TIA1-like protein

Overview
NameTIA1-like protein
Smed IDSMED30029877
Length (bp)1132
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIA1-like protein (SMED30029877) t-SNE clustered cells

Violin plots show distribution of expression levels for TIA1-like protein (SMED30029877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIA1-like protein (SMED30029877) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIA1-like protein (SMED30029877) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029877SMESG000055075.1 SMESG000055074.1 SmedASXL_010205SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30029877SMESG000055075.1 SMESG000055074.1 dd_Smed_v4_3545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIA1-like protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 189.504 bits (480), Expect = 4.826e-56
Identity = 105/283 (37.10%), Postives = 166/283 (58.66%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAI 963
            +T+YVGNL   V + L++++F   G C +C +I D +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   Y+ V  ++  +N  VY  G    LTE+L+   F  FG+I  ++V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE   +
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD-TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDM 279          

HSP 2 Score: 76.2554 bits (186), Expect = 9.650e-15
Identity = 50/209 (23.92%), Postives = 101/209 (48.33%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR-----NGLDGEQFIKYTPRPY 705
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     ++ K + Y   V         ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV F++ + A  AI S++ T      +KC W        N +  +  I Y P+PY
Sbjct:   93 NHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRV--FPD---KGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGY-PQPY 295          
BLAST of TIA1-like protein vs. Ensembl Human
Match: TIAL1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:HGNC Symbol;Acc:HGNC:11804])

HSP 1 Score: 188.348 bits (477), Expect = 1.215e-55
Identity = 107/280 (38.21%), Postives = 162/280 (57.86%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I + +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR        Q        +E V  ++   N  VY  G    LT++L+   F  FG+I  ++V+PEKG++F+ F THE+AA AI   +G  I  +V+KC WGKE+
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTS-NDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 278          

HSP 2 Score: 73.1738 bits (178), Expect = 1.081e-13
Identity = 43/186 (23.12%), Postives = 91/186 (48.92%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P      + K + + + V         ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV FS  + A  AI S++ T      +KC W 
Sbjct:   95 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG 275          
BLAST of TIA1-like protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 181.8 bits (460), Expect = 4.602e-53
Identity = 105/294 (35.71%), Postives = 167/294 (56.80%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSV-----------QIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAI 963
            +T+YVGNL   V + L++++F   G C +C +I D +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D S+S             +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   Y+ V  ++  +N  VY  G    LTE+L+   F  FG+I  ++V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE   +
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD-TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS---------SQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDM 290          
BLAST of TIA1-like protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 181.8 bits (460), Expect = 4.970e-53
Identity = 105/294 (35.71%), Postives = 167/294 (56.80%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSV-----------QIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAI 963
            +T+YVGNL   V + L++++F   G C +C +I D +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D S+S             +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   Y+ V  ++  +N  VY  G    LTE+L+   F  FG+I  ++V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE   +
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD-TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS---------SQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDM 290          
BLAST of TIA1-like protein vs. Ensembl Human
Match: TIAL1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:HGNC Symbol;Acc:HGNC:11804])

HSP 1 Score: 181.8 bits (460), Expect = 5.109e-53
Identity = 109/296 (36.82%), Postives = 163/296 (55.07%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD------------FSC----QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I +            FS       +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR        Q        +E V  ++   N  VY  G    LT++L+   F  FG+I  ++V+PEKG++F+ F THE+AA AI   +G  I  +V+KC WGKE+
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 295          

HSP 2 Score: 73.1738 bits (178), Expect = 1.278e-13
Identity = 43/186 (23.12%), Postives = 91/186 (48.92%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P      + K + + + V         ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV FS  + A  AI S++ T      +KC W 
Sbjct:  112 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG 292          
BLAST of TIA1-like protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 203.756 bits (517), Expect = 1.248e-61
Identity = 103/275 (37.45%), Postives = 158/275 (57.45%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG-ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGK 948
            RT+YVGNL   V +  +  +F   G      +I  F    +PYAF+E++DH  AS AL  M+   + + ++KVNW+  P           +KID +    +FVGD+  +VD   L+E F  FG + DAKV+R  +  +S+G+ FVS+  R+EAERAI+ M+  W   RTI+ NWATR   D E+   Y  + Y+ +Y +    NT+VYV    +LTE+ +   F  FGRI  V+++  +G+AF+ F   +AAA+AI Q +   +   +++C+WGK
Sbjct:   46 RTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVI--FDGSNDPYAFVEFSDHGQASQALQTMNKRLLLDREMKVNWAVEP-------GQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 311          
BLAST of TIA1-like protein vs. Ensembl Celegans
Match: tiar-2 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q9U2F5])

HSP 1 Score: 178.333 bits (451), Expect = 1.339e-51
Identity = 98/293 (33.45%), Postives = 161/293 (54.95%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPD-GQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN------------------GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG-ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGK 948
            RT++V NL  A+ D+ L  +F   G  +   II  F    +PYAF+E++DH  A+LAL + +G  +   ++ V W+  P   PG      +K + S    +FVGD+  ++D   L+E F +FG++ +AK++R  +  + +G+ FVS+  R++AERAI  M+  W   RTI+ NWATR                   G   +++   + + Y+ ++ +A   NT+VYV    NL E+ +   F  FG I+ V+ +  +G+AF+ F T E+AARAI Q +   I   +++C+WGK
Sbjct:   40 RTLFVANLDPAITDEFLATLFNQIGAVMKAKII--FEGLNDPYAFVEFSDHNQATLALQSHNGRELLEKEMHVTWAFEPRE-PGE---NRSKPETSRHFHVFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERAIDEMNGAWLGRRTIRTNWATRKPDEDGERGGDRGDRRGGGGGGRDRYHNQSEKTYDEIFNQAAADNTSVYVGNIANLGEDEIRRAFDRFGPINEVRTFKIQGYAFVKFETKESAARAIVQMNNADIGGQIVRCSWGK 326          
BLAST of TIA1-like protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 164.081 bits (414), Expect = 9.066e-47
Identity = 91/275 (33.09%), Postives = 139/275 (50.55%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG-ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGK 948
            RT+YVGNL   V +  +  +F   G      +I D                                  ++KVNW+  P           +KID +    +FVGD+  +VD   L+E F  FG + DAKV+R  +  +S+G+ FVS+  R+EAERAI+ M+  W   RTI+ NWATR   D E+   Y  + Y+ +Y +    NT+VYV    +LTE+ +   F  FGRI  V+++  +G+AF+ F   +AAA+AI Q +   +   +++C+WGK
Sbjct:   46 RTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVIFD----------------------------------EMKVNWAVEP-------GQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 279          
BLAST of TIA1-like protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 155.992 bits (393), Expect = 1.668e-44
Identity = 80/215 (37.21%), Postives = 126/215 (58.60%), Query Frame = 1
Query:  310 MDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG-ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGK 948
            M+   + + ++KVNW+  P           +KID +    +FVGD+  +VD   L+E F  FG + DAKV+R  +  +S+G+ FVS+  R+EAERAI+ M+  W   RTI+ NWATR   D E+   Y  + Y+ +Y +    NT+VYV    +LTE+ +   F  FGRI  V+++  +G+AF+ F   +AAA+AI Q +   +   +++C+WGK
Sbjct:    1 MNKRLLLDREMKVNWAVEPGQ-------QQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 208          

HSP 2 Score: 83.9593 bits (206), Expect = 5.461e-18
Identity = 46/180 (25.56%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDF-SCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSS-GPSTIPGPAAVTSAKID------YSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            ++VG+L   V++Q L   F  FG      +IRD  + ++  Y F+ Y     A  A+  M+G ++    I+ NW++  P     P+       D        ++  ++VG+I   + E  +++GF+ FG++ + ++ +      +G+AFV F N+D A +AI  M+      + ++C+W 
Sbjct:   34 VFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIA-SLTEDEIRQGFASFGRITEVRIFKM-----QGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWG 207          
BLAST of TIA1-like protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 154.451 bits (389), Expect = 4.735e-44
Identity = 79/205 (38.54%), Postives = 121/205 (59.02%), Query Frame = 1
Query:  340 IKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG-ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGK 948
            +KVNW+  P           +KID +    +FVGD+  +VD   L+E F  FG + DAKV+R  +  +S+G+ FVS+  R+EAERAI+ M+  W   RTI+ NWATR   D E+   Y  + Y+ +Y +    NT+VYV    +LTE+ +   F  FGRI  V+++  +G+AF+ F   +AAA+AI Q +   +   +++C+WGK
Sbjct:    1 MKVNWAVEPGQ-------QQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 198          

HSP 2 Score: 83.5741 bits (205), Expect = 5.600e-18
Identity = 46/180 (25.56%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDF-SCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSS-GPSTIPGPAAVTSAKID------YSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            ++VG+L   V++Q L   F  FG      +IRD  + ++  Y F+ Y     A  A+  M+G ++    I+ NW++  P     P+       D        ++  ++VG+I   + E  +++GF+ FG++ + ++ +      +G+AFV F N+D A +AI  M+      + ++C+W 
Sbjct:   24 VFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIA-SLTEDEIRQGFASFGRITEVRIFKM-----QGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWG 197          
BLAST of TIA1-like protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084592)

HSP 1 Score: 207.608 bits (527), Expect = 1.936e-62
Identity = 116/305 (38.03%), Postives = 177/305 (58.03%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN-------------------GLDGEQFIKYTPR-PYELVYKEAPLTNTNVYVAG---ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            M     +T+YVGNL  +V++ LLI +F   G   SC IIR+     +PYAFIEY+++ +A+ AL+AM+       +IKVNW++ P   P        K D S+   IFVGD+  +++   L+E F+ FG++ + ++VR P   +S+G+AFVSF  + EAE AIQ+M+  W  +R+I+ NW+TR                    G      +K + R  +E VY ++  TNT VY  G     ++++L++ HF +FG I  V+V+ +KG +FI FVT EAAA AI   H  +++ N++KC WGKEN
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQP--------KTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKEN 295          

HSP 2 Score: 77.7962 bits (190), Expect = 2.081e-15
Identity = 51/209 (24.40%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD-FSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKID-------------------------YSNS----VQIFVGDIGLDV-DEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLD 669
            I+VG+L   +  + L   F  FG+  +C I+RD  + ++  YAF+ +     A  A+ AM+G ++ +  I+ NWS+    +P P   +                              Y+ S      ++ G    +V  + ++ + F QFG + D +V +      +GF+F+ F  ++ A  AI+  H +  H   +KC W   NG D
Sbjct:   97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWST--RKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFK-----DKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGD 298          
BLAST of TIA1-like protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084594)

HSP 1 Score: 207.608 bits (527), Expect = 1.936e-62
Identity = 116/305 (38.03%), Postives = 177/305 (58.03%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN-------------------GLDGEQFIKYTPR-PYELVYKEAPLTNTNVYVAG---ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            M     +T+YVGNL  +V++ LLI +F   G   SC IIR+     +PYAFIEY+++ +A+ AL+AM+       +IKVNW++ P   P        K D S+   IFVGD+  +++   L+E F+ FG++ + ++VR P   +S+G+AFVSF  + EAE AIQ+M+  W  +R+I+ NW+TR                    G      +K + R  +E VY ++  TNT VY  G     ++++L++ HF +FG I  V+V+ +KG +FI FVT EAAA AI   H  +++ N++KC WGKEN
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQP--------KTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKEN 295          

HSP 2 Score: 77.7962 bits (190), Expect = 2.081e-15
Identity = 51/209 (24.40%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD-FSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKID-------------------------YSNS----VQIFVGDIGLDV-DEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLD 669
            I+VG+L   +  + L   F  FG+  +C I+RD  + ++  YAF+ +     A  A+ AM+G ++ +  I+ NWS+    +P P   +                              Y+ S      ++ G    +V  + ++ + F QFG + D +V +      +GF+F+ F  ++ A  AI+  H +  H   +KC W   NG D
Sbjct:   97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWST--RKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFK-----DKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGD 298          
BLAST of TIA1-like protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333200)

HSP 1 Score: 207.608 bits (527), Expect = 2.422e-62
Identity = 116/305 (38.03%), Postives = 177/305 (58.03%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN-------------------GLDGEQFIKYTPR-PYELVYKEAPLTNTNVYVAG---ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            M     +T+YVGNL  +V++ LLI +F   G   SC IIR+     +PYAFIEY+++ +A+ AL+AM+       +IKVNW++ P   P        K D S+   IFVGD+  +++   L+E F+ FG++ + ++VR P   +S+G+AFVSF  + EAE AIQ+M+  W  +R+I+ NW+TR                    G      +K + R  +E VY ++  TNT VY  G     ++++L++ HF +FG I  V+V+ +KG +FI FVT EAAA AI   H  +++ N++KC WGKEN
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQP--------KTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKEN 295          

HSP 2 Score: 77.7962 bits (190), Expect = 2.296e-15
Identity = 51/209 (24.40%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD-FSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKID-------------------------YSNS----VQIFVGDIGLDV-DEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLD 669
            I+VG+L   +  + L   F  FG+  +C I+RD  + ++  YAF+ +     A  A+ AM+G ++ +  I+ NWS+    +P P   +                              Y+ S      ++ G    +V  + ++ + F QFG + D +V +      +GF+F+ F  ++ A  AI+  H +  H   +KC W   NG D
Sbjct:   97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWST--RKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFK-----DKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGD 298          
BLAST of TIA1-like protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333202)

HSP 1 Score: 207.608 bits (527), Expect = 2.422e-62
Identity = 116/305 (38.03%), Postives = 177/305 (58.03%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN-------------------GLDGEQFIKYTPR-PYELVYKEAPLTNTNVYVAG---ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            M     +T+YVGNL  +V++ LLI +F   G   SC IIR+     +PYAFIEY+++ +A+ AL+AM+       +IKVNW++ P   P        K D S+   IFVGD+  +++   L+E F+ FG++ + ++VR P   +S+G+AFVSF  + EAE AIQ+M+  W  +R+I+ NW+TR                    G      +K + R  +E VY ++  TNT VY  G     ++++L++ HF +FG I  V+V+ +KG +FI FVT EAAA AI   H  +++ N++KC WGKEN
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQP--------KTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKEN 295          

HSP 2 Score: 77.7962 bits (190), Expect = 2.296e-15
Identity = 51/209 (24.40%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD-FSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKID-------------------------YSNS----VQIFVGDIGLDV-DEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLD 669
            I+VG+L   +  + L   F  FG+  +C I+RD  + ++  YAF+ +     A  A+ AM+G ++ +  I+ NWS+    +P P   +                              Y+ S      ++ G    +V  + ++ + F QFG + D +V +      +GF+F+ F  ++ A  AI+  H +  H   +KC W   NG D
Sbjct:   97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWST--RKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFK-----DKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGD 298          
BLAST of TIA1-like protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333201)

HSP 1 Score: 207.608 bits (527), Expect = 2.422e-62
Identity = 116/305 (38.03%), Postives = 177/305 (58.03%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN-------------------GLDGEQFIKYTPR-PYELVYKEAPLTNTNVYVAG---ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            M     +T+YVGNL  +V++ LLI +F   G   SC IIR+     +PYAFIEY+++ +A+ AL+AM+       +IKVNW++ P   P        K D S+   IFVGD+  +++   L+E F+ FG++ + ++VR P   +S+G+AFVSF  + EAE AIQ+M+  W  +R+I+ NW+TR                    G      +K + R  +E VY ++  TNT VY  G     ++++L++ HF +FG I  V+V+ +KG +FI FVT EAAA AI   H  +++ N++KC WGKEN
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQP--------KTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKEN 295          

HSP 2 Score: 77.7962 bits (190), Expect = 2.296e-15
Identity = 51/209 (24.40%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD-FSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKID-------------------------YSNS----VQIFVGDIGLDV-DEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLD 669
            I+VG+L   +  + L   F  FG+  +C I+RD  + ++  YAF+ +     A  A+ AM+G ++ +  I+ NWS+    +P P   +                              Y+ S      ++ G    +V  + ++ + F QFG + D +V +      +GF+F+ F  ++ A  AI+  H +  H   +KC W   NG D
Sbjct:   97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWST--RKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFK-----DKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGD 298          
BLAST of TIA1-like protein vs. Ensembl Zebrafish
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-1506])

HSP 1 Score: 197.593 bits (501), Expect = 3.348e-59
Identity = 104/285 (36.49%), Postives = 168/285 (58.95%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            M  +  +T+YVGNL   V + L++++FG  G C SC +I D +   +PY F+E+ +H  A+ +L+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    ++  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   ++ V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  +  +++KC WGKE
Sbjct:    2 MDDEQPKTLYVGNLSRDVTEALIMQLFGQIGPCKSCKMIVD-TAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATSPS---------SQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKATYETNTKHLSFDEVVNQSSPSNCTVYCGGVTTGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSLEGHIVKCYWGKE 276          
BLAST of TIA1-like protein vs. Ensembl Zebrafish
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-1506])

HSP 1 Score: 193.356 bits (490), Expect = 1.217e-57
Identity = 102/276 (36.96%), Postives = 163/276 (59.06%), Query Frame = 1
Query:  139 YVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            YVGNL   V + L++++FG  G C SC +I D +   +PY F+E+ +H  A+ +L+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    ++  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   ++ V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  +  +++KC WGKE
Sbjct:   11 YVGNLSRDVTEALIMQLFGQIGPCKSCKMIVD-TAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATSPS---------SQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKATYETNTKHLSFDEVVNQSSPSNCTVYCGGVTTGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSLEGHIVKCYWGKE 276          

HSP 2 Score: 75.485 bits (184), Expect = 1.485e-14
Identity = 44/186 (23.66%), Postives = 91/186 (48.92%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +    +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     T+ K + +   V         ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV F++ + A  AI S++ T      +KC W 
Sbjct:   94 NHFHVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKATYETNTKHLSFDEVVNQSSPSNCTVYCGGVTTGLTEQLMRQTFSPFGQIMEVRV--FPD---KGYSFVRFNSHESAAHAIVSVNGTSLEGHIVKCYWG 274          
BLAST of TIA1-like protein vs. Ensembl Zebrafish
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 187.193 bits (474), Expect = 8.060e-56
Identity = 108/303 (35.64%), Postives = 168/303 (55.45%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNG---LDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQ 1020
            RT+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ ++  A+ AL+AM+G  +    +KVNW+S PS         S K D SN   +FVGD+  ++    ++  F+ FG++ DA+VVR    G+S+G+ F+SF N+ +AE AIQ M+  W   R I+ NWATR         +        YE V  ++  +N  VY  G    L+++L+   F  FG+I  ++V+PEKG++F+ F +HE AA AI   +G  I  + +KC WGKE   + +    P+       + AQ
Sbjct:    9 RTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILD-TTGNDPYCFVEFYENRHAAAALAAMNGRKILGKDMKVNWASTPS---------SQKKDTSNHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVRDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLSYEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRSMQQMPMPQQNKPTYAAQ 301          

HSP 2 Score: 78.9518 bits (193), Expect = 7.571e-16
Identity = 45/187 (24.06%), Postives = 94/187 (50.27%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGP--AAVTSAKIDYS--------NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   ++   +   F  FG+     ++RD +  ++  Y FI + +   A  A+  M+G ++   QI+ NW++   + P       +S  + Y         ++  ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV F + + A  AI S++ T     T+KC W 
Sbjct:   95 NHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVRDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLSYEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWG 276          
BLAST of TIA1-like protein vs. Ensembl Zebrafish
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 186.037 bits (471), Expect = 2.712e-55
Identity = 107/303 (35.31%), Postives = 168/303 (55.45%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNG---LDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQ 1020
            RT+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ ++  A+ AL+AM+G  +    +KVNW+S PS         S K D SN   +FVGD+  ++    ++  F+ FG++ DA+VV+    G+S+G+ F+SF N+ +AE AIQ M+  W   R I+ NWATR         +        YE V  ++  +N  VY  G    L+++L+   F  FG+I  ++V+PEKG++F+ F +HE AA AI   +G  I  + +KC WGKE   + +    P+       + AQ
Sbjct:    9 RTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILD-TTGNDPYCFVEFYENRHAAAALAAMNGRKILGKDMKVNWASTPS---------SQKKDTSNHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLSYEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRSMQQMPMPQQNKPTYAAQ 301          

HSP 2 Score: 77.411 bits (189), Expect = 2.144e-15
Identity = 44/187 (23.53%), Postives = 94/187 (50.27%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGP--AAVTSAKIDYS--------NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   ++   +   F  FG+     +++D +  ++  Y FI + +   A  A+  M+G ++   QI+ NW++   + P       +S  + Y         ++  ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV F + + A  AI S++ T     T+KC W 
Sbjct:   95 NHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLSYEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWG 276          
BLAST of TIA1-like protein vs. Ensembl Zebrafish
Match: tial1 (TIA1 cytotoxic granule-associated RNA binding protein-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1547])

HSP 1 Score: 186.037 bits (471), Expect = 6.069e-55
Identity = 107/290 (36.90%), Postives = 168/290 (57.93%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPY---ELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMP 981
            +T+YVGNL   V + L++++F   G C SC +I + +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    ++  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +     + +     E+V + +P  N  VY  G    LTE L+   F  FG+I  ++V+PEKG++FI F +HE+AA AI   +G  I  +V+KC WGKE+  ++ +  P
Sbjct:    8 KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEHTS-NDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSVQDNSAKQLRFDEVVNQSSP-QNCTVYCGGIQSGLTEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMAKNVQP 286          

HSP 2 Score: 74.7146 bits (182), Expect = 2.451e-14
Identity = 45/186 (24.19%), Postives = 93/186 (50.00%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-------IDYSN--SVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +    +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P      SAK       ++ S+  +  ++ G I   + E ++++ FS FGQ+++ +V  +P+   +G++F+ FS+ + A  AI S++ T      +KC W 
Sbjct:   94 NHFHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSVQDNSAKQLRFDEVVNQSSPQNCTVYCGGIQSGLTEHLMRQTFSPFGQIMEIRV--FPE---KGYSFIRFSSHESAAHAIVSVNGTTIEGHVVKCYWG 274          
BLAST of TIA1-like protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 199.134 bits (505), Expect = 7.378e-60
Identity = 106/279 (37.99%), Postives = 164/279 (58.78%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            RT+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ +L+AM+G  +   ++KVNW++ PS         S K D +N   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +   +   +   YE V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE
Sbjct:    7 RTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMD-TAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPS---------SQKKDANNHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKE 275          

HSP 2 Score: 77.0258 bits (188), Expect = 5.504e-15
Identity = 45/186 (24.19%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +    +   F  FG+     +++D +  ++  Y F+ + +   A  A++ M G ++   QI+ NW++     P     ++ K + Y   V         ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV FS+ + A  AI S++ T      +KC W 
Sbjct:   93 NHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRV--FPD---KGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWG 273          
BLAST of TIA1-like protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 197.593 bits (501), Expect = 3.525e-59
Identity = 108/287 (37.63%), Postives = 167/287 (58.19%), Query Frame = 1
Query:  112 MSFKNNRTI--YVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            M F + +TI  YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ +L+AM+G  +   ++KVNW++ PS         S K D +N   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +   +   +   YE V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE
Sbjct:    1 MLFDDTKTILLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMD-TAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPS---------SQKKDANNHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKE 277          
BLAST of TIA1-like protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 195.667 bits (496), Expect = 2.705e-58
Identity = 104/282 (36.88%), Postives = 166/282 (58.87%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTS--AKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ +L+AM+G  +   ++KVNW++ PS+    A  +S  + +   +   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +   +   +   YE V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE 
Sbjct:    7 RTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMD-TAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQDHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 287          
BLAST of TIA1-like protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 190.66 bits (483), Expect = 2.287e-56
Identity = 102/279 (36.56%), Postives = 163/279 (58.42%), Query Frame = 1
Query:  139 YVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTS--AKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ +L+AM+G  +   ++KVNW++ PS+    A  +S  + +   +   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +   +   +   YE V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE 
Sbjct:   19 YVGNLSRDVTEPLILQVFSQLGPCKSCKMIMD-TAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQDHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 296          

HSP 2 Score: 76.6406 bits (187), Expect = 8.792e-15
Identity = 44/182 (24.18%), Postives = 90/182 (49.45%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            ++VG+L   +    +   F  FG+     +++D +  ++  Y F+ + +   A  A++ M G ++   QI+ NW++     P     ++ K + Y   V         ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV FS+ + A  AI S++ T      +KC W 
Sbjct:  117 VFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRV--FPD---KGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWG 293          
BLAST of TIA1-like protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 185.652 bits (470), Expect = 1.502e-54
Identity = 105/300 (35.00%), Postives = 167/300 (55.67%), Query Frame = 1
Query:  163 VNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQSGAIQPPPF 1047
            V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ +L+AM+G  +   ++KVNW++ PS         S K D +N   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +   +   +   YE V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE    +   + P+Q     +F        PPP+
Sbjct:   31 VTEPLILQVFSQLGPCKSCKMIMD-TAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPS---------SQKKDANNHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKE----TPDMLNPVQQASQISF--------PPPY 308          

HSP 2 Score: 77.0258 bits (188), Expect = 6.570e-15
Identity = 45/186 (24.19%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +    +   F  FG+     +++D +  ++  Y F+ + +   A  A++ M G ++   QI+ NW++     P     ++ K + Y   V         ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV FS+ + A  AI S++ T      +KC W 
Sbjct:  106 NHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRV--FPD---KGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWG 286          

HSP 3 Score: 53.1434 bits (126), Expect = 3.235e-7
Identity = 46/173 (26.59%), Postives = 74/173 (42.77%), Query Frame = 1
Query:  454 DVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEEL----LNCHFQEFGRIDSVKVYPE------KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNW 942
            DV EP++ + FSQ G     K++    G    + FV F     A  ++ +M+      + +K NWAT            TP   +   K+A   N + +V   +L+ E+    +   F  FGRI   +V  +      KG+ F++F     A  AI+Q  G  +    I+ NW
Sbjct:   30 DVTEPLILQVFSQLGPCKSCKMIMDTAGNDP-YCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWAT------------TPSSQK---KDA---NNHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNW 183          
BLAST of TIA1-like protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 191.045 bits (484), Expect = 8.854e-57
Identity = 106/284 (37.32%), Postives = 164/284 (57.75%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTN-PYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAI 963
            +T+YVGNL   V + L++++F   G C +C +I D     N PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   Y+ V  ++   N  VY  G    LTE+L+   F  FG+I  ++V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE   +
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVRTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDM 281          

HSP 2 Score: 78.5666 bits (192), Expect = 1.439e-15
Identity = 45/186 (24.19%), Postives = 93/186 (50.00%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYS--------NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     ++ K + Y         N+  ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV FS+ + A  AI S++ T      +KC W 
Sbjct:   95 NHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRV--FPD---KGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWG 275          
BLAST of TIA1-like protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 190.274 bits (482), Expect = 1.301e-56
Identity = 105/283 (37.10%), Postives = 165/283 (58.30%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAI 963
            +T+YVGNL   V + L++++F   G C +C +I D +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   Y+ V  ++   N  VY  G    LTE+L+   F  FG+I  ++V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE   +
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD-TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDM 279          

HSP 2 Score: 78.1814 bits (191), Expect = 1.461e-15
Identity = 45/186 (24.19%), Postives = 93/186 (50.00%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYS--------NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     ++ K + Y         N+  ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV FS+ + A  AI S++ T      +KC W 
Sbjct:   93 NHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRV--FPD---KGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWG 273          
BLAST of TIA1-like protein vs. Ensembl Mouse
Match: Tial1 (Tia1 cytotoxic granule-associated RNA binding protein-like 1 [Source:MGI Symbol;Acc:MGI:107913])

HSP 1 Score: 189.889 bits (481), Expect = 2.260e-56
Identity = 107/280 (38.21%), Postives = 162/280 (57.86%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I + +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR        Q        +E V  ++   N  VY  G    LT++L+   F  FG+I  ++V+PEKG++F+ F THE+AA AI   +G  I  +V+KC WGKE+
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTS-NDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 278          

HSP 2 Score: 75.0998 bits (183), Expect = 1.639e-14
Identity = 44/186 (23.66%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     T+ K + + + V         ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV FS  + A  AI S++ T      +KC W 
Sbjct:   95 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG 275          
BLAST of TIA1-like protein vs. Ensembl Mouse
Match: Tial1 (Tia1 cytotoxic granule-associated RNA binding protein-like 1 [Source:MGI Symbol;Acc:MGI:107913])

HSP 1 Score: 189.889 bits (481), Expect = 2.260e-56
Identity = 107/280 (38.21%), Postives = 162/280 (57.86%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I + +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR        Q        +E V  ++   N  VY  G    LT++L+   F  FG+I  ++V+PEKG++F+ F THE+AA AI   +G  I  +V+KC WGKE+
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTS-NDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 278          

HSP 2 Score: 75.0998 bits (183), Expect = 1.639e-14
Identity = 44/186 (23.66%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     T+ K + + + V         ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV FS  + A  AI S++ T      +KC W 
Sbjct:   95 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG 275          
BLAST of TIA1-like protein vs. Ensembl Mouse
Match: Tial1 (Tia1 cytotoxic granule-associated RNA binding protein-like 1 [Source:MGI Symbol;Acc:MGI:107913])

HSP 1 Score: 183.341 bits (464), Expect = 9.160e-54
Identity = 109/296 (36.82%), Postives = 163/296 (55.07%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD------------FSC----QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I +            FS       +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR        Q        +E V  ++   N  VY  G    LT++L+   F  FG+I  ++V+PEKG++F+ F THE+AA AI   +G  I  +V+KC WGKE+
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 295          

HSP 2 Score: 75.0998 bits (183), Expect = 1.762e-14
Identity = 44/186 (23.66%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     T+ K + + + V         ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV FS  + A  AI S++ T      +KC W 
Sbjct:  112 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG 292          
BLAST of TIA1-like protein vs. UniProt/SwissProt
Match: sp|Q01085|TIAR_HUMAN (Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 5.837e-55
Identity = 107/280 (38.21%), Postives = 162/280 (57.86%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I + +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR        Q        +E V  ++   N  VY  G    LT++L+   F  FG+I  ++V+PEKG++F+ F THE+AA AI   +G  I  +V+KC WGKE+
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTS-NDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 278          

HSP 2 Score: 73.1738 bits (178), Expect = 5.193e-13
Identity = 43/186 (23.12%), Postives = 91/186 (48.92%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P      + K + + + V         ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV FS  + A  AI S++ T      +KC W 
Sbjct:   95 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG 275          
BLAST of TIA1-like protein vs. UniProt/SwissProt
Match: sp|P70318|TIAR_MOUSE (Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 6.407e-53
Identity = 109/296 (36.82%), Postives = 163/296 (55.07%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD------------FSC----QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I +            FS       +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR        Q        +E V  ++   N  VY  G    LT++L+   F  FG+I  ++V+PEKG++F+ F THE+AA AI   +G  I  +V+KC WGKE+
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 295          

HSP 2 Score: 75.0998 bits (183), Expect = 1.232e-13
Identity = 44/186 (23.66%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     T+ K + + + V         ++ G I   + + ++++ FS FGQ+++ +V  +P+   +G++FV FS  + A  AI S++ T      +KC W 
Sbjct:  112 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV--FPE---KGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG 292          
BLAST of TIA1-like protein vs. UniProt/SwissProt
Match: sp|P52912|TIA1_MOUSE (Nucleolysin TIA-1 OS=Mus musculus OX=10090 GN=Tia1 PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.024e-52
Identity = 105/294 (35.71%), Postives = 166/294 (56.46%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSV-----------QIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAI 963
            +T+YVGNL   V + L++++F   G C +C +I D +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D S+S             +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   Y+ V  ++   N  VY  G    LTE+L+   F  FG+I  ++V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE   +
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD-TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS---------SQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDM 290          
BLAST of TIA1-like protein vs. UniProt/SwissProt
Match: sp|P31483|TIA1_HUMAN (Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=3)

HSP 1 Score: 181.8 bits (460), Expect = 2.387e-52
Identity = 105/294 (35.71%), Postives = 167/294 (56.80%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSV-----------QIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAI 963
            +T+YVGNL   V + L++++F   G C +C +I D +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D S+S             +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   Y+ V  ++  +N  VY  G    LTE+L+   F  FG+I  ++V+P+KG++F+ F +HE+AA AI   +G  I  +V+KC WGKE   +
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD-TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS---------SQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDM 290          
BLAST of TIA1-like protein vs. UniProt/SwissProt
Match: sp|Q9M427|UBP1_NICPL (Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia OX=4092 GN=UBP1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.102e-40
Identity = 106/324 (32.72%), Postives = 166/324 (51.23%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVV-RYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN-GLDGEQ------FIKYTPRPYE-----LVYKEAPLTN---TNVYVAGENLTEEL----LNCHFQEFGR--IDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSA--MPPLQ----PGMASAFLA 1017
            R++YVGN+   V + LL  +F + G    C +IR      + Y F++Y D  SA+LA+  ++G +++   IKVNW          A  ++ + D SN   IFVGD+  +V +  L   FS +    DA+V+     G+SRGF FVSF N+ EA+ AI  ++  W  +R I+CNWA +  G  GEQ       ++ T    +     +V ++AP  N   T VYV   NL  E+    L+ HF   G   I+ V++  +KG  F+ + +H  AARAI   +   +    +KC+WG +     +S+  +PP      PG+++  LA
Sbjct:   49 RSVYVGNIHPQVTEPLLQEVFASTGPLEGCKLIRK---DKSSYGFVDYFDRRSAALAIVTLNGRHLFGQPIKVNW----------AYASAQREDTSNHYNIFVGDLSPEVTDATLFACFSVYTSCSDARVMWDQKTGRSRGFGFVSFRNQQEAQSAINDLNGKWLGSRQIRCNWAAKGAGAVGEQNSDAKSVVELTSGTSDDGQEKVVNEDAPENNPQYTTVYVG--NLAPEVTSVDLHRHFHALGAGVIEDVRIQRDKGFGFVRYSSHAEAARAIQLGNARLLFGKPVKCSWGSKPTPPGSSSNPLPPPAIGQIPGLSAMDLA 357          

HSP 2 Score: 58.5362 bits (140), Expect = 3.252e-8
Identity = 45/189 (23.81%), Postives = 77/189 (40.74%), Query Frame = 1
Query:  409 DYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVA--GENLTEELLNCHFQEFGRIDSVKVY------PEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            D S    ++VG+I   V EP+L+E F+  G L   K++R        + FV + +R  A  AI +++      + IK NWA                 Y    +E    + N++V      +T+  L   F  +      +V         +G  F++F   + A  AI+  +G  +    I+CNW  +
Sbjct:   44 DSSTCRSVYVGNIHPQVTEPLLQEVFASTGPLEGCKLIRK---DKSSYGFVDYFDRRSAALAIVTLNGRHLFGQPIKVNWA-----------------YASAQREDTSNHYNIFVGDLSPEVTDATLFACFSVYTSCSDARVMWDQKTGRSRGFGFVSFRNQQEAQSAINDLNGKWLGSRQIRCNWAAK 212          
BLAST of TIA1-like protein vs. TrEMBL
Match: D5JG77 (TIA1-like protein OS=Dugesia japonica OX=6161 GN=TIAL-3 PE=2 SV=1)

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 306/323 (94.74%), Postives = 311/323 (96.28%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQSGAIQPPPFYIPNPTQQFYQ 1080
            MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDH SASLALSAMDGIYMWNNQIKVNWSSGPS +PGPAAV SAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENF IST+ +P LQP MASAFL Q+GA+QPPPFY   PTQ FYQ
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHSSASLALSAMDGIYMWNNQIKVNWSSGPSAVPGPAAVASAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFGISTATIPALQPAMASAFLTQTGALQPPPFYTAPPTQPFYQ 323          
BLAST of TIA1-like protein vs. TrEMBL
Match: D5JG78 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-4 PE=2 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 8.148e-170
Identity = 231/283 (81.63%), Postives = 258/283 (91.17%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSA-KIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            M  +NNRTIYVGNLPDA+ D LL+RIFGNFGQC+ CHIIRDFSCQTNPYAFIEYT+H +ASLAL+AMDGI+MWNNQIKVNWSSG S     +++ S+ KIDYSN++QIFVGDIGLDVDE MLKEGFS+FG ++DAKVVRY DGQSRGFAFV+FS RD+AE+AI+ MHKTWFHNRTIKCNWATRNGLDG+QFIKYTPRPYELVYKEAPLTNTNVY+AG  E LTEEL+  HF+EFGRID+VKVYPEK HAFINFVTHE+AARAISQRHGYKINDNVIKCNWGKE
Sbjct:    1 MDIRNNRTIYVGNLPDAITDHLLLRIFGNFGQCVGCHIIRDFSCQTNPYAFIEYTNHSAASLALAAMDGIFMWNNQIKVNWSSGNSVNTVASSLPSSNKIDYSNTIQIFVGDIGLDVDEAMLKEGFSEFGPVVDAKVVRYQDGQSRGFAFVAFSKRDDAEKAIEKMHKTWFHNRTIKCNWATRNGLDGDQFIKYTPRPYELVYKEAPLTNTNVYIAGIPEGLTEELIRVHFEEFGRIDAVKVYPEKAHAFINFVTHESAARAISQRHGYKINDNVIKCNWGKE 283          

HSP 2 Score: 70.8626 bits (172), Expect = 4.543e-10
Identity = 50/190 (26.32%), Postives = 88/190 (46.32%), Query Frame = 1
Query:  406 IDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVA--GENLTEELLNCHFQEFGRIDSVKVY-----PEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            +D  N+  I+VG++   + + +L   F  FGQ +   ++R    Q+  +AF+ ++N   A  A+ +M   +  N  IK NW++ N ++        P   ++ Y         ++V   G ++ E +L   F EFG +   KV        +G AF+ F   + A +AI + H    ++  IKCNW   N
Sbjct:    1 MDIRNNRTIYVGNLPDAITDHLLLRIFGNFGQCVGCHIIRDFSCQTNPYAFIEYTNHSAASLALAAMDGIFMWNNQIKVNWSSGNSVN--TVASSLPSSNKIDYSNT----IQIFVGDIGLDVDEAMLKEGFSEFGPVVDAKVVRYQDGQSRGFAFVAFSKRDDAEKAIEKMHKTWFHNRTIKCNWATRN 184          
BLAST of TIA1-like protein vs. TrEMBL
Match: D5JG75 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-1 PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 2.264e-82
Identity = 143/289 (49.48%), Postives = 195/289 (67.47%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVT--SAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN-GLDGEQF-IKYTPRPY----ELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTS 972
            +TIY+ NLP  ++++ L+ IFG+FG C+SC +  +    T   A+IE+ +  SA  AL AM+   M +NQ+ V  +   + +    + T  S K+DYS SVQIFVG IG D+DE +LKEGF+  GQ++D KVVR  DGQ +GFAFVSFSN  +A  AIQ M+ T FHNR I+CNWAT+N   +G  F  K+ P  +    E +  EAP +NT+VYV GE+LTEELL   F+ FG+I +VK +PEK HAF+N+ TH+AAA AI Q +GYKIN+  +KCNWGK+N A+  +
Sbjct:    1 KTIYISNLPSPISEEDLLSIFGSFGACVSCEL--NLETLT---AYIEFDNESSAEKAL-AMNNTPMESNQMSVEIAYVDNVVQNVTSYTLASKKVDYSQSVQIFVGGIGFDIDEAILKEGFAHCGQVLDTKVVRSNDGQHKGFAFVSFSNESDANSAIQKMNNTMFHNRKIQCNWATKNKNSNGAPFNPKFNPTKFNKTLEDISYEAPESNTSVYVLGESLTEELLRPIFERFGKIKNVKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINNIELKCNWGKKNAALGNA 283          
BLAST of TIA1-like protein vs. TrEMBL
Match: A0A1B0GMD7 (Uncharacterized protein OS=Phlebotomus papatasi OX=29031 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.176e-65
Identity = 123/301 (40.86%), Postives = 180/301 (59.80%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNG---LDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG---ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTS-AMP-----PLQP 993
            +T+YVGNL ++V+++LL  +F   G   +C IIR+     +PYAFIE+T+H SAS AL+AM+     + ++KVNW++ P   P        K D S+   IFVGD+  +++   L+E F+ FG++ + ++VR P   +S+G+AFVSF  + EAE AIQSM+  W  +R+I+ NW+TR      +  + IK     YE +Y +   TN  VY  G     ++EEL++ HF +FG I  V+V+ +KG+AFI F T EAA  AI   H   IN   +KC WGKEN   +TS A P     P+QP
Sbjct:    7 KTLYVGNLDNSVSEELLWSLFAQIGMVKNCKIIREPG--NDPYAFIEFTNHQSASTALTAMNKRLFLDKEMKVNWATSPGNQP--------KADTSSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAIQSMNGQWLGSRSIRTNWSTRKPPPPRETSKGIKGGKPSYEEIYNQTSPTNATVYCGGFAANVISEELVHKHFGQFGAIQDVRVFKDKGYAFIKFTTKEAATHAIEATHNTDINGQPVKCFWGKENGGDTTSNAQPSNQSQPVQP 297          

HSP 2 Score: 71.2478 bits (173), Expect = 4.361e-10
Identity = 54/201 (26.87%), Postives = 91/201 (45.27%), Query Frame = 1
Query:  406 IDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVA--GENLTEELLNCHFQEFGRIDSVKVYPE------KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPP 984
            +D S    ++VG++   V E +L   F+Q G + + K++R P      +AF+ F+N   A  A+ +M+K  F ++ +K NWAT  G           +P     K    ++ +++V      +  E L   F  FG I + ++  +      KG+AF++FV    A  AI   +G  +    I+ NW       ST   PP
Sbjct:    1 MDESQPKTLYVGNLDNSVSEELLWSLFAQIGMVKNCKIIREPGNDP--YAFIEFTNHQSASTALTAMNKRLFLDKEMKVNWATSPG----------NQP-----KADTSSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKAEAENAIQSMNGQWLGSRSIRTNW-------STRKPPP 177          
BLAST of TIA1-like protein vs. TrEMBL
Match: T1G9I0 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20217727 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 5.105e-65
Identity = 125/323 (38.70%), Postives = 178/323 (55.11%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPD-GQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKE---------APLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLA----QSGAIQPPP 1044
            + RT+YVGNL   V++ LL+ +FG  GQC  C +IR+   +   YAFIE+  H  A +AL AM+   +   ++KVNW++ P            K D S    IFVGD+  D++ P LKE F+ FG++ DAK++  P  G+S+GF FV F  +++AE AI  M+ TW   RTI+ NWAT  G+     +  + RP +  YKE         +   NT VY  G     T+ ++   FQ +G I  V+V+ EKG+AF+ + T +AA RAI   HG  IN +++KC+WGKE   +        Q  M SA LA    Q+G   PPP
Sbjct:    7 STRTLYVGNLDPMVSEDLLMTLFGTLGQCKGCKLIREAGSEL--YAFIEFNTHTEAQMALMAMNKRNVLGKELKVNWATQPGG--------QIKQDTSKHFHIFVGDLTPDIEAPQLKEAFAPFGEISDAKIITDPQTGRSKGFGFVCFVRKEDAEMAITGMNGTWLGGRTIRTNWATGKGV-----MSTSMRPQQSHYKELNYNEVQNQSGPNNTTVYCGGITSETTDSMMKEAFQSYGEIVEVRVFKEKGYAFVRYSTKDAAVRAICGVHGTDINGSIVKCSWGKEQAELQQQIANSQQ--MKSASLAAATSQAGGFYPPP 312          
BLAST of TIA1-like protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 199.134 bits (505), Expect = 1.990e-60
Identity = 123/345 (35.65%), Postives = 180/345 (52.17%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRP-------------YELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENF---AISTSAMPPLQPGMASAFLAQSGAI----QPPPFYIPN----PTQQFYQQ 1083
            +T+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ AL AM+G  +    +KVNW+S PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ F+SF N+ +AE AIQ M+  W   R I+ NWATR            P P             YE V  ++  +N  VY  G    LT++L+   F  FG+I  ++V+P+KG++F+ F +HE AA AI   +G  I  + +KC WGKE     A+    MP   PG A+    Q G      Q    Y+PN    PT   Y Q
Sbjct:    8 KTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIID-TAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWASMPS---------SQKKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRK----------PPAPKSNYETGNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRAMQQMPMPQSNPGYAAQPYGQWGQSYGNGQQMGQYVPNGWQMPTYGVYGQ 332          

HSP 2 Score: 73.9442 bits (180), Expect = 2.373e-14
Identity = 44/187 (23.53%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVT--SAKIDYS--------NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   ++   +   F  FG+     +++D +  ++  Y FI + +   A  A+  M+G ++   QI+ NW++     P     T  +  + Y         ++  ++ G +   + + ++++ FS FGQ+++ +V  +PD   +G++FV F + + A  AI S++ T     T+KC W 
Sbjct:   94 NHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYETGNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRV--FPD---KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWG 275          
BLAST of TIA1-like protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 199.134 bits (505), Expect = 1.990e-60
Identity = 123/345 (35.65%), Postives = 180/345 (52.17%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRP-------------YELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENF---AISTSAMPPLQPGMASAFLAQSGAI----QPPPFYIPN----PTQQFYQQ 1083
            +T+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ AL AM+G  +    +KVNW+S PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ F+SF N+ +AE AIQ M+  W   R I+ NWATR            P P             YE V  ++  +N  VY  G    LT++L+   F  FG+I  ++V+P+KG++F+ F +HE AA AI   +G  I  + +KC WGKE     A+    MP   PG A+    Q G      Q    Y+PN    PT   Y Q
Sbjct:    8 KTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIID-TAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWASMPS---------SQKKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRK----------PPAPKSNYETGNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRAMQQMPMPQSNPGYAAQPYGQWGQSYGNGQQMGQYVPNGWQMPTYGVYGQ 332          

HSP 2 Score: 73.9442 bits (180), Expect = 2.373e-14
Identity = 44/187 (23.53%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVT--SAKIDYS--------NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   ++   +   F  FG+     +++D +  ++  Y FI + +   A  A+  M+G ++   QI+ NW++     P     T  +  + Y         ++  ++ G +   + + ++++ FS FGQ+++ +V  +PD   +G++FV F + + A  AI S++ T     T+KC W 
Sbjct:   94 NHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYETGNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRV--FPD---KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWG 275          
BLAST of TIA1-like protein vs. Ensembl Cavefish
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:103030475])

HSP 1 Score: 185.267 bits (469), Expect = 1.141e-54
Identity = 107/296 (36.15%), Postives = 167/296 (56.42%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNG------LDGEQFIKYTPRP---YELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMP 981
            +T+YVGNL   V + L++++F   G C SC +I + +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  ++    ++  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR         D +Q           +E V  ++   N  VY  G    L+E L+   F  FG+I  ++V+PEKG++FI F +HE+AA AI   +G  I  +++KC WGKE+  ++ S  P
Sbjct:    8 KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEHTS-NDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSVQDSKQIAHLGSSKQLRFEDVVNQSSPQNCTVYCGGIQSGLSEHLIRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAAHAIVSVNGTTIESHIVKCYWGKESPDMAKSVQP 293          

HSP 2 Score: 72.4034 bits (176), Expect = 1.330e-13
Identity = 45/195 (23.08%), Postives = 96/195 (49.23%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAV----------TSAKIDYSNSVQ--------IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +    +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P P +V          +S ++ + + V         ++ G I   + E ++++ FS FGQ+++ +V  +P+   +G++F+ FS+ + A  AI S++ T   +  +KC W 
Sbjct:   94 NHFHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWAT--RKPPAPKSVQDSKQIAHLGSSKQLRFEDVVNQSSPQNCTVYCGGIQSGLSEHLIRQTFSPFGQIMEIRV--FPE---KGYSFIRFSSHESAAHAIVSVNGTTIESHIVKCYWG 281          
BLAST of TIA1-like protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 165.622 bits (418), Expect = 5.356e-48
Identity = 90/247 (36.44%), Postives = 143/247 (57.89%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFI 855
            +T+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ +H  A+ AL AM+G  +    +KVNW+S PS         S K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ F+SF N+ +AE AIQ M+  W   R I+ NWATR     +   +   +   YE V  ++  +N  VY  G    LT++L+   F  FG+I  ++V+P+KG++F+
Sbjct:    7 KTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIID-TAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWASMPS---------SQKKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYESNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFV 243          

HSP 2 Score: 55.0694 bits (131), Expect = 4.281e-8
Identity = 34/156 (21.79%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-IDYS--------NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFV 561
            N+  ++VG+L   ++   +   F  FG+     +++D +  ++  Y FI + +   A  A+  M+G ++   QI+ NW++     P     ++ K + Y         ++  ++ G +   + + ++++ FS FGQ+++ +V  +PD   +G++FV
Sbjct:   93 NHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYESNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRV--FPD---KGYSFV 243          

HSP 3 Score: 51.9878 bits (123), Expect = 4.315e-7
Identity = 43/190 (22.63%), Postives = 79/190 (41.58%), Query Frame = 1
Query:  406 IDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEEL----LNCHFQEFGRIDSVKVYPE------KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWG 945
            +D      ++VG++  DV E ++ + F+Q G     K++    G    + FV F     A  A+ +M+      + +K NWA+                  +   +   T+ + +V   +L+ E+    +   F  FG+I   +V  +      KG+ FI+F+    A  AI Q +G  +    I+ NW 
Sbjct:    1 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAGNDP-YCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWAS------------------MPSSQKKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWA 171          
BLAST of TIA1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000018970.2 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 102.449 bits (254), Expect = 2.489e-23
Identity = 71/266 (26.69%), Postives = 133/266 (50.00%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTN---TNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPE----KGHAFINFVTHEAAARAISQRHG 906
            I++ NL  +++++ L   F  FG  +SC ++ D +  +  Y F+ +  H +A  A+  M+G+ +  N  KV      S     A + +   +++N   +++ + G D+D+  LK+ F ++G  +  +V+    G+S+GF FVSF   ++A+RA+  M+    + + +    A + G    +      R +E + K+  +T     N+YV    + L +E L   F  FG I S KV  E    KG  F+ F + E A +A+++ +G
Sbjct:  101 IFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLL--NDRKVFVGRFKSRKEREAEMGARAKEFTN---VYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTEL----KRKFEQM-KQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNG 355          

HSP 2 Score: 94.7449 bits (234), Expect = 9.493e-21
Identity = 70/269 (26.02%), Postives = 123/269 (45.72%), Query Frame = 1
Query:  133 TIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTN-PYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSS-GPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPE-----KGHAFINFVTHEAAARAISQRHGYKIN 918
            ++YVG+L   V + +L   F   G  +S  + RD   + +  YA++ +     A  AL  M+   +    +++ WS   PS            +  S    IF+ ++   +D   L + FS FG ++  KVV   +G S+G+ FV F   + AERAI+ M+    ++R +             +F     R  E+  +    TN  +   GE++ +E L   F ++G   S++V  +     KG  F++F  HE A RA+ + +G ++N
Sbjct:   12 SLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPS------------LRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVG----------RFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELN 257          

HSP 3 Score: 75.485 bits (184), Expect = 1.920e-14
Identity = 46/180 (25.56%), Postives = 86/180 (47.78%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWS--SGPSTIPGPAAVTSAKIDYSNSVQ---IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN 660
            +Y+ N  + ++D+ L  +FG +G  +S  ++ D S ++  + F+ +  H  A  A+  M+G  +   Q+ V  +   G             K D     Q   ++V ++   +D+  L++ FS FG +  AKV+    G+S+GF FV FS+ +EA +A+  M+      + +    A R 
Sbjct:  193 VYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVM-MEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRK 371          

HSP 4 Score: 73.9442 bits (180), Expect = 6.428e-14
Identity = 51/172 (29.65%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPE----KGHAFINFVTHEAAARAISQRHGYKINDNVI 930
            ++VGD+  DV E ML E FS  G ++  +V R     +S G+A+V+F    +AERA+ +M+      R ++  W+ R+                   +++ + N  +    +++  + L   F  FG I S KV  +    KG+ F++F THEAA RAI + +G  +ND  +
Sbjct:   13 LYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDP----------------SLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKV 168          
BLAST of TIA1-like protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 132.494 bits (332), Expect = 9.496e-37
Identity = 72/179 (40.22%), Postives = 104/179 (58.10%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN--GLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            +FVGD+  ++    L+  F+ FG++ DA+VV+    G+S+G+ FVSF  + +AE AIQ M   W   R I+ NWATR      G Q        +E V  ++  TN  VY  G  + LTE+L+   F  FG+I  ++V+P+KG++FI F THE+AA AI   +G  I    +KC WGKE
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPDKGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKE 183          

HSP 2 Score: 74.3294 bits (181), Expect = 1.819e-15
Identity = 50/231 (21.65%), Postives = 108/231 (46.75%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK-------IDYSN--SVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQ 798
            ++VG+L   ++   L   F  FG+     +++D +  ++  Y F+ +     A  A+  M G ++   QI+ NW++     P  +  T  K       ++ S+  +  ++ G I   + E ++++ F  FGQ+++ +V  +PD   +G++F+ F+  + A  AI S++ +     ++KC W         QF +   +  ++ Y + P T    +  G    ++ +N  +Q
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRV--FPD---KGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKEASDPVNQFQQ---QFSQVGYTQQPWTQWGPWYGGSQQYQQFINNGWQ 227          
BLAST of TIA1-like protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 102.449 bits (254), Expect = 4.716e-24
Identity = 69/267 (25.84%), Postives = 135/267 (50.56%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSG--PSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKE--APLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPE----KGHAFINFVTHEAAARAISQRHG 906
            +++ NL  +++++ +   F  FG  +SC ++ D +  +  Y F+ +    +A  A+  M+G+ + N+++      G   S       + +   +++N   +++ + G D+DE  L+E F +FG+ +   V+    G+SRGF FVSF   ++A+RA+  M+    + RT+    A + G    +      R +E++ +E  +     N+YV    +N+ +E L   F  +G I S KV  E    KG  F+ F + E A +A+++ +G
Sbjct:  101 VFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETQEAADRAIEKMNGM-LLNDRLARRRFVGRFKSRKEREQEMGARAKEFTN---VYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAEL----KRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSEEGRSKGFGFVCFSSPEEATKAVTEMNG 358          

HSP 2 Score: 97.8265 bits (242), Expect = 1.492e-22
Identity = 68/272 (25.00%), Postives = 126/272 (46.32%), Query Frame = 1
Query:  133 TIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDF-SCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPE-----KGHAFINFVTHEAAARAISQRHGYKINDNVI 930
            ++YVG+L   V + +L   F   G  +S  + RD  + ++  YA++ +     A  AL  M+   +    I++ WS                +  S    +F+ ++   +D   + + FS FG ++  KVV   +G SRG+ FV F  ++ A+RAI+ M+    ++R  +  +  R       F     R  E+  +    TN  +   G+++ E+ L   F +FG+  SV V  +     +G  F++F  HE A RA+++ +G ++N   +
Sbjct:   12 SLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQ-----------RDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGR-------FKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTV 264          

HSP 3 Score: 70.8626 bits (172), Expect = 1.212e-13
Identity = 40/180 (22.22%), Postives = 86/180 (47.78%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGP-----AAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRN 660
            +Y+ N  D +++  L   FG FG+ +S  ++ D   ++  + F+ +  H  A  A++ M+G  +    + V  +                +   +I     V ++V ++  ++D+  L++ F+ +G +   KV+   +G+S+GF FV FS+ +EA +A+  M+     ++ +    A R 
Sbjct:  196 VYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVM-SEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRK 374          

HSP 4 Score: 68.1662 bits (165), Expect = 9.975e-13
Identity = 48/173 (27.75%), Postives = 86/173 (49.71%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPE----KGHAFINFVTHEAAARAISQRHGYKINDNVIK 933
            ++VGD+  DV E ML E FS  G ++  +V R     +S G+A+V+F    +AERA+ +M+      + I+  W+ R+                   +++ + N  +    +++  + +   F  FG I S KV  +    +G+ F++F T EAA RAI + +G  +ND + +
Sbjct:   13 LYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDP----------------SLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENGSRGYGFVHFETQEAADRAIEKMNGMLLNDRLAR 169          
BLAST of TIA1-like protein vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 90.8929 bits (224), Expect = 1.639e-20
Identity = 58/209 (27.75%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  127 NRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD-FSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDA-KVVRYPD-GQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTN 744
            + T+YVG L D V++ LL  +F   G  ++ H+ +D  + Q   Y F+E+     A  A+  M+ I ++   I+VN +S            +  +D      IF+G++  ++DE +L + FS FG ++   K +R P+ G S+G+AF++F++ + ++ AI++M+  +  NR I  ++A +    GE+      R   L+  + PL+  +
Sbjct:   12 DATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKAS----------AHNKNLDVG--ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDSKGERHGSAAER---LLAAQNPLSQAD 205          

HSP 2 Score: 47.7506 bits (112), Expect = 2.428e-6
Identity = 47/183 (25.68%), Postives = 82/183 (44.81%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNG--LDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRI-DSVKVY--PE----KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNW 942
            ++VG +   V E +L E F Q G +++  + +     Q +G+ FV F   ++A+ AI+ M+    + + I+ N A+ +   LD                        N+++      + E+LL   F  FG I  + K    PE    KG+AFINF + EA+  AI   +G  + +  I  ++
Sbjct:   15 VYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLD---------------------VGANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSY 176          
BLAST of TIA1-like protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 77.0258 bits (188), Expect = 1.110e-15
Identity = 60/233 (25.75%), Postives = 112/233 (48.07%), Query Frame = 1
Query:  259 AFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQF-GQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKE--APLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHA----FINFVTHEAAARAISQRHGYKINDNVI 930
             F+ +    +A  A+  M+G+ +  N  KV      S     A   +   +++N   +++ + G D+D+  L+E F Q+ G+ +  KV+    G+S+GF FVSF   ++A++A+  M+    + R I    A +      +      R +E++ +E  +     N+YV    +N+ +E L   F  FG I S KV  E+G +    F+ F + E A +A+++ +G  I    +
Sbjct:    1 GFVHFETQEAADKAIEKMNGMLL--NDRKVFVGRFKSRKEREAEFGAKAREFTN---VYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELK----RKFEMLKQERMSKYQGVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMMEEGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPL 224          
BLAST of TIA1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002852.1 (pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-1 gene:ENSPMAG00000002591.1 transcript:ENSPMAT00000002852.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 4.615e-13
Identity = 46/169 (27.22%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFS---CQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTS------AKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKT 615
            ++VG +P + +++ L  +F  FG     +I+RD +    Q+    F+ +    +A  A +A+  I                T+PG  A T       +        ++F+G I     E  ++  FS FGQ+ + +V+R PDGQS+G AF++++ R  A+ AI+ MH++
Sbjct:   54 MFVGQIPRSWSEKELRDLFEQFGPVYEINIVRDRTQKPPQSRGCCFVTFYTRKAALEAQNALHNI---------------KTLPGLHAPTELVPSTTSSSSSLEERKLFIGMISKKCSENDIRAMFSPFGQMEECRVLRGPDGQSKGCAFITYTARAMAQNAIKGMHQS 207          

HSP 2 Score: 46.9802 bits (110), Expect = 2.658e-6
Identity = 47/176 (26.70%), Postives = 73/176 (41.48%), Query Frame = 1
Query:  418 NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR---YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELV----YKEAPLTNTNVYVA--GENLTEELLNCHFQEFGRIDSVKVY--PE---KGHAFINFVTHEAAARAISQRH 903
            +++++FVG I     E  L++ F QFG + +  +VR       QSRG  FV+F  R  A  A  ++H           N  T  GL           P ELV       + L    +++    +  +E  +   F  FG+++  +V   P+   KG AFI +     A  AI   H
Sbjct:   50 DAIKMFVGQIPRSWSEKELRDLFEQFGPVYEINIVRDRTQKPPQSRGCCFVTFYTRKAALEAQNALH-----------NIKTLPGLHA---------PTELVPSTTSSSSSLEERKLFIGMISKKCSENDIRAMFSPFGQMEECRVLRGPDGQSKGCAFITYTARAMAQNAIKGMH 205          
BLAST of TIA1-like protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 100.908 bits (250), Expect = 5.403e-24
Identity = 55/178 (30.90%), Postives = 95/178 (53.37%), Query Frame = 1
Query:  127 NRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVV-RYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR 657
            +R +YVGNL  A+ + +L + F   G   +  I+ D + +   YAF+EY     A++AL  ++G  + NN +K+NW           A  S +    ++  +FVGD+ ++VD+  L+  F  F   +   V+     G SRG+ FVSF+++D+A+ A+ SM     + R ++ NWA +
Sbjct:   74 DRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINW-----------AFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240          

HSP 2 Score: 48.9062 bits (115), Expect = 6.333e-7
Identity = 31/91 (34.07%), Postives = 41/91 (45.05%), Query Frame = 1
Query:  685 KYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            +  P+  + + + AP   T  Y+       TE  L   FQ FG I   K YPEKG  FI + THE AA  I     +      ++  WGKE
Sbjct:  323 QVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 413          
BLAST of TIA1-like protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 84.7297 bits (208), Expect = 2.519e-18
Identity = 67/273 (24.54%), Postives = 121/273 (44.32%), Query Frame = 1
Query:  133 TIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTN-PYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCN-WATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQE----FGRIDSVKVYPE-----KGHAFINFVTHEAAARAISQRHGYKIN 918
            ++YVG+L  +V++  L  IF   G   S  + RD   +T+  YA++ + DH +   A+  ++   +     ++ WS                +    S  IF+ ++  D+D   L + FS FG ++ +K+    +G+S+GF FV F     A+ AI +++    + + I      +R   D +              +E     TN+YV  +N+  E  +  FQE    FG I S  +  +     KG  F+N+  HE A +A+   +  ++N
Sbjct:   39 SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQ-----------RDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQ-------------LEETKAHYTNLYV--KNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELN 285          

HSP 2 Score: 73.9442 bits (180), Expect = 6.980e-15
Identity = 47/201 (23.38%), Postives = 90/201 (44.78%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPST-----IPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKE 723
            +YV N+     D+    +F  FG  +S  + +D   +   + F+ Y  H  A  A+ A++   +   ++ V  +   +           A    K+     V +FV ++   VD+  L+E F+ +G +  AKV+R  +G+S+GF FV FS  +EA +AI   ++     + +    A R  +   Q  +      ++ Y++
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQQ 421          
BLAST of TIA1-like protein vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 72.7886 bits (177), Expect = 1.468e-14
Identity = 69/280 (24.64%), Postives = 123/280 (43.93%), Query Frame = 1
Query:  271 YTDHPSASLALSAM--DGIYMWN---NQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGF-SQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA---------------TRNGLDGE-----------------------------QFIKYTPRPYELVYKEAPLTNTNVYVAGEN--LTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            + D PS++ A +A+  +G+ + N    ++K+NW++   +    +  +   +   N+  IFVGD+  +V E  L E F +++     AK+V     G S+G+ FV F+N DE + A+  M   + + R IK                   + + L+ E                             QFI    +   L +   P  NT V++ G +  +TE+ L  +FQ FG I  VK+   K   F+ +V   +A  AI+   G+ I ++ ++ +WG+ 
Sbjct:  110 FVDFPSSTHAANALLKNGMLIPNFPNKKLKLNWATSSYSN---SNNSLNNVKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDP-NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRS 385          
BLAST of TIA1-like protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 69.707 bits (169), Expect = 1.180e-13
Identity = 38/176 (21.59%), Postives = 89/176 (50.57%), Query Frame = 1
Query:  133 TIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG-QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWAT 654
            TI+VG L  +++D+ L + F + G  I   +I +    ++  Y ++++ +   A  A+  M G  +    I  + S+         A          S  +F+G++  + D   + E F++ G+++  ++  +P+  Q +GF +V FSN ++A++A+ ++   +  NR ++ ++++
Sbjct:  169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSS 344          

HSP 2 Score: 63.929 bits (154), Expect = 1.117e-11
Identity = 52/183 (28.42%), Postives = 88/183 (48.09%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDG--QSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR----NGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKV--YPE----KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNW 942
            IFVG +   +D+  LK+ F   G +I A+V+ Y  G  +SRG+ +V F N+  AE+AIQ M       R I C+ +T     N    ++F      P + ++    L N + + A  +   EL   H    G + SV++  +PE    KG  ++ F   E A +A+    G  I++  ++ ++
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVI-YERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLF----LGNLS-FNADRDAIFELFAKH----GEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDF 342          
BLAST of TIA1-like protein vs. Ensembl Yeast
Match: HSH49 (U2-snRNP associated splicing factor; similar to the mammalian splicing factor SAP49; proposed to function as a U2-snRNP assembly factor along with Hsh155p and binding partner Cus1p; contains two RNA recognition motifs (RRM) [Source:SGD;Acc:S000005846])

HSP 1 Score: 58.9214 bits (141), Expect = 1.252e-10
Identity = 53/207 (25.60%), Postives = 94/207 (45.41%), Query Frame = 1
Query:  133 TIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQT-NPYAFIEYTDHPSASLALSAMDG-IYMWNNQIKVNW---SSG----PSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEA 726
            T+YVGN+   +  + L  +F      +     +D   Q    YAFIE+ +   A  A+  M+  + +++  IKV     S+G    PS I     +  AK        +F+ ++   +D   L + F++FG+LI    + Y        A+V F + ++A+ AI+S++     N  I  ++A +   +G+   KY      L+ KEA
Sbjct:   10 TVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAK--------LFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFKE--NGKGNAKYGDDVDRLLNKEA 206          
BLAST of TIA1-like protein vs. Ensembl Nematostella
Match: EDO32492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY1])

HSP 1 Score: 127.872 bits (320), Expect = 5.823e-35
Identity = 77/243 (31.69%), Postives = 126/243 (51.85%), Query Frame = 1
Query:  139 YVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYP-DGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR-NGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFI 855
            YVGNL      +L+  IF    + + C +I   S +  PY F+E+  H  A  A   MD   + + ++KVNW++     PG       + D +N   IFVGD+  +VD  +L++ F  FG++ + +VV+ P   +S+GF FVSF  R++A +AI  M       + +K NWA R N     +++      ++ V+ ++   NT VYV     ++ +  L   F ++G I   KV+ +KG+AFI
Sbjct:    1 YVGNLDPKCTQELICSIFNKIAKVVRCKMINSVSYK-GPYCFVEFETHADAQEAKFRMDQRTVMDKKLKVNWATNH---PG-----MKRGDTNNHFHIFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQSKYVCVKNLLWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILETKVFADKGYAFI 234          

HSP 2 Score: 63.1586 bits (152), Expect = 1.786e-11
Identity = 36/156 (23.08%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRD-FSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSN--------SVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVS 564
            N+  I+VG+L + V++ LL + F  FG+     +++D    ++  + F+ +     A+ A++ MD + +   Q+K NW++  +       V    + + +        +  ++VG++  DV +  L++ FSQ+G +++ KV        +G+AF+ 
Sbjct:   85 NHFHIFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQSKYVCVKNLLWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILETKVF-----ADKGYAFIK 235          
BLAST of TIA1-like protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 98.5969 bits (244), Expect = 1.594e-22
Identity = 70/269 (26.02%), Postives = 131/269 (48.70%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKV-NWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTN----TNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPE-----KGHAFINFVTHEAAARAISQRHG 906
            I++ NL  +++++ L   F  FG  +SC I +D       Y F+ +    +A  A++ +DG+ + + ++ V  W S    I     + +    ++N   ++V + G D+D+  +KE  ++ G+++  KV+  P+G+S+GF FVSF   +EAE A+  ++      R +   WA R     E+  +      E+  K     N     N+Y+    + + +E L   F  +G I S KV  +     KG  F+ F + E A +A+++ +G
Sbjct:  103 IFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERI---EKMGTQPKKFTN---VYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL---WAGRAKKRAERAAEVK---AEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSPEEATKAVTEMNG 359          

HSP 2 Score: 62.003 bits (149), Expect = 1.751e-10
Identity = 46/173 (26.59%), Postives = 81/173 (46.82%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPE-----KGHAFINFVTHEAAARAISQRHGYKINDNVI 930
            ++VGD+  DV E ML E FS  G ++  +V R     +S G+A+V+F     AE+A+ +M+      R  +  W  R+                   +++ + N  +    +++  + L   F  FG I S K+  +     KG+ F++F T +AA  AI++  G  +ND  +
Sbjct:   15 LYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRD----------------PSLRKSGVGNIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKV 171          
BLAST of TIA1-like protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 89.3521 bits (220), Expect = 7.902e-20
Identity = 59/207 (28.50%), Postives = 108/207 (52.17%), Query Frame = 1
Query:  133 TIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNP-YAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDA-KVVRYPD-GQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTN 744
            TIYVG L + V++ L+  +F   G  ++ H+ +D   Q +  Y F+E+     A  A+  M+ I ++   I+VN +S            +  +D      +F+G++  +VDE +L + FS FG ++   K++R  D G S+GFAF++F++ D ++ AI++M+  +  NR I  ++A +    GE+      R   L+  + PL   +
Sbjct:   14 TIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKAS----------AHNKNLDVG--ANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKESKGERHGSAAER---LLAAQNPLAQAD 205          
BLAST of TIA1-like protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 77.0258 bits (188), Expect = 8.367e-16
Identity = 46/169 (27.22%), Postives = 87/169 (51.48%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIK 639
            + +  +P +++ + + +IFG  G   SC +IRD +  Q+  YAF+ Y +   A+ A+  M+G  + N  +KV++          A  +S +I  +N   +++  +  D+ E  ++  F  FG++I +KV++   G+ RG  FV F  R EA+ AI  ++        +K
Sbjct:   12 LIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSF----------ARPSSTEIKNAN---LYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVK 167          

HSP 2 Score: 63.929 bits (154), Expect = 1.921e-11
Identity = 49/188 (26.06%), Postives = 83/188 (44.15%), Query Frame = 1
Query:  472 LKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPE-----KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAF 1011
            +K+ F   G +   K++R    GQS G+AFV++ N D+A +A++ M+     N+T+K ++A               RP     K     N N+Y++G  +++ EE +   F+ FG+I + KV  +     +G  F+ F     A  AI   +   +    +K      N   S     PL P + S  
Sbjct:   26 IKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA---------------RPSSTEIK-----NANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVKFANPPNSRQPAMPLSPALTSPL 193          
BLAST of TIA1-like protein vs. Ensembl Nematostella
Match: EDO46547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ1])

HSP 1 Score: 63.1586 bits (152), Expect = 5.309e-11
Identity = 70/281 (24.91%), Postives = 124/281 (44.13%), Query Frame = 1
Query:  136 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLID--AKVVRYPDGQ----SRGFAFVSF-SNRDEA---ERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGK 948
            ++VG +P  + +  L+ +F   G      ++ DF+ Q   YAF+ YT    A   +  ++     N +I+     G         V S+     ++ ++FVG I   V +    E  ++  ++ D    V+ YP  Q    +RGFAFV + S+RD A    + +    + W H   I  +WA     + EQ +       E++ +   L   N+ ++    TEE +   F +FG ++ VK    K + FI+F T E A  A+   +  +++ N I+    K
Sbjct:   59 VFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFNGQNRGYAFVVYTSKDDAKRCVKTLN-----NYEIRKGKCIG---------VCSS----VDNCRLFVGGIPKKVKK---DEIMAEVSKVTDNVVDVIVYPSAQDKTKNRGFAFVEYISHRDAAMARRKLMTGKIQLWGHQ--IAVDWA-----EPEQEVD-----QEIMDQVKVLYARNLLLS---TTEETIEQAFSKFGEVERVKKI--KDYCFIHFRTKEQARDAMEAMNETELDGNEIEVTLAK 301          

HSP 2 Score: 47.3654 bits (111), Expect = 5.485e-6
Identity = 41/193 (21.24%), Postives = 85/193 (44.04%), Query Frame = 1
Query:  427 QIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPE-------KGHAFINFVTHEAAARAISQRHGYKIN--DNVIKCNWGKENFAISTSAM 978
            ++FVG I  D+ E  L   F   G + + +++   +GQ+RG+AFV ++++D+A+R +++++   +  R  KC     +  +   F+   P+          +    +      +T+ +++           V VYP        +G AF+ +++H  AA A  +    KI    + I  +W +    +    M
Sbjct:   58 EVFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFNGQNRGYAFVVYTSKDDAKRCVKTLNN--YEIRKGKCIGVCSSVDNCRLFVGGIPK---------KVKKDEIMAEVSKVTDNVVD-----------VIVYPSAQDKTKNRGFAFVEYISHRDAAMARRKLMTGKIQLWGHQIAVDWAEPEQEVDQEIM 228          
BLAST of TIA1-like protein vs. Ensembl Medaka
Match: ENSORLT00000019582.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614])

HSP 1 Score: 202.601 bits (514), Expect = 2.776e-61
Identity = 108/279 (38.71%), Postives = 166/279 (59.50%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            RT+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ DH  A+ +L+AM+G  +   ++KVNW++ P         TS K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   +E V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F+ F +HE+AA AI   +G  I+ +V+KC WGKE
Sbjct:    7 RTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVD-TAGNDPYCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWATTP---------TSQKKDTSNHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSIDGHVVKCYWGKE 275          

HSP 2 Score: 73.559 bits (179), Expect = 4.828e-14
Identity = 42/186 (22.58%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK---------IDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     +++K             ++  ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FV F++ + A  AI S++ T      +KC W 
Sbjct:   93 NHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRV--FPD---KGYSFVRFNSHESAAHAIVSVNGTSIDGHVVKCYWG 273          
BLAST of TIA1-like protein vs. Ensembl Medaka
Match: ENSORLT00000003147.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125])

HSP 1 Score: 193.741 bits (491), Expect = 7.220e-58
Identity = 104/285 (36.49%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKE 951
            M  +  +T+YVGNL   V + L++ +FG  G C SC +I D +   +PY F+E+ +H  A+  ++AM+G  +   ++KVNW++ P         TS K D S+   +FVGD+  ++    +K  F+ FG++ D +VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR           + +   ++ V  ++  +N  VY  G    LTE+++   F  FG+I  ++V+PEKG++F+ F +HEAAA AI   +G  I   V+KC WGKE
Sbjct:    1 MDDEQPKTLYVGNLSRDVTEALILELFGQIGPCKSCKMIVDTAGH-DPYCFVEFYEHRHATATIAAMNGRKILGKEVKVNWATTP---------TSQKKDTSSHFHVFVGDLSPEITTDDIKAAFAPFGKISDCRVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPAPKTTNESSSSKQLSFDEVVNQSSPSNCTVYCGGVTTGLTEQIMRQTFSPFGQIMEIRVFPEKGYSFVRFNSHEAAAHAIVSVNGTSIEGYVVKCYWGKE 275          

HSP 2 Score: 54.6842 bits (130), Expect = 7.327e-8
Identity = 47/189 (24.87%), Postives = 77/189 (40.74%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVA--GENLTEELLNCHFQEFGRIDSVKVYPE------KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTS 972
            ++VG++  DV E ++ E F Q G     K++    G    + FV F     A   I +M+      + +K NWAT            TP       K+   ++ +V+V      +T + +   F  FG+I   +V  +      KG+ F++F     A  AI Q  G  +    I+ NW     A  T+
Sbjct:    9 LYVGNLSRDVTEALILELFGQIGPCKSCKMIVDTAGHDP-YCFVEFYEHRHATATIAAMNGRKILGKEVKVNWAT------------TPTSQ----KKDTSSHFHVFVGDLSPEITTDDIKAAFAPFGKISDCRVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPAPKTT 180          
BLAST of TIA1-like protein vs. Ensembl Medaka
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:101155294])

HSP 1 Score: 185.267 bits (469), Expect = 1.102e-54
Identity = 106/281 (37.72%), Postives = 163/281 (58.01%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQF---IKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I + +   +PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  D+    ++  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +     +    R  E+V + +P  N  VY  G    L+E L+   F  FG+I  ++V+PEKG++FI F +H++AA AI   +G  I  + +KC WGKE+
Sbjct:    8 RTLYVGNLSRDVTEILILQLFTQIGPCKSCKMITEHTS-NDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLNPDISTEDVRAAFTPFGKISDARVVKDLTTGKSKGYGFVSFYNKLDAENAIVHMAGQWLGGRQIRTNWATRKPPAPKSLQDSVSKQLRFEEVVTQSSP-QNCTVYCGGIQSELSEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHDSAAHAIVSVNGTSIEGHAVKCYWGKES 277          

HSP 2 Score: 74.7146 bits (182), Expect = 2.042e-14
Identity = 45/188 (23.94%), Postives = 96/188 (51.06%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAV---TSAKIDYSNSV--------QIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   ++ + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P P ++    S ++ +   V         ++ G I  ++ E ++++ FS FGQ+++ +V  +P+   +G++F+ FS+ D A  AI S++ T      +KC W 
Sbjct:   94 NHFHVFVGDLNPDISTEDVRAAFTPFGKISDARVVKDLTTGKSKGYGFVSFYNKLDAENAIVHMAGQWLGGRQIRTNWAT--RKPPAPKSLQDSVSKQLRFEEVVTQSSPQNCTVYCGGIQSELSEHLMRQTFSPFGQIMEIRV--FPE---KGYSFIRFSSHDSAAHAIVSVNGTSIEGHAVKCYWG 274          
BLAST of TIA1-like protein vs. Ensembl Medaka
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:101155294])

HSP 1 Score: 179.104 bits (453), Expect = 3.721e-52
Identity = 107/295 (36.27%), Postives = 162/295 (54.92%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTN--------------PYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQF---IKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 954
            RT+YVGNL   V + L++++F   G C SC +I +     N              PY F+E+ +H  A+ AL+AM+G  +   ++KVNW++ PS         S K D SN   +FVGD+  D+    ++  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AI  M   W   R I+ NWATR     +     +    R  E+V + +P  N  VY  G    L+E L+   F  FG+I  ++V+PEKG++FI F +H++AA AI   +G  I  + +KC WGKE+
Sbjct:    8 RTLYVGNLSRDVTEILILQLFTQIGPCKSCKMITEVPIFVNRWGSSFFLQHTSNDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWATTPS---------SQKKDTSNHFHVFVGDLNPDISTEDVRAAFTPFGKISDARVVKDLTTGKSKGYGFVSFYNKLDAENAIVHMAGQWLGGRQIRTNWATRKPPAPKSLQDSVSKQLRFEEVVTQSSP-QNCTVYCGGIQSELSEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHDSAAHAIVSVNGTSIEGHAVKCYWGKES 292          

HSP 2 Score: 74.3294 bits (181), Expect = 2.605e-14
Identity = 45/188 (23.94%), Postives = 96/188 (51.06%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAV---TSAKIDYSNSV--------QIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWA 651
            N+  ++VG+L   ++ + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P P ++    S ++ +   V         ++ G I  ++ E ++++ FS FGQ+++ +V  +P+   +G++F+ FS+ D A  AI S++ T      +KC W 
Sbjct:  109 NHFHVFVGDLNPDISTEDVRAAFTPFGKISDARVVKDLTTGKSKGYGFVSFYNKLDAENAIVHMAGQWLGGRQIRTNWAT--RKPPAPKSLQDSVSKQLRFEEVVTQSSPQNCTVYCGGIQSELSEHLMRQTFSPFGQIMEIRV--FPE---KGYSFIRFSSHDSAAHAIVSVNGTSIEGHAVKCYWG 289          
BLAST of TIA1-like protein vs. Ensembl Medaka
Match: ENSORLT00000019586.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614])

HSP 1 Score: 171.785 bits (434), Expect = 1.030e-50
Identity = 92/252 (36.51%), Postives = 148/252 (58.73%), Query Frame = 1
Query:  130 RTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVR-YPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPR--PYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTH 870
            RT+YVGNL   V + L++++F   G C SC +I D +   +PY F+E+ DH  A+ +L+AM+G  +   ++KVNW++ P         TS K D SN   +FVGD+  ++    +K  F+ FG++ DA+VV+    G+S+G+ FVSF N+ +AE AIQ M   W   R I+ NWATR     +   +   +   +E V  ++  +N  VY  G    LTE+L+   F  FG+I  V+V+P+KG++F++ +++
Sbjct:    7 RTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVD-TAGNDPYCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWATTP---------TSQKKDTSNHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRVFPDKGYSFVSAISN 248          

HSP 2 Score: 57.7658 bits (138), Expect = 3.809e-9
Identity = 36/179 (20.11%), Postives = 85/179 (47.49%), Query Frame = 1
Query:  124 NNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSC-QTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAK---------IDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNR 630
            N+  ++VG+L   +  + +   F  FG+     +++D +  ++  Y F+ + +   A  A+  M G ++   QI+ NW++     P     +++K             ++  ++ G +   + E ++++ FS FGQ+++ +V  +PD   +G++FVS  +        Q ++ +   N+
Sbjct:   93 NHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRV--FPD---KGYSFVSAISNGGVMEPTQGLNGSMLANQ 266          

HSP 3 Score: 56.9954 bits (136), Expect = 8.471e-9
Identity = 45/179 (25.14%), Postives = 76/179 (42.46%), Query Frame = 1
Query:  430 IFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVA--GENLTEELLNCHFQEFGRIDSVKVYPE------KGHAFINFVTHEAAARAISQRHGYKINDNVIKCNW 942
            ++VG++  DV EP++ + F+Q G     K++    G    + FV F +   A  ++ +M+      + +K NWAT            TP       K+    + +V+V      +T E +   F  FGRI   +V  +      KG+ F++F     A  AI    G  +    I+ NW
Sbjct:    9 LYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVDTAGNDP-YCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWAT------------TP----TSQKKDTSNHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNW 170          
BLAST of TIA1-like protein vs. Planmine SMEST
Match: SMESG000055075.1 (SMESG000055075.1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 324/324 (100.00%), Postives = 324/324 (100.00%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQSGAIQPPPFYIPNPTQQFYQQ 1083
            MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQSGAIQPPPFYIPNPTQQFYQQ
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQSGAIQPPPFYIPNPTQQFYQQ 324          
BLAST of TIA1-like protein vs. Planmine SMEST
Match: SMESG000055074.1 (SMESG000055074.1)

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 312/323 (96.59%), Postives = 315/323 (97.52%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQSGAIQPPPFYIPNPTQQFYQ 1080
            MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTS MPPLQP +ASAFL Q+GA+QPPPFY   P Q FYQ
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSTMPPLQPAIASAFLTQTGALQPPPFYNAPPIQPFYQ 323          
BLAST of TIA1-like protein vs. Planmine SMEST
Match: SMESG000044648.1 (SMESG000044648.1)

HSP 1 Score: 506.523 bits (1303), Expect = 0.000e+0
Identity = 246/325 (75.69%), Postives = 280/325 (86.15%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAFLAQSGAIQPPPFYIPNPTQQFYQ 1080
            M  +NNRTIYVGNLPDA+ D LL+RIFGNFGQC SCHIIRDFS QTNPYAFIEYT+H +ASLAL+AMDGIYMWNNQIKVNWSSG S      A+T++KIDYSN++QIFVGDIGLDVDE MLKEGFS+FG +IDAKVVRY DGQSRGFAFV++S R++AE+AI++MHKTWFHNRTIKCNWATRNGLDG+QFIKYTPRPYELVYKEAPLTNTNVY+AG  E +TEEL+  HF+EFGRID+VK+Y EK HAFINFVTHEAAARAISQRHGYKIN++VIKCNWGKENF  S + + P+QP +ASA L QS   Q   +  P   QQ YQ
Sbjct:    1 MDIRNNRTIYVGNLPDAITDHLLLRIFGNFGQCASCHIIRDFSGQTNPYAFIEYTNHSAASLALAAMDGIYMWNNQIKVNWSSGNSLGTAAPAITASKIDYSNTIQIFVGDIGLDVDESMLKEGFSKFGSVIDAKVVRYQDGQSRGFAFVAYSRREDAEKAIENMHKTWFHNRTIKCNWATRNGLDGDQFIKYTPRPYELVYKEAPLTNTNVYIAGIPEGITEELIRVHFEEFGRIDAVKIYQEKAHAFINFVTHEAAARAISQRHGYKINESVIKCNWGKENFGFS-APLLPIQPAVASAILNQSAMQQFQQYCNPPSQQQNYQ 324          
BLAST of TIA1-like protein vs. Planmine SMEST
Match: SMESG000055085.1 (SMESG000055085.1)

HSP 1 Score: 446.047 bits (1146), Expect = 3.546e-157
Identity = 206/294 (70.07%), Postives = 245/294 (83.33%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAA-VTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAG--ENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPP 984
            M   NN+ IYVGNLP  + DQLL+ +FG+FGQC+ CHI+RDFS Q NPYAFIE+ +H +ASLA++ M+ I +W +Q+KVNW+SG      PA+ +T+ K+DYS ++QIFVGDIGLDV+E MLK+ FSQFG +ID KVVRYPDGQS+GFAF+SF+NR +AE AI SMHKTW HNRTIKCNWATRNG D EQF +YTPRPYELVYKEAPLTNTNVYVAG  ENLTEEL+ CHF+EFGRIDSVKV+P+K +AFIN+ THEAAARAISQRHGYKIN+NV+KCNWGKENF    S   P
Sbjct:    1 MDPTNNKCIYVGNLPHEITDQLLLTVFGHFGQCVGCHIMRDFSGQINPYAFIEFNEHQAASLAVAGMNNISLWGHQLKVNWASGSQN---PASNITNVKVDYSKAIQIFVGDIGLDVNEQMLKDAFSQFGSIIDVKVVRYPDGQSKGFAFLSFTNRQDAENAITSMHKTWLHNRTIKCNWATRNGTDEEQFKQYTPRPYELVYKEAPLTNTNVYVAGITENLTEELVRCHFEEFGRIDSVKVFPDKAYAFINYSTHEAAARAISQRHGYKINNNVVKCNWGKENFGFGPSTTGP 291          
BLAST of TIA1-like protein vs. Planmine SMEST
Match: SMESG000044649.1 (SMESG000044649.1)

HSP 1 Score: 279.641 bits (714), Expect = 1.171e-90
Identity = 150/299 (50.17%), Postives = 198/299 (66.22%), Query Frame = 1
Query:  112 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTI-PGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR----NGLDGEQFIKY--TPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPL 987
            M  KNN+TIYV NLP  ++++ L+ IFG+FG CISC +  + S      A+IE+ +  SA  AL AM+   M +NQ+ V  +         P  V S K+DYS  VQIFVG IG D+DE  LK+GFS  GQ+IDAKVVR PDGQ +GFAFVSFSN DEA  AIQSM+ T FHNR I+CNWAT+    NG+   + + +  + +  E +  EAP TNT+VYV  ENL+E++L   F+ FG+I ++K +PEK HAF+N+ TH+AAA AI Q +GYKIN   +KCNWGK+N A   +   P+
Sbjct:    1 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEASAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPM 293          
The following BLAST results are available for this feature:
BLAST of TIA1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIA14.826e-5637.10TIA1 cytotoxic granule associated RNA binding prot... [more]
TIAL11.215e-5538.21TIA1 cytotoxic granule associated RNA binding prot... [more]
TIA14.602e-5335.71TIA1 cytotoxic granule associated RNA binding prot... [more]
TIA14.970e-5335.71TIA1 cytotoxic granule associated RNA binding prot... [more]
TIAL15.109e-5336.82TIA1 cytotoxic granule associated RNA binding prot... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tiar-11.248e-6137.45TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-21.339e-5133.45TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-19.066e-4733.09TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-11.668e-4437.21TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-14.735e-4438.54TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rox81.936e-6238.03gene:FBgn0005649 transcript:FBtr0084592[more]
Rox81.936e-6238.03gene:FBgn0005649 transcript:FBtr0084594[more]
Rox82.422e-6238.03gene:FBgn0005649 transcript:FBtr0333200[more]
Rox82.422e-6238.03gene:FBgn0005649 transcript:FBtr0333202[more]
Rox82.422e-6238.03gene:FBgn0005649 transcript:FBtr0333201[more]
back to top
BLAST of TIA1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia13.348e-5936.49TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia11.217e-5736.96TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia1l8.060e-5635.64cytotoxic granule-associated RNA binding protein 1... [more]
tia1l2.712e-5535.31cytotoxic granule-associated RNA binding protein 1... [more]
tial16.069e-5536.90TIA1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia17.378e-6037.99TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia13.525e-5937.63TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia12.705e-5836.88TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia12.287e-5636.56TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia11.502e-5435.00TIA1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tia18.854e-5737.32cytotoxic granule-associated RNA binding protein 1... [more]
Tia11.301e-5637.10cytotoxic granule-associated RNA binding protein 1... [more]
Tial12.260e-5638.21Tia1 cytotoxic granule-associated RNA binding prot... [more]
Tial12.260e-5638.21Tia1 cytotoxic granule-associated RNA binding prot... [more]
Tial19.160e-5436.82Tia1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of TIA1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01085|TIAR_HUMAN5.837e-5538.21Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 ... [more]
sp|P70318|TIAR_MOUSE6.407e-5336.82Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1... [more]
sp|P52912|TIA1_MOUSE1.024e-5235.71Nucleolysin TIA-1 OS=Mus musculus OX=10090 GN=Tia1... [more]
sp|P31483|TIA1_HUMAN2.387e-5235.71Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9... [more]
sp|Q9M427|UBP1_NICPL1.102e-4032.72Oligouridylate-binding protein 1 OS=Nicotiana plum... [more]
back to top
BLAST of TIA1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG770.000e+094.74TIA1-like protein OS=Dugesia japonica OX=6161 GN=T... [more]
D5JG788.148e-17081.63TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
D5JG752.264e-8249.48TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
A0A1B0GMD71.176e-6540.86Uncharacterized protein OS=Phlebotomus papatasi OX... [more]
T1G9I05.105e-6538.70Uncharacterized protein OS=Helobdella robusta OX=6... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l1.990e-6035.65TIA1 cytotoxic granule associated RNA binding prot... [more]
tia1l1.990e-6035.65TIA1 cytotoxic granule associated RNA binding prot... [more]
tial11.141e-5436.15TIA1 cytotoxic granule associated RNA binding prot... [more]
tia1l5.356e-4836.44TIA1 cytotoxic granule associated RNA binding prot... [more]
ENSAMXT00000018970.22.489e-2326.69polyadenylate-binding protein 1-like [Source:NCBI ... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l9.496e-3740.22cytotoxic granule-associated RNA binding protein 1... [more]
pabpc44.716e-2425.84poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
sf3b41.639e-2027.75splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
pabpc41.110e-1525.75poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ENSPMAT00000002852.14.615e-1327.22pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PUB15.403e-2430.90Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
PAB12.519e-1824.54Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NAM81.468e-1424.64RNA binding protein, component of the U1 snRNP pro... [more]
NSR11.180e-1321.59Nucleolar protein that binds nuclear localization ... [more]
HSH491.252e-1025.60U2-snRNP associated splicing factor; similar to th... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO324925.823e-3531.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332061.594e-2226.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424177.902e-2028.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348798.367e-1627.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465475.309e-1124.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIA1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000019582.22.776e-6138.71nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614][more]
ENSORLT00000003147.27.220e-5836.49nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125][more]
tial11.102e-5437.72TIA1 cytotoxic granule associated RNA binding prot... [more]
tial13.721e-5236.27TIA1 cytotoxic granule associated RNA binding prot... [more]
ENSORLT00000019586.21.030e-5036.51nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614][more]
back to top
BLAST of TIA1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055075.10.000e+0100.00SMESG000055075.1[more]
SMESG000055074.10.000e+096.59SMESG000055074.1[more]
SMESG000044648.10.000e+075.69SMESG000044648.1[more]
SMESG000055085.13.546e-15770.07SMESG000055085.1[more]
SMESG000044649.11.171e-9050.17SMESG000044649.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029877 ID=SMED30029877|Name=TIA1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1132bp
ATTTAATAAAAAGTTGTTTCTAAAATAATATAATATAATACATATTGTTC
TTCCGTAATCCGATAAAAGTTTGTTTAAATAATTATTTGCAAAGTGTTTA
TTTAAATAGTTATGAGTTTTAAAAATAATCGAACAATCTATGTTGGTAAT
TTACCAGATGCAGTTAATGATCAACTATTAATCAGAATATTTGGAAATTT
CGGTCAATGCATTAGTTGCCATATTATAAGAGATTTTAGTTGCCAAACAA
ATCCATATGCGTTTATCGAATATACTGATCACCCTTCTGCGAGTTTAGCT
TTATCTGCTATGGATGGAATTTATATGTGGAACAATCAAATTAAAGTTAA
TTGGTCAAGTGGACCTAGTACGATACCAGGACCAGCTGCTGTAACATCTG
CTAAAATTGATTATAGTAATTCAGTACAAATATTTGTTGGTGACATTGGC
CTTGATGTGGATGAACCGATGCTGAAAGAAGGATTTAGTCAGTTTGGGCA
ATTGATCGATGCGAAAGTTGTTAGATATCCTGATGGTCAATCCAGAGGAT
TTGCATTTGTTTCGTTTTCAAATCGTGATGAAGCAGAAAGAGCAATACAG
AGTATGCATAAAACATGGTTTCACAATCGTACAATTAAATGTAATTGGGC
AACAAGAAATGGTCTTGACGGTGAGCAGTTTATTAAATATACTCCTCGTC
CATATGAATTGGTGTACAAAGAAGCTCCATTGACTAATACAAATGTCTAT
GTAGCCGGAGAAAATCTGACTGAAGAATTACTGAATTGTCATTTTCAAGA
ATTCGGAAGAATTGATAGTGTTAAAGTGTATCCAGAGAAAGGTCATGCGT
TCATTAATTTTGTTACCCATGAAGCAGCTGCAAGAGCTATAAGTCAGCGA
CACGGATATAAAATAAATGACAATGTTATCAAGTGCAATTGGGGTAAAGA
GAATTTCGCTATATCAACCAGTGCAATGCCGCCATTGCAACCTGGCATGG
CAAGTGCGTTTTTAGCCCAATCTGGAGCTATTCAGCCTCCACCGTTTTAT
ATTCCAAATCCTACACAGCAATTTTATCAGCAGTGATGTATGGAAATTTG
ATAGAATTTTATATTAGTAAATAAAATTTGTC
back to top

protein sequence of SMED30029877-orf-1

>SMED30029877-orf-1 ID=SMED30029877-orf-1|Name=SMED30029877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYA
FIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKID
YSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFV
SFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYEL
VYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINF
VTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPLQPGMASAF
LAQSGAIQPPPFYIPNPTQQFYQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 106..178
e-value: 8.1E-24
score: 95.1
coord: 8..80
e-value: 7.3E-15
score: 65.4
coord: 211..276
e-value: 3.4E-12
score: 56.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 217..274
e-value: 2.1E-12
score: 46.7
coord: 9..77
e-value: 1.2E-15
score: 57.1
coord: 107..176
e-value: 5.3E-18
score: 64.6
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 7..84
score: 15.477
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 210..280
score: 13.652
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 105..182
score: 18.069
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 88..190
e-value: 7.1E-24
score: 86.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..87
e-value: 3.4E-20
score: 74.1
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 205..284
e-value: 6.5E-18
score: 66.7
NoneNo IPR availablePANTHERPTHR47640FAMILY NOT NAMEDcoord: 4..300
NoneNo IPR availablePANTHERPTHR47640:SF5TIA-1/TIAL RNA BINDING PROTEIN HOMOLOGcoord: 4..300
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 194..281
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 5..184