Tigger transposable element derived 1

Overview
NameTigger transposable element derived 1
Smed IDSMED30029880
Length (bp)1222
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element derived 1 (SMED30029880) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element derived 1 (SMED30029880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tigger transposable element derived 1 (SMED30029880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tigger transposable element derived 1 (SMED30029880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Tigger transposable element derived 1 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 88.1965 bits (217), Expect = 3.235e-18
Identity = 86/257 (33.46%), Postives = 121/257 (47.08%), Query Frame = 2
Query:   29 CDKAKSS*KSLTLDIKLNNLRRFEAG*KLYT*GK-LFICYQQL*ILFGAVAXXXXXXXXXXXXITRNI---TSIRI*MEYFVTVWVEEQN-----------Q*RML-VFN*HHLRPEFNREKYD-KFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNIIGNSI*LK---INHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDED--LLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCI 733
            C   + S  SLTL+ KL  ++  E G      G+ L +  Q +  +  A      +        TR I    S+   ME  + VW+E+Q            Q + L +FN   ++ E   E  + KFE S GW +RFK R + HNI  + EAA+ D   A  +   L  II      K    N +      YW+++ SRTFI ++EK   GFK   D    LLG NA GDFKL+P+LIY+S N RA+    KS+  +
Sbjct:    5 CSSERKSRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFN--SMKAERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDE--TAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPV 257          
BLAST of Tigger transposable element derived 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.554e-17
Identity = 86/257 (33.46%), Postives = 121/257 (47.08%), Query Frame = 2
Query:   29 CDKAKSS*KSLTLDIKLNNLRRFEAG*KLYT*GK-LFICYQQL*ILFGAVAXXXXXXXXXXXXITRNI---TSIRI*MEYFVTVWVEEQN-----------Q*RML-VFN*HHLRPEFNREKYD-KFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNIIGNSI*LK---INHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDED--LLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCI 733
            C   + S  SLTL+ KL  ++  E G      G+ L +  Q +  +  A      +        TR I    S+   ME  + VW+E+Q            Q + L +FN   ++ E   E  + KFE S GW +RFK R + HNI  + EAA+ D   A  +   L  II      K    N +      YW+++ SRTFI ++EK   GFK   D    LLG NA GDFKL+P+LIY+S N RA+    KS+  +
Sbjct:    5 CSSERKSRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFN--SMKAERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDE--TAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPV 257          
BLAST of Tigger transposable element derived 1 vs. TrEMBL
Match: A0A3Q0HKR4 (centrosomal protein of 89 kDa isoform X2 OS=Alligator sinensis OX=38654 GN=CEP89 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.383e-20
Identity = 85/257 (33.07%), Postives = 129/257 (50.19%), Query Frame = 2
Query:   53 KSLTLDIKLNNLRRFEAG*KLYT*GKLFICYQQL*ILFGAVAXXXXXXXXXXXXITRNITS------------IRI*MEYFVTVWVEEQNQ*RM-------------LVFN*HHLRPEFNREKYDKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNII---GNSI*LKINHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDED--LLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCI 733
            KS+TL++KL+ L+R EAG +        +C  +   L G+   +  K+    K   R +T             I + ME  ++VW+E+  Q RM             L  +     P+ +    + F  S GW  RFK R N+HN+ ++ EAA+ D   A  ++++L  II   G +     N +     L+W+++ SRT+I ++EK   GFKV  D    LLGGNA GDFKL+PLL+Y+S N RA+    KSS  +
Sbjct:  182 KSITLELKLDVLKRIEAGERQNE-----VC--RALNLAGSTVRTILKNKDKIKECGRIVTPLNALKLSRSRAPIMLEMERLLSVWIEDTTQRRMPLSMLLIQKKAKSLYDDLQKKLPQGS--ASEPFIASKGWFERFKRRSNLHNVSVQGEAASGDTQAAFTYRNKLVEIIEEGGYTPQQVFNADE--TDLFWKRMPSRTYIFREEKSMPGFKVSKDRLTLLLGGNAAGDFKLKPLLVYHSENPRALKGYLKSSLPV 427          
BLAST of Tigger transposable element derived 1 vs. TrEMBL
Match: A0A1A9X369 (HTH CENPB-type domain-containing protein OS=Glossina brevipalpis OX=37001 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.715e-20
Identity = 71/196 (36.22%), Postives = 97/196 (49.49%), Query Frame = 2
Query:  215 ITRNITSIRI*MEYFVTVWVEEQNQ*RMLV------------FN*HHLRPEFN-------REKYDKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNIIGNSI*LKINHES**DG----------LYWEQLSSRTFILKQEKPTLGFKVKIDE--DLLGGNATGDFKLQPLLIYYSANFRAMNE 709
            +TR  +++ I ME  +++W+E Q   R+ +            F+    +   +       ++K + FEGS GW  RFK R N+H+I LK EAA  D   A+ +   LK +I         HES  D           L+W++L  RTFI K EK   GFK   D    LLGGNA GDFK +P L+Y S N RAM E
Sbjct:   49 MTRTRSALMIKMESLLSIWIENQVAHRIPLSKMIIKTKAKSLFDDIKSKATVSNDNASGSKDKNETFEGSQGWFERFKVRANLHSIGLKGEAARADITAAERYPTVLKALI---------HESGYDQKQVFNVDETELFWKRLPKRTFISKTEKSAPGFKASKDRLTLLLGGNANGDFKFKPFLVYQSENPRAMRE 235          
BLAST of Tigger transposable element derived 1 vs. TrEMBL
Match: A0A455AEE9 (tigger transposable element-derived protein 1-like OS=Physeter macrocephalus OX=9755 GN=LOC102979005 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.382e-19
Identity = 63/178 (35.39%), Postives = 94/178 (52.81%), Query Frame = 2
Query:  248 MEYFVTVWVEEQNQ*R-----MLVFN*-----HHLRPEFNREKYDK-FEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNIIGNSI*LK---INHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDED--LLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCI 733
            ME  ++VW+++Q Q R     ML+          L+ +   E   K F  S  W  RFK R  +HN+ + ++AA+ D + A+ F   L+ II     L     N +    GLYW+++  R++I K+EK   G+K   D    L GGNA+GD KL+PLL+Y+S N R +  IAK S  +
Sbjct:  141 MEKLLSVWMQDQRQRRVPLSLMLIQEKAKSLYEDLKKKHGEESEGKSFNASRSWVHRFKARAKLHNVKVSDKAASTDTIAAREFPETLREIIDEGAYLPEQVFNVDE--TGLYWKRMPDRSYISKEEKLMPGYKASKDRLTLLFGGNASGDMKLKPLLVYHSENPRTLKNIAKGSLPV 316          
BLAST of Tigger transposable element derived 1 vs. TrEMBL
Match: A0A3Q1C7G7 (HTH CENPB-type domain-containing protein OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.576e-19
Identity = 64/178 (35.96%), Postives = 96/178 (53.93%), Query Frame = 2
Query:  248 MEYFVTVWVEEQNQ*RM---LVFN*HHLRPEFNREKY--------DKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNII---GNSI*LKINHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDE--DLLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCI 733
            ME  +T+W+E+Q Q R+   L+      +  F   K         + F  S+GW  RFK R N+H++ +  EAA+ DK  A+ F   LK II   G S     N +    GL+W+++  +T+I ++EK   G+K   D    +LG NA G FKL+PLL+Y +AN RA+  + KSS  +
Sbjct:   89 MEKLLTIWLEDQQQRRIPLSLMLIQEKAKSIFEDVKAKAGESAAEETFSASHGWFSRFKKRANLHHVAVSGEAASADKEAAERFPQVLKEIIEEGGYSAKQVFNVDE--TGLFWKKMPEKTYISREEKTMPGYKAAKDRLTLMLGANADGSFKLKPLLVYRAANPRALKNVTKSSLPV 264          
BLAST of Tigger transposable element derived 1 vs. TrEMBL
Match: A0A3Q1CCG6 (HTH CENPB-type domain-containing protein OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.012e-18
Identity = 64/178 (35.96%), Postives = 96/178 (53.93%), Query Frame = 2
Query:  248 MEYFVTVWVEEQNQ*RM---LVFN*HHLRPEFNREKY--------DKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNII---GNSI*LKINHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDE--DLLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCI 733
            ME  +T+W+E+Q Q R+   L+      +  F   K         + F  S+GW  RFK R N+H++ +  EAA+ DK  A+ F   LK II   G S     N +    GL+W+++  +T+I ++EK   G+K   D    +LG NA G FKL+PLL+Y +AN RA+  + KSS  +
Sbjct:   89 MEKLLTIWLEDQQQRRIPLSLMLIQEKAKSIFEDVKAKAGESAAEETFSASHGWFSRFKKRANLHHVAVSGEAASADKEAAERFPQVLKEIIEEGGYSAKQVFNVDE--TGLFWKKMPEKTYISREEKTMPGYKAAKDRLTLMLGANADGSFKLKPLLVYRAANPRALKNVTKSSLPV 264          
BLAST of Tigger transposable element derived 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 5.510e-17
Identity = 59/190 (31.05%), Postives = 91/190 (47.89%), Query Frame = 2
Query:  215 ITRNITSIRI*MEYFVTVWVEEQNQ*RMLV------------FN*HHLRPEFNREKYDKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNII---GNSI*LKINHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDE--DLLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCI 733
            +TR  + +   ME  + +W++ QN+ RM +            FN    R        + F  S GW  +FK R N+ ++ +  E A  D   A+ F+  LK II   G S     N      GL+W+++ + TF+ ++EK   GFK   D    L+G NA GD KL+PLL+Y+S   RA+    K+   +
Sbjct:   72 LTRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQAKALRLFNDFKKR-AGESAANETFGASTGWYAKFKGRYNLRHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNE--TGLFWKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGCIKADLPV 258          
BLAST of Tigger transposable element derived 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 2.787e-16
Identity = 63/217 (29.03%), Postives = 99/217 (45.62%), Query Frame = 2
Query:  248 MEYFVTVWVEEQNQ*RM----------LVFN*HHLRPEFNREKYDKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNII---GNSI*LKINHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDE--DLLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCIDI*TS*NYLLCVVFGQGTQTMALVYFQICVESRKRCKSKN 853
            ME  + +W++ QN+ RM           +     LR E +R+  + F  S GW  +FK R N+H++ +  E A  D   A+ F+  LK II   G S     N       L+W+++ + TF+ +++K   GFK   D    L+G N  GD +L+PLL+Y+S   R +    K+   I       ++   VF      +  +    C    K CK KN
Sbjct:   82 MEESLGMWIKHQNEHRMPLSTALIQVKALIQAKALRLEESRQA-ETFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNE--TRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPIWRSNKKGWITASVF------LDWLKNHFCPAIEKYCKKKN 289          
BLAST of Tigger transposable element derived 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 3.040e-16
Identity = 63/217 (29.03%), Postives = 99/217 (45.62%), Query Frame = 2
Query:  248 MEYFVTVWVEEQNQ*RM----------LVFN*HHLRPEFNREKYDKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNII---GNSI*LKINHES**DGLYWEQLSSRTFILKQEKPTLGFKVKIDE--DLLGGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCIDI*TS*NYLLCVVFGQGTQTMALVYFQICVESRKRCKSKN 853
            ME  + +W++ QN+ RM           +     LR E +R+  + F  S GW  +FK R N+H++ +  E A  D   A+ F+  LK II   G S     N       L+W+++ + TF+ +++K   GFK   D    L+G N  GD +L+PLL+Y+S   R +    K+   I       ++   VF      +  +    C    K CK KN
Sbjct:   83 MEESLGMWIKHQNEHRMPLSTALIQVKALIQAKALRLEESRQA-ETFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNE--TRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPIWRSNKKGWITASVF------LDWLKNHFCPAIEKYCKKKN 290          
BLAST of Tigger transposable element derived 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 1.578e-6
Identity = 34/107 (31.78%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  536 GLYWEQLSSRTFILKQEKPTLGFKVKIDEDLL--GGNATGDFKLQPLLIYYSANFRAMNEIAKSSFCIDI*TS*NYLLCVVFGQG---TQTMALVYFQICVESRKRC 841
            GL+W+++ SRTFI+++E    GFK + D   L   GNA G F ++P LIY S N RA+    K    +          C ++      T+ + L +F+ C   + +C
Sbjct:  118 GLFWKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAG-FMIKPGLIYRSKNPRALKNKNKDDLHV----------CWMYNAKAWMTKALNLDWFKNCFIPQVKC 213          
BLAST of Tigger transposable element derived 1 vs. Planmine SMEST
Match: SMESG000032685.1 (SMESG000032685.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.647e-9
Identity = 32/97 (32.99%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  215 ITRNITSIRI*MEYFVTVWVEEQNQ*RMLVFN*------HHLRPEFNREKYDKFEGSNGWSVRFKYRRNIHNIFLKEEAANLDKMVAKLFQHQLKNI 487
            +TR  T++ I ME  V++W+E Q + + L ++       +      N  K + FE ++GW  RFK R N+H+  LK EAA+ D  +A+ +  +LK +
Sbjct:  607 MTRTRTALIIKMESLVSIWIENQTKAKSLFYDIKSKAVSNDNASSSNTNKNETFEATHGWVERFKVRANLHSTALKGEAASADITIAEPYLTELKAL 703          

HSP 2 Score: 23.8682 bits (50), Expect = 3.647e-9
Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = 3
Query:  531 EMGYIGNSFLAELLF*NRKNL 593
            + GY GN +L EL +  +KNL
Sbjct:  712 KQGYFGNVYLTELSYLKQKNL 732          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element derived 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TIGD13.235e-1833.46tigger transposable element derived 1 [Source:HGNC... [more]
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN1.554e-1733.46Tigger transposable element-derived protein 1 OS=H... [more]
back to top
BLAST of Tigger transposable element derived 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0HKR42.383e-2033.07centrosomal protein of 89 kDa isoform X2 OS=Alliga... [more]
A0A1A9X3699.715e-2036.22HTH CENPB-type domain-containing protein OS=Glossi... [more]
A0A455AEE96.382e-1935.39tigger transposable element-derived protein 1-like... [more]
A0A3Q1C7G79.576e-1935.96HTH CENPB-type domain-containing protein OS=Amphip... [more]
A0A3Q1CCG61.012e-1835.96HTH CENPB-type domain-containing protein OS=Amphip... [more]
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005656.15.510e-1731.05pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000010132.12.787e-1629.03pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
ENSPMAT00000001313.13.040e-1629.03pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element derived 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000031980.11.578e-631.78pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
back to top
BLAST of Tigger transposable element derived 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032685.13.647e-932.99SMESG000032685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029880 ID=SMED30029880|Name=Tigger transposable element derived 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1222bp
AATTTTAAAATAATTTTGTATTTAAATGTGTGACAAAGCTAAGAGCTCAT
AGAAATCCTTAACTTTGGATATAAAACTGAATAATTTGCGTCGATTTGAA
GCTGGTTGAAAACTGTATACATAAGGAAAGCTCTTTATTTGTTATCAACA
ACTGTAAATTTTATTCGGAGCCGTGGCGCTTTCAAAATCAAAGAGTCCTT
TGCTCAAAAAACCAATTACTCGTAATATAACAAGCATTAGGATATAAATG
GAATATTTTGTTACAGTTTGGGTCGAAGAGCAAAATCAATGAAGAATGCT
TGTATTTAACTAACATCATCTTCGGCCAGAATTTAACAGGGAGAAATATG
ATAAATTTGAAGGCAGTAACGGGTGGTCTGTTAGATTCAAATATAGAAGA
AATATCCATAATATTTTCCTGAAAGAAGAAGCAGCCAATCTAGACAAAAT
GGTAGCAAAACTATTTCAACATCAATTGAAGAATATAATTGGAAACAGTA
TTTAATTAAAAATAAATCATGAATCTTGATGAGATGGGTTATATTGGGAA
CAGCTTTCTAGCAGAACTTTTATTTTGAAACAGGAAAAACCTACACTGGG
CTTCAAAGTCAAAATTGATGAGGATCTGTTAGGTGGTAATGCTACAGGTG
ATTTTAAACTCCAGCCTTTATTAATTTATTATTCTGCCAATTTTAGGGCT
ATGAATGAAATCGCGAAAAGTTCTTTCTGTATAGATATCTGAACTTCATA
AAATTATTTGTTATGCGTCGTTTTCGGTCAAGGAACGCAAACCATGGCTT
TGGTGTACTTTCAGATTTGCGTTGAGTCTCGTAAGAGATGTAAGTCCAAA
AATACAAAATAATTAATTGTCGTTTGCACTGATTAATCTTCCTGAAAAAA
ATATTTAAATTTTACGTTTGGCAAGCAAGCAATAAAAAAACTCTCAGGTG
GTAGCACGTTTCGCAATACCCAGTTGAAACTTAATCAGATTTCAGAAGCC
TCGTGTTATTAAACGGTTTAGGATAGTCAATCGAGTGCATGTGAAGTCTA
GAGATGCTAGCTTTTTTACTTCCAAAGGAACTTGAAATGTTAATAAATTA
AGGTAAATGGCTTGATGCAAGTTATTTTATTGGATAATTTTATTAAACCG
CCAGAGAATTATGAAATCAGAGCCAACGTTAAAGACTGTATTTGAAAGAA
TTTTAAAGCTTATGGTCATCTT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus