTSDYPVILSFENHCTPKQQLKMASYCVNIFGDMLLSKPLDDYPLEEGRPLPPLKVLMRKIVIKNKK 393          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO38229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH9])

HSP 1 Score: 201.445 bits (511), Expect = 5.588e-54
Identity = 123/325 (37.85%), Postives = 181/325 (55.69%), Query Frame = 2
Query: 2027 VIVKHKKYLHEKKSSA--KDLTSLMVGDESAEIEKDDQTVGMNYRHT-SGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKK--------IGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVF-EETGK--LIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITL 2959
            V++K KK   E++ +A  +D  ++   DE+A+IE++D         +      +   LS  VNY   V F  F    E    + MSSF E+      +N A   V YN  QLSR YP G+RVDSSN+ PQ+ WN GCQ+VALN+Q+    M LNQGRF  N  +GY+LKP +MR  +  F+P +     GV      +++ISGQ L + +        I  YVEV +YG+ +D+   +F+T+V+  NG NP++ E+   + + + +P+LA+LR  V+ E+ GK   IGQ  LP+  L+TG+RHI L      P   +SLF  + L
Sbjct:  346 VLIKGKKLKPEQEMAAVGEDDGTVSDEDEAADIEQEDLAAAREGEESKEKKVKLAKELSRCVNYISSVGFKNFEHSKENAKFYQMSSFVESKVATLAQNKAAGFVEYNTRQLSRTYPAGSRVDSSNYNPQVAWNVGCQIVALNYQTDGEYMHLNQGRFRENKRAGYVLKPAYMRNPDIKFNPNNPKSCPGVKKKLLIIQVISGQQLPKPQGSSSKGEVIDPYVEVKIYGVNSDS--ADFKTKVIKDNGFNPVWNEE---IKKLLYVPELAMLRFCVYDEDVGKDDFIGQFSLPITSLRTGYRHIHLLDIKGEPLPHASLFVHVML 665          

HSP 2 Score: 191.815 bits (486), Expect = 8.402e-51
Identity = 131/398 (32.91%), Postives = 197/398 (49.50%), Query Frame = 2
Query:  602 TLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLV---NVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTD--LTQDLEIA--EDPDLIAGEDG 1774
            +L  + K  +  N W+  L+++ +N          Q K  WL         N + ++ L  V K   +  N  +  +++K+     E+      +    E+F      I  R +I ++ N  + GK ++  + + +FL +      + E+   Y +      I+ TYE     +   ++ +D    YL+S E          ++QDM QPL+HY+I SSHNTYL   Q +G SSVD Y      GCRCVELDCWD  GD+ +PI+ HG  + S I F+D+I A+ + AF  S YPV LS ENHC+   Q KIA++ E +LG+ L   P++     A   LPSPE LK K+LIK K+L  E E     M   G+ D  ++ + E A  E  DL A  +G
Sbjct:   25 SLDLVAKSVETANLWLVGLQTLINN----------QSKCTWLIDAFEKFDKNKDGELGLSEVTKLL-NALNVNITPKTIKKRFRVSEQAGA--EAALNKEEFAEFFKAIATRDEIVEIMNKFTSGKAHMNVEDLQKFLYKQG----VKEVSKQYCD-----IIISTYEPTEEGQRDKQLGIDGLTNYLLSKEGDIFDTAHDKVYQDMRQPLSHYFIASSHNTYLMEDQLKGPSSVDAYINAFNKGCRCVELDCWD--GDNGDPIVYHGHTLTSKIKFKDIIQAVAEHAFKVSDYPVILSLENHCNIENQRKIAEHLENILGDKLFKDPVDT----ALTSLPSPESLKGKVLIKGKKLKPEQE-----MAAVGEDDGTVSDEDEAADIEQEDLAAAREG 389          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO28963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T501])

HSP 1 Score: 187.193 bits (474), Expect = 3.067e-52
Identity = 112/275 (40.73%), Postives = 147/275 (53.45%), Query Frame = 2
Query:  854 KTADVD----PSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLP 1666
            K AD D         FE+F N    I  R ++  L       K+ +T   ++ FL   QR P  +E             I+ TYE     K    + +D F  YL+S +      +  D++QDM +PL+HY+I SSHNTYLTG Q    SS+DMY +VL +GCRC+ELDCWDGK  D EP++ HG  M S + FR VI  I D AF+ + YPV LS ENHCS  QQ  +A +  +   + L    I    L  G  LPSP++L  KILIK K+LP
Sbjct:   43 KAADTDTVNSSGLLDFEEFANFYKSISTRRELYMLLLKYGNSKENMTVQELLNFLRIEQRVPECDE--------EYCSNIIQTYEPADSNKKNMLLGIDGFTSYLLSADGEIFNPEHSDVYQDMTRPLSHYFIASSHNTYLTGDQLASASSMDMYVRVLQSGCRCLELDCWDGK--DGEPVVYHGYTMTSKVKFRYVILNINDFAFLNNRYPVILSLENHCSVEQQKFMANFMRDTFKDILC---ILFFMLFDGKDLPSPQELMGKILIKTKKLP 304          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Match: EDO31556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXK4])

HSP 1 Score: 188.348 bits (477), Expect = 2.010e-50
Identity = 98/251 (39.04%), Postives = 153/251 (60.96%), Query Frame = 2
Query:  905 LLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNK 1657
            +   I  R ++  LF ++S    ++T D +  F+ + QR        +  +++ + + ++  +E++   K+Q ++ +D F  ++ S   +        ++QDM+QPL+HY+I SSHNTYL G Q +G SSV  YR VL  GCRCVELDCWD  GDD+EPI+ HG  + S +LF+D++ AI++ AF  SPYPV +S ENHCS   Q K+A++ + +LG  L T P++   L+A   LPSP+    KIL++ K
Sbjct:    1 MYKFISKRKEVDLLFRNVSSNGAWVTVDDLEDFMTKDQR--------FDVTHK-TCKELIKKFEVSQRGKAQLQLGIDGFLSFINSQHASLFNPAHEKIYQDMNQPLSHYFIASSHNTYLLGHQLKGSSSVQAYRDVLERGCRCVELDCWD--GDDEEPIVYHGHTLTSKVLFKDIVQAIKESAFKVSPYPVIVSLENHCSVQFQIKMAEHLKGILGSLLYTTPVD-FTLDA---LPSPKFFLNKILVRGK 236          

HSP 2 Score: 156.762 bits (395), Expect = 6.508e-40
Identity = 104/304 (34.21%), Postives = 157/304 (51.64%), Query Frame = 2
Query: 2102 DESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDG-------------VIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVI-LPDLAVLRIGVFEET---GKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLS 2962
            D   +IE+  Q    ++R T    +V   LS L+NY    KF  F    E        SF E+  L  +   A E V +NK+Q+SRIYP   RVDSSN+ P   W  GCQ+VALN Q++   MQL+ G+F  N N+GY+LKP+F+R  E  FDP    P DG             VI+A   ++I     L   +   YV+V+++G+P D  +  F T  +    LNP++ E+    F+ ++ +P+LA+++  V++E       +GQ V+P + L  G+R I L      P   ++LF  + +S
Sbjct:  255 DRKVQIERSVQET--DFRGTK--EHVADELSQLINYISNEKFKSFIESMEMGHFSQTHSFVESEMLYFLDKSASEFVEFNKHQISRIYPGNLRVDSSNYDPIKPWTVGCQIVALNHQTNSEEMQLHYGKFRQNGNTGYVLKPKFLRDPELTFDP---DPQDGKFPGIQPKRLQLTVISAFQLLEIEESWSLVRDEPDPYVQVEVHGVPAD--KATFTTHGLTDTTLNPVWNEE----FQTIVHVPELAMVQFVVYDEDYGFDDFLGQVVIPFESLMEGYRQIQLLDMSGLPLPGTTLFVHVKIS 545          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB4 (phospholipase C beta 4 [Source:NCBI gene;Acc:100049535])

HSP 1 Score: 1143.26 bits (2956), Expect = 0.000e+0
Identity = 594/1236 (48.06%), Postives = 815/1236 (65.94%), Query Frame = 2
Query:  281 SKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQD--KTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGK-DYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAE--DPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGD--ESAEIEKD-DQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMH------------------KKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            +K YEF W++++PE +++GA FD +D++  + E NCLV+VDEFGFF++WK+E  E  V +  LI+ ++ G   KD K+LS  +   KT++++E   + I   +D VNL  +  +  + +    W+  LRSV HN KA N+CPMT LKKHW+++C L N+N KIP++ + +TFASG+ EK +FQ+LK+L LP  K  +++PS FTF+ FY L   ICPRTDI++LF  ++  K DYLT D ++ FLNE QRDPRLNEIL+P+ +      I++ YE +   K +G +S D F RYLMSDENAPVFLDRL+L+Q+MDQPLAHY+I+SSHNTYLTGRQF GKSSV+MYRQVLL+GCRCVELDCWDGKG+DQEPIITHGKAMC+DILF+DVI AI++ AFVTS YPV LSFENHCSKPQQYK+AKYCEE+ G+ LL +P+E H +E G PLPSP  LK KILIKNKRL  E E+ Q + F K        +E  E   P +I GE+  +                                +      +S  P+     +++ EAN   LK+  +    + K E SN+   V  +H      + + A D++     D  ++ E+ +D ++ +   Y +   TTN+HP+LS++VNYAQPVKF  F++  E+   ++MSSF+E+  LG++K +AIE VNYNK Q+SRIYP+G RVDSSN++PQIFWNAGCQMV+LNFQ+ DLAMQLNQG+FEYN + GY+LKP+FMRRS+R FDPFSE+P+DGVIAATC V++ SGQFLS+KKIGTYVEVDMYGLPTDTIRKEFRTR+V  NGLNP Y E+  FVFRKVILPDLAVLRI V+++  KLIGQR+LPLDGLQ G+RHISLR+EGN P +L ++FC+I L TYVPDGF + VDALSDP+  ++  E +   M  +G +T++I D+ PS +S      K +   +   D   +         S T + +S++ Q     +N     N S+  KD  +    + E L +TK  +K +K+Q KE + L+K+  KE N + K+H    +K+ S   K+KS +                   KK+TE++++  + +   + +  +T ++ +E ++L   H N EQ +K  +  Q  E   K+L+  Q  Q   L+L+ +R+ KEM   Q K SME ++ +  D   +NKAER+RR+REL   N K+FLD+R+   MKH +
Sbjct:    2 TKCYEFNWQKHLPEFMQEGASFDRFDEDPYLFEPNCLVRVDEFGFFITWKNEGKEGQVLECSLINSIRVGAVPKDPKILSSFESIGKTEADLEGCIICICSGADLVNLSFMFMVADNPETARKWIEGLRSVIHNFKANNVCPMTCLKKHWMKMCFLTNINGKIPVRGITRTFASGKTEKGIFQALKDLGLPSGKNDEIEPSDFTFDMFYALTQKICPRTDIEELFKKINGNKTDYLTVDHLVSFLNENQRDPRLNEILFPFYDPKRAMQIIEKYERDEELKKKGRMSSDGFCRYLMSDENAPVFLDRLELYQEMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSDYPVILSFENHCSKPQQYKMAKYCEEIFGDLLLKQPLESHPIEPGRPLPSPNDLKRKILIKNKRLKPEVEQKQFEAFKK-------HMEAGETNTPAIIMGEEDDVENGE---------------------------KEGEEKDLNSEAPSCLSEMTSVKEANDVSLKETVS----LKKEEQSNSIKKV-PEHDGTEMSEATDATDISEASDQDNKKAGEVAEDSEEALIAQYTYEGATTNIHPFLSAMVNYAQPVKFQSFDVAEERNIHYNMSSFNESVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEP-FVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCQIILKTYVPDGFGAIVDALSDPKKFLTIAEKRADQMKALGIDTNDIADV-PSGNS------KNDKKGKGKGDTVKT---------SVTPQASSDMAQTSNSAQN-----NTSESKKDATLVPNASIEDLKQTKAYLKLMKKQQKELNALKKKHSKEQNTMQKAHCTQVDKMVSLHEKEKSTLEKLLEKAFKKRGENNCQELKKETEDKIQTLVTEHKAK-VKEITAQHTKEWSELISGHSNKEQEMKDGHVMQQCEVLKKLLNNNQEQQTSQLKLIHERQSKEMRANQAKVSMENSKAINQDKTIKNKAERERRVRELNSSNTKKFLDERKRLAMKHQK 1175          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB1 (phospholipase C beta 1 [Source:NCBI gene;Acc:101172698])

HSP 1 Score: 361.688 bits (927), Expect = 2.065e-103
Identity = 189/451 (41.91%), Postives = 278/451 (61.64%), Query Frame = 2
Query:  314 IPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSG--VKIKDEKVLSQLQDKTQ--SNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKP-QQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILI 1648
            +PE LKKG  F  ++D+   +    L  VD  G+FL W  +  +  + D+  I D ++G   K+  +  L ++ D +     +E+R L +   +D VN+  L F+    +I   W   L  +  N+   N    T L+K + RL L +N   +IP+K + + F++ R  K V  +L+  NLP  +   +    FT E +   L+ ICPR ++  +F+ + ++ + YLT ++M  F+N  QRDPRLNEILYP      VQ ++D YE N     +G++SV+ F RYL  +EN+ +  ++LD  +DM  PL+HY+INSSHNTYLT  Q  G SSV+MY+QVLL+GCRC+ELDCW G+  ++EP+ITHG  M ++I F++VI AI +CAF TSP+P+ LSFENH   P QQ K+A+YC  + G+ LL +P+EK+QLEAGVPLPSP +L  KILI
Sbjct:   18 VPECLKKGNKFMKWEDDSTAVTPVTLT-VDPKGYFLYWTDQNKDTDLLDVAFIKDARNGKFCKMPKDAKLREVLDISTLVGKLENRMLTVVSGTDMVNITYLNFMAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPVKNIFRIFSADR--KRVETALESCNLPSGRNESIPQEDFTPEVYSMFLSNICPRPELDHIFSEIGAKSRPYLTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRYLNGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRCIELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPKQQAKMAEYCRSIFGDALLMEPLEKYQLEAGVPLPSPMELMGKILI 465          

HSP 2 Score: 345.125 bits (884), Expect = 6.354e-98
Identity = 183/439 (41.69%), Postives = 267/439 (60.82%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAI--FEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHK 3499
            +S+LV Y QPVKF  F    +    + MSSF ET AL  +    +E V YNK QLSRIYP+G RVDSSN+ PQ+FWNAGCQ+VALNFQ+ DL+MQLN G FEYN   GY LKPEFMRR ++ FDPF+ES +DG++A T  VKI+SGQFLS+KK+GTYVE+DM+GLP DT RK F+T+    N +NP++ E++  VF+KV+LP LA LRI VFEE GK IG R+ P   ++ G+ +I+LR+E N    L SLF  + +  YVPD FA  ++ALS+P  +++  E +   +A +  E    ++      + +   T+ ++ R     G     + G+      +K  S V     ++   +    K++D     +   E  T E L + K+ V+  ++Q KE   L ++  ++  E++K H+    +L+    +++S + K
Sbjct:  569 MSNLVLYIQPVKFHSFETSKKINRSYQMSSFVETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVDLSMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEA-IVFKKVVLPTLASLRIAVFEEGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEALSNPIRYVNLMEQRANQLAALTLEEGGEEEGDKEVEAGSDAPTESKVDR-----GVVQPAENGLETPIIPSKPPSLVG--PTQSAGSLKPAAKTEDIIQSVLTELEAHTVEELKQQKSFVREQRKQYKEMKELVRKHHRKTGEMIKEHTARISELQGQHQRRRSALQK 999          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB1 (phospholipase C beta 1 [Source:NCBI gene;Acc:101172698])

HSP 1 Score: 361.688 bits (927), Expect = 3.391e-103
Identity = 189/451 (41.91%), Postives = 278/451 (61.64%), Query Frame = 2
Query:  314 IPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSG--VKIKDEKVLSQLQDKTQ--SNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKP-QQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILI 1648
            +PE LKKG  F  ++D+   +    L  VD  G+FL W  +  +  + D+  I D ++G   K+  +  L ++ D +     +E+R L +   +D VN+  L F+    +I   W   L  +  N+   N    T L+K + RL L +N   +IP+K + + F++ R  K V  +L+  NLP  +   +    FT E +   L+ ICPR ++  +F+ + ++ + YLT ++M  F+N  QRDPRLNEILYP      VQ ++D YE N     +G++SV+ F RYL  +EN+ +  ++LD  +DM  PL+HY+INSSHNTYLT  Q  G SSV+MY+QVLL+GCRC+ELDCW G+  ++EP+ITHG  M ++I F++VI AI +CAF TSP+P+ LSFENH   P QQ K+A+YC  + G+ LL +P+EK+QLEAGVPLPSP +L  KILI
Sbjct:   18 VPECLKKGNKFMKWEDDSTAVTPVTLT-VDPKGYFLYWTDQNKDTDLLDVAFIKDARNGKFCKMPKDAKLREVLDISTLVGKLENRMLTVVSGTDMVNITYLNFMAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPVKNIFRIFSADR--KRVETALESCNLPSGRNESIPQEDFTPEVYSMFLSNICPRPELDHIFSEIGAKSRPYLTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRYLNGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRCIELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPKQQAKMAEYCRSIFGDALLMEPLEKYQLEAGVPLPSPMELMGKILI 465          

HSP 2 Score: 345.51 bits (885), Expect = 1.062e-97
Identity = 183/439 (41.69%), Postives = 267/439 (60.82%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAI--FEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHK 3499
            +S+LV Y QPVKF  F    +    + MSSF ET AL  +    +E V YNK QLSRIYP+G RVDSSN+ PQ+FWNAGCQ+VALNFQ+ DL+MQLN G FEYN   GY LKPEFMRR ++ FDPF+ES +DG++A T  VKI+SGQFLS+KK+GTYVE+DM+GLP DT RK F+T+    N +NP++ E++  VF+KV+LP LA LRI VFEE GK IG R+ P   ++ G+ +I+LR+E N    L SLF  + +  YVPD FA  ++ALS+P  +++  E +   +A +  E    ++      + +   T+ ++ R     G     + G+      +K  S V     ++   +    K++D     +   E  T E L + K+ V+  ++Q KE   L ++  ++  E++K H+    +L+    +++S + K
Sbjct:  569 MSNLVLYIQPVKFHSFETSKKINRSYQMSSFVETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVDLSMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEA-IVFKKVVLPTLASLRIAVFEEGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEALSNPIRYVNLMEQRANQLAALTLEEGGEEEGDKEVEAGSDAPTESKVDR-----GVVQPAENGLETPIIPSKPPSLVG--PTQSAGSLKPAAKTEDIIQSVLTELEAHTVEELKQQKSFVREQRKQYKEMKELVRKHHRKTGEMIKEHTARISELQGQHQRRRSALQK 999          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: PLCB1 (phospholipase C beta 1 [Source:NCBI gene;Acc:101172698])

HSP 1 Score: 360.918 bits (925), Expect = 5.729e-103
Identity = 189/451 (41.91%), Postives = 278/451 (61.64%), Query Frame = 2
Query:  314 IPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSG--VKIKDEKVLSQLQDKTQ--SNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSL-SEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKP-QQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILI 1648
            +PE LKKG  F  ++D+   +    L  VD  G+FL W  +  +  + D+  I D ++G   K+  +  L ++ D +     +E+R L +   +D VN+  L F+    +I   W   L  +  N+   N    T L+K + RL L +N   +IP+K + + F++ R  K V  +L+  NLP  +   +    FT E +   L+ ICPR ++  +F+ + ++ + YLT ++M  F+N  QRDPRLNEILYP      VQ ++D YE N     +G++SV+ F RYL  +EN+ +  ++LD  +DM  PL+HY+INSSHNTYLT  Q  G SSV+MY+QVLL+GCRC+ELDCW G+  ++EP+ITHG  M ++I F++VI AI +CAF TSP+P+ LSFENH   P QQ K+A+YC  + G+ LL +P+EK+QLEAGVPLPSP +L  KILI
Sbjct:   18 VPECLKKGNKFMKWEDDSTAVTPVTLT-VDPKGYFLYWTDQNKDTDLLDVAFIKDARNGKFCKMPKDAKLREVLDISTLVGKLENRMLTVVSGTDMVNITYLNFMAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPVKNIFRIFSADR--KRVETALESCNLPSGRNESIPQEDFTPEVYSMFLSNICPRPELDHIFSEIGAKSRPYLTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRYLNGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRCIELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPKQQAKMAEYCRSIFGDALLMEPLEKYQLEAGVPLPSPMELMGKILI 465          

HSP 2 Score: 337.421 bits (864), Expect = 3.257e-95
Identity = 157/292 (53.77%), Postives = 207/292 (70.89%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANM 3064
            +S+LV Y QPVKF  F    +    + MSSF ET AL  +    +E V YNK QLSRIYP+G RVDSSN+ PQ+FWNAGCQ+VALNFQ+ DL+MQLN G FEYN   GY LKPEFMRR ++ FDPF+ES +DG++A T  VKI+SGQFLS+KK+GTYVE+DM+GLP DT RK F+T+    N +NP++ E++  VF+KV+LP LA LRI VFEE GK IG R+ P   ++ G+ +I+LR+E N    L SLF  + +  YVPD FA  ++ALS+P  +++  E +   +A +
Sbjct:  563 MSNLVLYIQPVKFHSFETSKKINRSYQMSSFVETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVDLSMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEA-IVFKKVVLPTLASLRIAVFEEGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEALSNPIRYVNLMEQRANQLAAL 853          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Match: ENSORLT00000042446.1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 [Source:NCBI gene;Acc:101175365])

HSP 1 Score: 347.436 bits (890), Expect = 7.469e-99
Identity = 188/431 (43.62%), Postives = 265/431 (61.48%), Query Frame = 2
Query: 2189 LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVP-ANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANM----GFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTK--------INSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITP---ESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLK 3433
            +S+LVNY QP KF  F    +   C+HMSSF ET AL H+    +E V YNK QLSRIYP+G RVDSSNF+PQ+FWNAGCQ+VALN+Q+ DL+MQLN   FEYN  SGY LKPEFMRR ++ FDPF+E+ +DG++A T  VK+ISGQFL+E+++G YVEV+M+GLP DT RK  +T+     N +NP++ E+   VF+KVILP LA LRI  FEE GK IG  ++P+  ++ G+R+I LR+E N    L ++F  I +  YVPD FA  ++ALS+P  +++  E + K +A +    G E ++ +D + ST+   K+   K          T S  + G    ++T K          ++  +  V+ E+LV S           +  E+ P   E L ++K   K  +RQ KE   L +R  K+ +ELL+
Sbjct:  532 MSTLVNYVQPTKFNSFEASKKAARCYHMSSFVETKALEHLTKSPVEFVEYNKSQLSRIYPKGTRVDSSNFMPQLFWNAGCQLVALNYQTIDLSMQLNLFMFEYNGRSGYRLKPEFMRRPDKHFDPFTENTVDGIVANTLSVKVISGQFLTERRVGVYVEVEMFGLPADTRRKALKTKTSQNNNAINPVWDEEP-IVFKKVILPTLASLRIAAFEEGGKFIGHHIIPVSAIRPGYRYIGLRNERNQSLMLPAVFVYIEVKDYVPDTFADVIEALSNPIRYVNLLEQRSKQLAALTLEDGEEEAQTEDEADSTT--EKRADLKPATVENGLSPTSS--QAGHTPAATTPKASSANQQAAAADPAKASVKTEDLVLS-----------VLIEVPPCLLEHLQQSKLYSKEQRRQFKELKELSRRHQKKTSELLR 946          

HSP 2 Score: 333.954 bits (855), Expect = 2.546e-94
Identity = 183/455 (40.22%), Postives = 270/455 (59.34%), Query Frame = 2
Query:  311 NIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSG--VKIKDEKVLSQLQDKTQ--SNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHC-SKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKR 1660
            ++   L+ G+ F  +D++L+ +     + VD  GF+L W  +  +  + D+ ++ DV++G   K   E  L +L D       +E+R + +   SD VN++ L FI         W   L S+  N+ + N+     L K ++RL L +N + +IP+K + + F+S R  K V  +L    LP  +   +    FT E + + L+ +CPR ++ ++F         L+ D+M  F+N  QRDPRLNEILYP         +++ ++L+     +G IS+  F  YL SDEN  +  ++LD  +DM  P++HY+INSSHNTYLT  Q  G SSV+MYRQVLLAGCRCVELD W G+  ++EP+ITHG  M S+I F++VI AI +CAF TS +PV LSFENH  S  QQ K+A+YC  + G+ LL  P++K+ LEAGV LPSP +L  KILIKNK+
Sbjct:   17 SVSHTLRNGSNFIKWDEDLSTV-TPVTLHVDPNGFYLYWTDQNKDTELLDLTVVKDVRTGRSTKTTKEAKLRELLDVGNLVGRLENRMVTVVTASDLVNVNQLNFIASQEDEAKVWCEELFSLSSNLLSHNLNRDQSLLKAYVRLTLQLNTDGRIPVKNIVRLFSSDR--KRVETALDSCRLPYGRGDSIRVEDFTLEVYKSFLDSLCPRPELGNIFKLQGGNGGMLSIDQMTEFINNKQRDPRLNEILYPPFRPAQTLSLMERHQLDQAELKRGLISLQAFSMYLSSDENGVIPPEKLDQSEDMSFPMSHYFINSSHNTYLTAGQLAGSSSVEMYRQVLLAGCRCVELDVWKGRTAEEEPVITHGFTMTSEISFKEVIEAIAECAFKTSLFPVILSFENHVDSLKQQAKMAEYCRSIFGDALLIDPLDKYPLEAGVALPSPLELMGKILIKNKK 468          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000024212.1 (SMESG000024212.1)

HSP 1 Score: 2379.36 bits (6165), Expect = 0.000e+0
Identity = 1209/1246 (97.03%), Postives = 1213/1246 (97.35%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNRXXXXXXXXXXXXXXXXFEFIEE 3976
            MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSEDDDDDDDDAEAEAEINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANG +          F +++L                     VLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHLNAEQNLKLLNQQQLKEAYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNRQVELLEQKHEEQKKRLFEFIEE
Sbjct:    1 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEIAEDPDLIAGEDGALNVVSSEDDDDDDDDAEAEAEINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGKS----------FYQILL---------------------VLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHLNAEQNLKLLNQQQLKEAYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNRQVELLEQKHEEQKKRLFEFIEE 1215          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 1336.63 bits (3458), Expect = 0.000e+0
Identity = 671/1228 (54.64%), Postives = 878/1228 (71.50%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDL-EIAEDPD---LIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            MTSDIAKRQRTVPSSK +EF WR+ + ++L  GA FD YD++ N LE NCLV+VDE+GFF+ WKSE+ E  V D+  +SDV+ G K K++K+ + L ++  + ++DR + I   +D VN+     + +D++I  FW+ +LR + HN K  N+CPM QLKKHWLRLCL V  N  IP++ ++KTFASG+ EK++FQSLKEL LP  K  ++DPS FTFEKFY L + ICPRTDI+++F  LS  KD++T +++I +LNE QRDPRLNEIL+P++N+++V+YILD  E +   + +G++S++CFYRYLMSD+NAPVFLDRL++ QDMDQPLAHYYINSSHNTYLTGRQF GKSSV++YRQVLL+GCRC+ELDCWDGKG+DQEPIITHGKAMC+DILF+DVIYAIRD AFVTS  P+ LSFENHCSKPQQYK+AKYCE+VLG+ LLTKPI+KH+L   VPLPSP KL+ KILIKNKRL  E EK QL+MFLKGQT++ Q+  E AEDPD   ++ GEDG +N +                                         N  II  N  + +  + K E N    +   E S+ +  + VK +K    +K+++K       G  +AE   ++Q +   Y +   TTN+HPYLS++VNY QPVKF GF+I  E+   FHMSSFSET ALG++KN+AIE VNYNK QLSRIYPRGNRVDS+NF+PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN NSGY+LKPEFMRR ER+FDPFSESPMDGVIAAT E+KIISGQFLS+KK+GTYVEVDMYGLPTDT RKEFRTRVVP NGLNP+Y +DS F+FRKV+LPDLAVLRIGV+E+TGKLIGQRVLPL+GLQ+G+RHISLR+EGNFP +L ++FCKIT +TY+P+G    VDALSDPRA++S+EE ++K +A+MG ETS+I D+   T+    K+   +     + +    N+     Q +++T          V    + +S NK  D KD+  F+ I+   L   KT  K +KRQ +E  NL+K+  K+   L KS ++ T+KL +   ++ +   K K EN+    + +    +M+ L + +  E   +   H   E +L +   +  +E  LKV+ ++Q  Q+K L+++Q+RE+KEM  QQTK+S++AN+ VI D   +NKAERDRR+REL D N KRF+DQR+AQ  K +R
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEI-----------------------------------------NPTIIVKNDTDPHPEMHKTELNGLLKVK--EQSDTQLNIKVKEEKEPDSRKNASKK------GSLTAE---EEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEEEAYHFHMSSFSETVALGYLKNEAIEFVNYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDV--PTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNST----------VSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGENEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDR 1164          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 1320.45 bits (3416), Expect = 0.000e+0
Identity = 663/1228 (53.99%), Postives = 872/1228 (71.01%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDL-EIAEDPD---LIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            MTSDIAKRQRTVPSSK +EF WR+ + ++L  GA FD YD++ N LE NCLV+VDE+GFF+ WKSE+ E  V D+  +SDV+ G K K++K+ + L ++  + ++DR + I   +D VN+     + +D++I  FW+ +LR + HN K  N+CPM QLKKHWLRLCL V  N  IP++ ++KTFASG+ EK++FQSLKEL LP  K  ++DPS FTFEKFY L + ICPRTDI+++F  LS  KD++T +++I +LNE QRDPRLNEIL+P++N+++V+YILD  E +   + +G++S++CFYRYLMSD+NAPVFLDRL++ QDMDQPLAHYYINSSHNTYLTGRQF GKSSV++YRQVLL+GCRC+ELDCWDGKG+DQEPIITHGKAMC+DILF+DVIYAIRD AFVTS  P+ LSFENHCSKPQQYK+AKYCE+VLG+ LLTKPI+KH+L   VPLPSP KL+ KILIKNKRL  E EK QL+MFLKGQT++ Q+  E AEDPD   ++ GEDG +N +                                         N  II  N  + +  + K E N    +   E S+ +  + VK +K    +K+++K       G  +AE   ++Q +   Y +   TTN+HPYLS++VNY QPVKF GF+I  +    +HMSSF+E   LG ++ D I LV+YNK QLSRIYPRGNRVDS+NF+PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN NSGY+LKPEFMRR ER+FDPFSESPMDGVIAAT E+KIISGQFLS+KK+GTYVEVDMYGLPTDT RKEFRTRVVP NGLNP+Y +DS F+FRKV+LPDLAVLRIGV+E+TGKLIGQRVLPL+GLQ+G+RHISLR+EGNFP +L ++FCKIT +TY+P+G    VDALSDPRA++S+EE ++K +A+MG ETS+I D+   T+    K+   +     + +    N+     Q +++T          V    + +S NK  D KD+  F+ I+   L   KT  K +KRQ +E  NL+K+  K+   L KS ++ T+KL +   ++ +   K K EN+    + +    +M+ L + +  E   +   H   E +L +   +  +E  LKV+ ++Q  Q+K L+++Q+RE+KEM  QQTK+S++AN+ VI D   +NKAERDRR+REL D N KRF+DQR+AQ  K +R
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEI-----------------------------------------NPTIIVKNDTDPHPEMHKTELNGLLKVK--EQSDTQLNIKVKEEKEPDSRKNASKK------GSLTAE---EEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDV--PTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNST----------VSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGENEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDR 1164          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 1315.83 bits (3404), Expect = 0.000e+0
Identity = 671/1267 (52.96%), Postives = 879/1267 (69.38%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDL-EIAEDPD---LIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIE---------------------------------------LVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            MTSDIAKRQRTVPSSK +EF WR+ + ++L  GA FD YD++ N LE NCLV+VDE+GFF+ WKSE+ E  V D+  +SDV+ G K K++K+ + L ++  + ++DR + I   +D VN+     + +D++I  FW+ +LR + HN K  N+CPM QLKKHWLRLCL V  N  IP++ ++KTFASG+ EK++FQSLKEL LP  K  ++DPS FTFEKFY L + ICPRTDI+++F  LS  KD++T +++I +LNE QRDPRLNEIL+P++N+++V+YILD  E +   + +G++S++CFYRYLMSD+NAPVFLDRL++ QDMDQPLAHYYINSSHNTYLTGRQF GKSSV++YRQVLL+GCRC+ELDCWDGKG+DQEPIITHGKAMC+DILF+DVIYAIRD AFVTS  P+ LSFENHCSKPQQYK+AKYCE+VLG+ LLTKPI+KH+L   VPLPSP KL+ KILIKNKRL  E EK QL+MFLKGQT++ Q+  E AEDPD   ++ GEDG +N +                                         N  II  N  + +  + K E N    +   E S+ +  + VK +K    +K+++K       G  +AE   ++Q +   Y +   TTN+HPYLS++VNY QPVKF GF+I  E+   FHMSSFSET ALG++KN+AIE                                       LV+YNK QLSRIYPRGNRVDS+NF+PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN NSGY+LKPEFMRR ER+FDPFSESPMDGVIAAT E+KIISGQFLS+KK+GTYVEVDMYGLPTDT RKEFRTRVVP NGLNP+Y +DS F+FRKV+LPDLAVLRIGV+E+TGKLIGQRVLPL+GLQ+G+RHISLR+EGNFP +L ++FCKIT +TY+P+G    VDALSDPRA++S+EE ++K +A+MG ETS+I D+   T+    K+   +     + +    N+     Q +++T          V    + +S NK  D KD+  F+ I+   L   KT  K +KRQ +E  NL+K+  K+   L KS ++ T+KL +   ++ +   K K EN+    + +    +M+ L + +  E   +   H   E +L +   +  +E  LKV+ ++Q  Q+K L+++Q+RE+KEM  QQTK+S++AN+ VI D   +NKAERDRR+REL D N KRF+DQR+AQ  K +R
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEI-----------------------------------------NPTIIVKNDTDPHPEMHKTELNGLLKVK--EQSDTQLNIKVKEEKEPDSRKNASKK------GSLTAE---EEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEEEAYHFHMSSFSETVALGYLKNEAIEFCFVLMHDYILLLDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDV--PTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNST----------VSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGENEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDR 1203          
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Match: SMESG000049234.1 (SMESG000049234.1)

HSP 1 Score: 1311.21 bits (3392), Expect = 0.000e+0
Identity = 671/1279 (52.46%), Postives = 879/1279 (68.73%), Query Frame = 2
Query:  239 MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNCLVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKTQSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAANICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKELNLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTNDRMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVDCFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGKSSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIYAIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKHQLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDL-EIAEDPD---LIAGEDGALNVVSSXXXXXXXXXXXXXXXINRLKSYEICGSKQTRFSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVKHKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPYLSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIE---------------------------------------------------LVNYNKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGRFEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLSEKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVILPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSSLFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIKDLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQIKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFSNLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQRSIQEMLSLTEKNEQEKNKLCFNHXXXXXXXXXXXXXXXXXXYLKVLSQLQLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRLRELCDYNAKRFLDQRRAQQMKHNR 3910
            MTSDIAKRQRTVPSSK +EF WR+ + ++L  GA FD YD++ N LE NCLV+VDE+GFF+ WKSE+ E  V D+  +SDV+ G K K++K+ + L ++  + ++DR + I   +D VN+     + +D++I  FW+ +LR + HN K  N+CPM QLKKHWLRLCL V  N  IP++ ++KTFASG+ EK++FQSLKEL LP  K  ++DPS FTFEKFY L + ICPRTDI+++F  LS  KD++T +++I +LNE QRDPRLNEIL+P++N+++V+YILD  E +   + +G++S++CFYRYLMSD+NAPVFLDRL++ QDMDQPLAHYYINSSHNTYLTGRQF GKSSV++YRQVLL+GCRC+ELDCWDGKG+DQEPIITHGKAMC+DILF+DVIYAIRD AFVTS  P+ LSFENHCSKPQQYK+AKYCE+VLG+ LLTKPI+KH+L   VPLPSP KL+ KILIKNKRL  E EK QL+MFLKGQT++ Q+  E AEDPD   ++ GEDG +N +                                         N  II  N  + +  + K E N    +   E S+ +  + VK +K    +K+++K       G  +AE   ++Q +   Y +   TTN+HPYLS++VNY QPVKF GF+I  E+   FHMSSFSET ALG++KN+AIE                                                   LV+YNK QLSRIYPRGNRVDS+NF+PQIFWNAGCQMVALNFQ+ DLAMQLNQG+FEYN NSGY+LKPEFMRR ER+FDPFSESPMDGVIAAT E+KIISGQFLS+KK+GTYVEVDMYGLPTDT RKEFRTRVVP NGLNP+Y +DS F+FRKV+LPDLAVLRIGV+E+TGKLIGQRVLPL+GLQ+G+RHISLR+EGNFP +L ++FCKIT +TY+P+G    VDALSDPRA++S+EE ++K +A+MG ETS+I D+   T+    K+   +     + +    N+     Q +++T          V    + +S NK  D KD+  F+ I+   L   KT  K +KRQ +E  NL+K+  K+   L KS ++ T+KL +   ++ +   K K EN+    + +    +M+ L + +  E   +   H   E +L +   +  +E  LKV+ ++Q  Q+K L+++Q+RE+KEM  QQTK+S++AN+ VI D   +NKAERDRR+REL D N KRF+DQR+AQ  K +R
Sbjct:    1 MTSDIAKRQRTVPSSKAFEFNWRQPVSDDLINGAHFDRYDEDSNSLESNCLVRVDEYGFFVHWKSEQGEGQVLDLSQVSDVRFGSKPKEDKICAVLLERISNPLDDRIVTICSGTDLVNISYTHMVSQDNEIATFWINNLRPLTHNTKMNNVCPMIQLKKHWLRLCLGVKANGMIPVRSISKTFASGKTEKIIFQSLKELGLPFGKNDEIDPSSFTFEKFYELYHKICPRTDIEEIFKELSNSKDFITTEKIIEYLNEVQRDPRLNEILFPFANKDTVKYILDNNEPSEEYRKEGKLSIECFYRYLMSDDNAPVFLDRLNICQDMDQPLAHYYINSSHNTYLTGRQFGGKSSVEIYRQVLLSGCRCIELDCWDGKGEDQEPIITHGKAMCTDILFKDVIYAIRDTAFVTSEMPIILSFENHCSKPQQYKLAKYCEDVLGDLLLTKPIDKHELSQAVPLPSPLKLRKKILIKNKRLKPEVEKQQLEMFLKGQTEIIQEENENAEDPDPLVMVDGEDGPMNEI-----------------------------------------NPTIIVKNDTDPHPEMHKTELNGLLKVK--EQSDTQLNIKVKEEKEPDSRKNASKK------GSLTAE---EEQAMLAQYHYIGATTNIHPYLSAMVNYTQPVKFQGFDIAEEEAYHFHMSSFSETVALGYLKNEAIEFVKYPKFLFFPLNCFVLMHDYILLLDLNIHYHMSSFNENVGLGLIRRDCIALVDYNKRQLSRIYPRGNRVDSANFMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNSGYLLKPEFMRRPERSFDPFSESPMDGVIAATLEIKIISGQFLSDKKVGTYVEVDMYGLPTDTFRKEFRTRVVPNNGLNPIYGDDSVFLFRKVVLPDLAVLRIGVYEDTGKLIGQRVLPLEGLQSGYRHISLRTEGNFPLSLPTIFCKITQTTYIPEGLVDLVDALSDPRAYLSKEEKRMKQLADMGIETSDIVDV--PTTGKPFKKPPDKKSENSNQEPLTPNLANKSGQSNNST----------VSTPVVGFSNNKKDDKKDEPKFDNISLVLLETDKTFQKLIKRQTRELENLRKKHEKDSAILHKSQTIVTDKLNANHAREINKKVKVKGENEESDMIEEVQKNQMVDLVKTHTDEWTSMKLQHRKEEHDLCMSFLESRQELLLKVMKEVQEDQKKELKIIQEREIKEMKAQQTKASIDANKNVINDRKLKNKAERDRRIRELNDINTKRFIDQRKAQAQKQDR 1215          
The following BLAST results are available for this feature:
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB43.264e-17357.14phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB42.375e-17357.14phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB42.375e-17357.14phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB42.137e-17357.14phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB42.137e-17357.14phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-81.784e-746.181-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-81.896e-746.381-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-82.104e-745.001-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-82.038e-745.191-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
egl-86.142e-15246.211-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
norpA1.823e-16552.43gene:FBgn0262738 transcript:FBtr0343599[more]
norpA1.823e-16552.43gene:FBgn0262738 transcript:FBtr0100670[more]
norpA1.823e-16552.43gene:FBgn0262738 transcript:FBtr0100671[more]
norpA2.116e-16252.02gene:FBgn0262738 transcript:FBtr0070651[more]
norpA2.116e-16252.02gene:FBgn0262738 transcript:FBtr0301475[more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB41.049e-16355.33phospholipase C beta 4 [Source:NCBI gene;Acc:10053... [more]
plcb33.880e-9938.17phospholipase C, beta 3 (phosphatidylinositol-spec... [more]
plcb33.937e-9938.17phospholipase C, beta 3 (phosphatidylinositol-spec... [more]
plch14.606e-9133.47phospholipase C, eta 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
CABZ01072157.15.880e-8951.00pep chromosome:GRCz11:17:2348540:2386569:-1 gene:E... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r16b2.226e-16456.70protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b7.669e-16456.70protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b1.505e-16456.70protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b4.054e-16456.70protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16b5.509e-16156.70protein phosphatase 1 regulatory subunit 16B [Sour... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plcb46.857e-17257.56phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb46.857e-17257.56phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb41.879e-15757.56phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb49.386e-14957.81phospholipase C, beta 4 [Source:MGI Symbol;Acc:MGI... [more]
Plcb11.638e-10745.00phospholipase C, beta 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15147|PLCB4_HUMAN1.026e-17257.141-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|Q9QW07|PLCB4_RAT8.088e-17157.351-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|Q07722|PLCB4_BOVIN1.011e-17347.881-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|P13217|PIPA_DROME2.121e-16152.021-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
sp|G5EBH0|PLCB_CAEEL2.266e-14446.211-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CYF80.000e+053.461-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
A0A074ZXA50.000e+053.501-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
A0A4S2KEP20.000e+053.261-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
A0A0X3P0N30.000e+052.761-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
A0A0R3U5L30.000e+050.971-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB40.000e+049.07phospholipase C beta 4 [Source:NCBI gene;Acc:10302... [more]
PLCB40.000e+048.90phospholipase C beta 4 [Source:NCBI gene;Acc:10302... [more]
PLCB40.000e+047.531-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
PLCB40.000e+047.041-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
PLCB41.855e-15458.40phospholipase C beta 4 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB41.145e-16845.79phospholipase C beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB13.592e-10540.81phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGN... [more]
PLCB15.743e-9554.27phospholipase C beta 1 [Source:HGNC Symbol;Acc:HGN... [more]
PLCD46.862e-5342.86phospholipase C delta 4 [Source:HGNC Symbol;Acc:HG... [more]
plcd3b1.236e-4942.15phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PLC12.857e-2942.24Phospholipase C; hydrolyzes phosphatidylinositol 4... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422371.462e-11744.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438132.052e-11359.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382295.588e-5437.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289633.067e-5240.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315562.010e-5039.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCB40.000e+048.06phospholipase C beta 4 [Source:NCBI gene;Acc:10004... [more]
PLCB12.065e-10341.91phospholipase C beta 1 [Source:NCBI gene;Acc:10117... [more]
PLCB13.391e-10341.91phospholipase C beta 1 [Source:NCBI gene;Acc:10117... [more]
PLCB15.729e-10341.91phospholipase C beta 1 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000042446.17.469e-9943.621-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024212.10.000e+097.03SMESG000024212.1[more]
SMESG000049234.10.000e+054.64SMESG000049234.1[more]
SMESG000049234.10.000e+053.99SMESG000049234.1[more]
SMESG000049234.10.000e+052.96SMESG000049234.1[more]
SMESG000049234.10.000e+052.46SMESG000049234.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029890 ID=SMED30029890|Name=1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=5190bp
GTCTAATAATTTCCTATTGATTTTTCTGTATAAAATATTAAGAAATATAA
TTATATATAAGTTATATATAAATTTTGATTTTAAATCTCTTCAATAATAT
TTTAATCATTTTTTCTCTCGACAATGCGGATATTTGCCGGATGTAAAATA
AATAAATGATTCCAGTGTTTTCTAATTAAATTAATCAATGAATTGAGGAA
TTTTATTTTGTAATTTATCAAAATTTACAATTTGATTTATGACGTCTGAC
ATAGCGAAACGTCAGCGGACGGTACCCAGCTCAAAAATATATGAATTTCA
GTGGCGTAGAAATATTCCAGAAGAATTAAAAAAAGGAGCACTATTTGATT
TCTATGATGATGAACTGAATATTTTAGAAGTAAATTGTCTTGTAAAAGTT
GATGAGTTTGGATTCTTTCTCTCGTGGAAAAGTGAAAAATCGGAGGCGTA
TGTGTATGACATGCCACTTATCAGTGATGTAAAATCTGGAGTGAAAATAA
AGGATGAAAAAGTTCTGAGCCAATTGCAAGATAAAACCCAGTCAAACATA
GAAGATCGCACGCTGGTGATTTCCGTCAATTCGGATTTTGTCAATCTTCA
CACGTTACTTTTTATTGGGAAGGATTCAAAAATTGTAAATTTTTGGGTGA
CATCTTTACGATCAGTTTTTCACAATATCAAAGCAGCTAACATATGTCCA
ATGACACAACTCAAAAAACACTGGCTCAGATTATGCTTGCTAGTCAATGT
CAATAACAAAATTCCGCTTAAACTTGTAGCCAAAACTTTTGCATCCGGTA
GAAACGAGAAATTGGTGTTTCAAAGTCTTAAAGAATTGAATCTTCCATGT
GAAAAGACTGCAGATGTCGATCCAAGTCAGTTCACATTTGAAAAGTTCTA
TAATCTTTTAAATATGATCTGCCCAAGAACAGATATACAAGATTTATTTA
ACAGTTTGTCTGAAGGTAAAGATTATTTAACCAATGACAGAATGATTCGG
TTTTTGAATGAAACTCAAAGAGATCCACGACTAAATGAAATTCTATATCC
ATATTCGAACAGAAATTCTGTACAATATATTCTTGATACTTATGAATTAA
ATCCCGTGAGAAAAAGCCAAGGAGAAATATCAGTTGACTGTTTTTATCGA
TACCTTATGAGCGATGAAAACGCCCCAGTATTTCTAGATCGTCTGGACCT
TCATCAAGACATGGATCAACCTTTAGCTCACTATTACATAAATTCTTCAC
ATAATACATACTTAACTGGAAGACAGTTCAGAGGAAAATCTTCAGTTGAT
ATGTATCGCCAAGTTTTATTAGCAGGATGTCGATGCGTTGAGCTGGATTG
TTGGGATGGGAAAGGCGATGATCAGGAACCGATTATAACGCACGGGAAAG
CTATGTGTTCTGATATTTTATTTAGGGATGTAATTTACGCAATTCGTGAT
TGCGCTTTTGTCACCAGTCCATATCCGGTATTTTTATCCTTTGAAAATCA
TTGCAGCAAGCCTCAACAGTACAAAATTGCAAAATATTGTGAAGAAGTTC
TAGGGGAATATTTGTTGACAAAACCAATTGAAAAACATCAACTTGAAGCC
GGAGTCCCACTTCCATCTCCAGAAAAACTGAAATACAAAATTCTAATTAA
AAATAAGCGATTGCCACAAGAAACTGAAAAAATCCAGTTGGATATGTTTC
TAAAAGGACAAACAGATTTGACTCAAGATTTGGAAATTGCTGAAGATCCC
GACTTGATTGCTGGTGAAGATGGAGCTTTAAATGTTGTCTCTTCGGAGGA
TGACGACGATGATGACGACGATGCCGAAGCCGAGGCTGAAATCAACAGAT
TAAAATCTTATGAAATTTGCGGATCAAAACAAACAAGATTTTCATTTTCT
AGCAGTGTACCAAATACTCCAATTATCAACAGCAACATCCTAGAAGCAAA
TATAGGCATTCTAAAGCAGGAAACCAATAGTCATAGTCATATAACCAAAA
TGGAGTCTTCGAATGCTGAATCAACTGTAATTGTGAAACATAAGAAATAT
TTACATGAGAAAAAGAGCTCGGCCAAGGATTTGACATCATTAATGGTCGG
CGATGAATCTGCAGAAATAGAGAAAGACGATCAAACTGTTGGAATGAATT
ATAGACACACAAGTGGCACCACAAACGTACATCCCTACCTCTCTTCATTG
GTAAATTATGCACAGCCTGTAAAATTTCTTGGTTTCAACATTCCCCCAGA
GAAACGTTGTTGCTTCCACATGTCATCCTTCAGTGAGACTGCAGCTCTCG
GACACATGAAGAACGATGCTATTGAACTTGTCAATTACAATAAATACCAA
CTAAGCCGAATTTATCCCAGAGGAAACAGAGTTGATTCAAGTAACTTCCT
GCCACAAATTTTTTGGAATGCTGGATGTCAAATGGTTGCTTTGAATTTTC
AGAGTTCAGATTTAGCTATGCAATTAAATCAAGGCCGTTTTGAATATAAC
AATAATTCTGGTTATATGTTGAAACCGGAATTCATGCGACGATCAGAAAG
AGCTTTTGATCCGTTTTCAGAATCACCGATGGATGGAGTGATTGCAGCTA
CATGTGAAGTAAAGATAATTTCCGGTCAGTTTCTTTCAGAAAAGAAAATC
GGTACATATGTTGAAGTAGATATGTATGGATTACCAACAGATACAATACG
TAAGGAATTCAGAACGAGAGTCGTGCCCGCAAATGGTCTTAATCCACTTT
ATCCCGAAGATAGCAATTTTGTTTTTAGGAAAGTCATTTTACCAGATCTT
GCTGTATTACGAATTGGTGTTTTTGAAGAAACAGGAAAGTTGATTGGACA
GAGAGTTCTTCCTCTCGATGGATTGCAGACCGGATTTCGGCATATTTCCC
TTCGAAGCGAAGGAAACTTTCCATGTGCTCTTTCATCTTTGTTTTGTAAA
ATAACGTTGTCAACTTACGTGCCTGATGGATTTGCTAGTTTCGTTGATGC
CCTATCAGATCCTAGAGCTCATATCAGTAGAGAAGAACACAAGCTTAAAC
TCATGGCAAATATGGGATTTGAAACTTCTGAAATAAAGGATCTCTCGCCT
TCTACATCATCATTGAATAAAAAACAGACAAAGAAAGAAATTATGCGGCG
ACAGTCCACAGATGGAACAGATTCCAATATGAAGTATGGAATAAATCAGG
AATCATCAACTACTAAAATAAATTCAAACGTTTATCAAATTAAAGTTCGA
AATGAAAATTTAGTTTATAGTCCAAACAAATCCAAAGATTTTAAAGATGA
TGCTATTTTTGAAGAAATCACACCCGAATCTCTAAATGAAACAAAAACGA
TTGTTAAATATTTAAAAAGACAAAATAAAGAATTCTCAAATCTGCAGAAA
CGCCAAATTAAAGAGATTAATGAACTATTGAAGTCGCACTCCTTAAGCAC
CGAGAAATTGGAAAGTTGTCTTGGAAAACAAAAATCAATAATGCATAAAA
AGAAAACCGAAAATCAAATGAAAATCGACATGAATCAAAGAAGCATTCAA
GAAATGTTAAGTCTTACGGAGAAAAATGAACAAGAAAAAAATAAATTATG
TTTCAATCATTTGAACGCTGAGCAGAACTTAAAGTTATTAAATCAGCAAC
AGTTGAAAGAAGCTTATTTAAAGGTCCTGAGTCAGTTGCAATTAGGTCAG
CGAAAATATCTTAGATTGGTTCAAAAACGCGAAGTAAAAGAAATGCATAA
TCAACAAACGAAGTCTTCAATGGAAGCAAATCGAATAGTAATAACTGACA
GTAACTTCAGAAATAAAGCAGAAAGAGATAGGCGATTGAGAGAACTTTGC
GATTACAACGCAAAGAGGTTTCTAGATCAAAGAAGAGCTCAACAAATGAA
GCACAACAGGCAAGTAGAACTTCTTGAACAGAAACATGAAGAACAAAAGA
AACGATTATTTGAATTCATTGAAGAAGTAATTAATTTAATTTCTTGTATT
TTCACTTCACTTAATGATGATATAGCGAATTCATTTCTTGTGTGGTTTTA
TTTCCTCTTTTTCGAGATCTTAAAAGATTAAGTTTAGAATAAGAATTATC
TTGGAAAGGGGATGATTCTTGGATGATTCTCGTTCATTTCAGTACATTCA
CAATTTGCATGATGATATCACTCTTTTAGCTCAAACTTTAGTAAAGTTAT
CCCTTTTATGTTTCGTTTGAAGCTTCCATATTTTACTTTTGAAAGGAGCA
AATTTCTACCTTGCTCCTGAAATAAGTTTTTGATTTTCAAATGACTTGTA
TTCAAACATTTAATATGAAAAGTTAAAATATTTCTAAATGAAATCTTCCG
AGCACGACTAATGCTAATTATGCTTGGTGCTACCATGATAGTATGTTCTC
TATCAACCAAATCTGATTTTGTAATCTGTTTTATGCTATGCCATGTTTTA
TAAAACTTTATGTCTTTCTAATCAGTGAATTCATTGAGGAAAATTGGGGC
AAGTGACTTATTTATGAAAACCTTTAAGTTTAAGAACTAAGAACTGCTTA
AACTCCCATTTTGAAATTCTTTGTCATGAAGAAAATTCGGCAGAGATATT
AACAAAAATAATAAGGAGCAGCTAGGTTAGACTATAATGAGAAAACTTGG
ATTTAACTCTTTGATTTTCTCCGGGATCCCTTTCAAAATATTAGTCGGTC
ACTATCCTGTTGGAAAATCACTTATTTACTATTAATTGAAACTACTTCAA
CTATCCTAAAGAGAATAACTTAGTATAGTTTTTGGAATTTATCCCGTTCC
TGGCTAAATAGGGATATTGTTCTTATTTAATTTAAGGTTTCACTTAAACA
TTTAATAACGGCAAATAAACCTTTAGCATGATTAAGGAATTATGTCAACA
ATTCTGATTTAGAAACTGATTCTTATTTGGTTAGAATTTCTCTGATTTCT
TAAACAATTTGTCTCAAACAAATAACTATCTTTTTCTAACTCAAGAGAAA
ATATCGAAAATATCGAAAAAGCCATCGACATCTTCATGAAATCGCGAGAT
CTTAATTTCTACTTGAATAGTTACTAGAAGATTGTAAGAAACTGAATCAT
GTTCTTTTAAAAAGTTTTTGAAAAAGTTATCATAAATCCGACAAAATTAT
TTGATTAATATACACCATTTCTAAATTGAATCTGCTATAA
back to top

protein sequence of SMED30029890-orf-1

>SMED30029890-orf-1 ID=SMED30029890-orf-1|Name=SMED30029890-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1281bp
MTSDIAKRQRTVPSSKIYEFQWRRNIPEELKKGALFDFYDDELNILEVNC
LVKVDEFGFFLSWKSEKSEAYVYDMPLISDVKSGVKIKDEKVLSQLQDKT
QSNIEDRTLVISVNSDFVNLHTLLFIGKDSKIVNFWVTSLRSVFHNIKAA
NICPMTQLKKHWLRLCLLVNVNNKIPLKLVAKTFASGRNEKLVFQSLKEL
NLPCEKTADVDPSQFTFEKFYNLLNMICPRTDIQDLFNSLSEGKDYLTND
RMIRFLNETQRDPRLNEILYPYSNRNSVQYILDTYELNPVRKSQGEISVD
CFYRYLMSDENAPVFLDRLDLHQDMDQPLAHYYINSSHNTYLTGRQFRGK
SSVDMYRQVLLAGCRCVELDCWDGKGDDQEPIITHGKAMCSDILFRDVIY
AIRDCAFVTSPYPVFLSFENHCSKPQQYKIAKYCEEVLGEYLLTKPIEKH
QLEAGVPLPSPEKLKYKILIKNKRLPQETEKIQLDMFLKGQTDLTQDLEI
AEDPDLIAGEDGALNVVSSEDDDDDDDDAEAEAEINRLKSYEICGSKQTR
FSFSSSVPNTPIINSNILEANIGILKQETNSHSHITKMESSNAESTVIVK
HKKYLHEKKSSAKDLTSLMVGDESAEIEKDDQTVGMNYRHTSGTTNVHPY
LSSLVNYAQPVKFLGFNIPPEKRCCFHMSSFSETAALGHMKNDAIELVNY
NKYQLSRIYPRGNRVDSSNFLPQIFWNAGCQMVALNFQSSDLAMQLNQGR
FEYNNNSGYMLKPEFMRRSERAFDPFSESPMDGVIAATCEVKIISGQFLS
EKKIGTYVEVDMYGLPTDTIRKEFRTRVVPANGLNPLYPEDSNFVFRKVI
LPDLAVLRIGVFEETGKLIGQRVLPLDGLQTGFRHISLRSEGNFPCALSS
LFCKITLSTYVPDGFASFVDALSDPRAHISREEHKLKLMANMGFETSEIK
DLSPSTSSLNKKQTKKEIMRRQSTDGTDSNMKYGINQESSTTKINSNVYQ
IKVRNENLVYSPNKSKDFKDDAIFEEITPESLNETKTIVKYLKRQNKEFS
NLQKRQIKEINELLKSHSLSTEKLESCLGKQKSIMHKKKTENQMKIDMNQ
RSIQEMLSLTEKNEQEKNKLCFNHLNAEQNLKLLNQQQLKEAYLKVLSQL
QLGQRKYLRLVQKREVKEMHNQQTKSSMEANRIVITDSNFRNKAERDRRL
RELCDYNAKRFLDQRRAQQMKHNRQVELLEQKHEEQKKRLFEFIEEVINL
ISCIFTSLNDDIANSFLVWFYFLFFEILKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037862PLC-beta_PH
IPR035892C2_domain_sf
IPR001192PI-PLC_fam
IPR000909PLipase_C_PInositol-sp_X_dom
IPR000008C2_dom
IPR001711PLipase_C_Pinositol-sp_Y
IPR011992EF-hand-dom_pair
IPR011993PH-like_dom_sf
IPR009535PLC-beta_CS
IPR015359PLC_EF-hand-like
IPR016280PLC-beta
IPR017946PLC-like_Pdiesterase_TIM-brl
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0006629lipid metabolic process
GO:0007165signal transduction
GO:0016042lipid catabolic process
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004435phosphatidylinositol phospholipase C activity
GO:0005509calcium ion binding
GO:0008081phosphoric diester hydrolase activity
GO:0004871signal transducer activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1212..1246
NoneNo IPR availableCOILSCoilCoilcoord: 1099..1119
NoneNo IPR availableGENE3DG3DSA:2.30.29.240coord: 14..228
e-value: 1.1E-56
score: 193.5
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 229..319
e-value: 1.5E-29
score: 103.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 953..976
NoneNo IPR availablePANTHERPTHR10336:SF1061-PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE PHOSPHODIESTERASE BETA-4coord: 20..1069
NoneNo IPR availablePROSITEPS50007PIPLC_X_DOMAINcoord: 323..473
score: 59.72
NoneNo IPR availableCDDcd08591PI-PLCc_betacoord: 322..754
e-value: 4.34552E-160
score: 476.83
NoneNo IPR availableCDDcd00275C2_PLC_likecoord: 788..908
e-value: 9.8609E-37
score: 133.05
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 25..151
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 790..906
NoneNo IPR availableSUPERFAMILYSSF69989C-terminal domain of PLC-betacoord: 1021..1249
IPR001192Phosphoinositide phospholipase C familyPRINTSPR00390PHPHLIPASECcoord: 328..346
score: 72.79
coord: 457..474
score: 58.39
coord: 354..374
score: 59.12
coord: 874..884
score: 43.4
coord: 726..744
score: 59.78
coord: 705..726
score: 60.72
IPR001192Phosphoinositide phospholipase C familyPANTHERPTHR10336PHOSPHOINOSITIDE-SPECIFIC PHOSPHOLIPASE C FAMILY PROTEINcoord: 20..1069
IPR000008C2 domainSMARTSM00239C2_3ccoord: 788..888
e-value: 2.3E-8
score: 43.8
IPR000008C2 domainPROSITEPS50004C2coord: 774..873
score: 19.647
IPR000909Phosphatidylinositol-specific phospholipase C, X domainSMARTSM00148plcx_3coord: 323..473
e-value: 2.7E-81
score: 286.1
IPR000909Phosphatidylinositol-specific phospholipase C, X domainPFAMPF00388PI-PLC-Xcoord: 325..473
e-value: 4.6E-61
score: 204.6
IPR001711Phospholipase C, phosphatidylinositol-specific, Y domainSMARTSM00149plcy_3coord: 651..767
e-value: 5.4E-63
score: 225.3
IPR001711Phospholipase C, phosphatidylinositol-specific, Y domainPFAMPF00387PI-PLC-Ycoord: 651..765
e-value: 9.3E-40
score: 135.6
IPR001711Phospholipase C, phosphatidylinositol-specific, Y domainPROSITEPS50008PIPLC_Y_DOMAINcoord: 651..767
score: 52.3
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilyGENE3DG3DSA:3.20.20.190coord: 320..554
e-value: 1.1E-77
score: 263.4
coord: 563..778
e-value: 9.7E-51
score: 174.8
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilySUPERFAMILYSSF51695PLC-like phosphodiesterasescoord: 323..768
IPR037862PLC-beta, PH domainPFAMPF17787PH_14coord: 26..151
e-value: 9.7E-27
score: 93.4
IPR037862PLC-beta, PH domainCDDcd13361PH_PLC_betacoord: 30..154
e-value: 3.62199E-30
score: 114.204
IPR016280Phosphatidylinositol-4, 5-bisphosphate phosphodiesterase betaPIRSFPIRSF000956PLC-betacoord: 10..1255
e-value: 0.0
score: 1357.5
IPR015359Phosphoinositide-specific phospholipase C, EF-hand-like domainPFAMPF09279EF-hand_likecoord: 225..311
e-value: 1.1E-7
score: 32.2
IPR009535Phospholipase C-beta, conserved sitePFAMPF06631DUF1154coord: 1024..1060
e-value: 1.1E-6
score: 28.6
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 780..948
e-value: 1.5E-48
score: 166.7
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 152..322