Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30029869
Length (bp)1958
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30029869) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30029869) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30029869) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30029869) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029869

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30029869SMESG000011837.1 dd_Smed_v4_6094_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029869SMESG000011837.1 dd_Smed_v4_6094_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029869SMESG000011837.1 dd_Smed_v4_6094_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029869SMESG000011837.1 SMESG000056433.1 OX_Smed_1.0.10563ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4123])

HSP 1 Score: 421.009 bits (1081), Expect = 9.847e-140
Identity = 221/524 (42.18%), Postives = 318/524 (60.69%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKT-QWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q   +GPGE G+ V +  E+ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y ++LPTTSV+I+FHNEAWS LLRT HSV+NRSP   ++E++L DD+S +  L   LE+YVK  + P   V ++R + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   52 QKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 414.075 bits (1063), Expect = 4.094e-137
Identity = 220/520 (42.31%), Postives = 315/520 (60.58%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q+GPGE G+ V +  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAWS LLRT +SV+NRSP   L EVIL DD+S +  L   LE YVK    +  V+I+R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI + R+T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PYTFPG   +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +  NG V  + C   +   QLW Y+ E  +L ++   QCLD  + ++    T+Q C  S   Q+W
Sbjct:   54 QEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNL--EVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVIMLKC-HHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 400.979 bits (1029), Expect = 5.107e-132
Identity = 217/521 (41.65%), Postives = 310/521 (59.50%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDR-VTIQPCESSNPYQKW 1881
            Q+GPGE G+ V +  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAWS LLRT +SV+NRSP   L EVIL DD+S +  L   LE YVK    +  V+I+R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI + R+T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PYTFPG   +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C  G    Q+FS +  K               +IR +  CL  +  NG V  + C   +   QLW Y+ E+          CL  + + +  +  T++ C  S   QKW
Sbjct:   54 QEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNL--EVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNCH-GMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVIMLKC-HHMRGNQLWEYDAES----------CLSVNKVADGSQHPTVETCNDST-LQKW 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT3 (polypeptide N-acetylgalactosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:4125])

HSP 1 Score: 371.318 bits (952), Expect = 1.371e-119
Identity = 230/596 (38.59%), Postives = 319/596 (53.52%), Query Frame = 1
Query:  184 NKFKISDSKLNNDLNVKDTSFLLALGINI------------STYNYRANRYHIYNTNQYYQKGPGENGELVSLTD---EENKNLDDVMKKEAFNRPTSDRISLQRSL-PDFRNSEC--KAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQ---VGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPE----LREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCV-----TELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            NK K+ D  L    N+KD    + +G  +              Y   A    + +        PG +G+    T+   EE K  +    K  FN   SDRISL R L PD R  EC  + F     LPTTSVII+FHNEAWS LLRT HSV+  SP   LKE+IL DD+S    L  +L+ YVK     ++V+IVR + R GLI ARL GA  A  E L FLD+HCE   GWLEP+L RI +    ++ P I SID   F +   +  G     G F WS+ F W+ +P+H K+  K +T  +K+ T AGGLF+  ++YF  IGSYDE MEIWGGEN+E+SFR W CGG LE  PCS VGH+FR+  P++FP        N  R+ +VW+D+YK +FY    +    +++   G++S R ++++ LQCK+F W++ N+ PE ++PD N +  GY+K+    LCLD+    E ++G     +Y+C +G    Q F  S         ++I+ N    I++E  CL A +  G V    C      T +   Q+W   K+   L N   K CL A    N +  ++  C  S+P QKW
Sbjct:   58 NKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQ---FSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDV---GENNQGGKPLIMYTC-HGLGGNQYFEYSA-------QHEIRHN----IQKEL-CLHAAQ--GLVQLKACTYKGHKTVVTGEQIWEIQKDQ-LLYNPFLKMCLSA----NGEHPSLVSCNPSDPLQKW 627          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT6 (polypeptide N-acetylgalactosaminyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:4128])

HSP 1 Score: 365.54 bits (937), Expect = 1.913e-117
Identity = 216/532 (40.60%), Postives = 295/532 (55.45%), Query Frame = 1
Query:  334 GPGENGELVS---LTDEENKNLDDVMKKEAFNRPTSDRISLQRSL-PDFRNSEC--KAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQV---GTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPE----LREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENN---GKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
             PG +G+       T  E +  ++  KK  FN   SDRISLQRSL PD R  EC  + F     L TTSVII+FHNEAWS LLRT +SV++ +P   LKE+IL DD+S +  L  +LE YVK      VVR+VR + R GLI ARL GA  A  EVL FLD+HCE   GWLEP+L RI + +  ++ P I +ID   F +      G+V   G F WS+ F W+ +P H K+  K +T  +KS T AGGLF+  + YF  IG+YD  MEIWGGEN+E+SFR W CGG LE  PCS VGH+FR   P+TFP        N  R+ +VW+D YK++FY    +     +E + G+IS R++LR  L C +F W++ NV PE F+PD     YG +KN  +N CLD+    E +RG     +YSC +G    Q F         +   D++ N   Q+     CL  ++     G   F    +++ + + W   ++   + N     CL + + K      + PC  S+P+Q W
Sbjct:  112 APGADGKAFQKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQL---QVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDV---GENNRGGKPLIMYSC-HGLGGNQYF-------EYTTQRDLRHNIAKQL-----CLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQ-LIRNSGSGTCLTSQDKKP----AMAPCNPSDPHQLW 619          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-9 (Probable N-acetylgalactosaminyltransferase 9 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2C4])

HSP 1 Score: 461.07 bits (1185), Expect = 1.418e-155
Identity = 239/524 (45.61%), Postives = 327/524 (62.40%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYS-ESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPG---NKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKN--SKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            ++GPGE G+ V LT ++ +     MKK   N   SD+ISL R +PD R   CK   Y   +LP TSVIIIF +EAW+ LLRT HSV+NRSPP  L+EVIL DD+S +  L   L+ ++K       VR++R  +R GLIRA+L GA+ A G+++VFLDSHCE   GWLEPI+ RI  +R  ++ P+I+SI     +Y+G   +   G F W++HFTW+ + E  +K     TD ++S TMAGGL A++R+YFFE+G YDE M+IWGGENLEISFR WMCGG++E  PCSHVGHIFRA HPY   G   NKD HG NSKR+ +VW+DDYKRL+Y++R +LR  + G+++ R +LR  L CK F WF+ N+   KFI D +++ YG +    S + +C D L ++E  + +   GV+ CQ   SS Q+ SLS            K  N   +RRE  C  A+E NG +   TC  +    + W Y  EN  + NLK  +C+  +NLK  D   +  C+  + +QKW
Sbjct:   72 REGPGEKGKPVVLTGKDAELGQADMKKWFMNVHASDKISLDRDVPDPRIQACKDIKYDYAALPKTSVIIIFTDEAWTPLLRTVHSVINRSPPELLQEVILLDDNSKRQELQEPLDEHIKRF--GGKVRLIRKHVRHGLIRAKLAGAREAVGDIIVFLDSHCEANHGWLEPIVQRISDERTAIVCPMIDSISDNTLAYHGDWSL-STGGFSWALHFTWEGLSEEEQKRRTKPTDYIRSPTMAGGLLAANREYFFEVGGYDEEMDIWGGENLEISFRAWMCGGSIEFIPCSHVGHIFRAGHPYNMTGRNNNKDVHGTNSKRLAEVWMDDYKRLYYMHREDLRTKDVGDLTARHELRKRLNCKPFKWFLDNIAKGKFIMDEDVVAYGALHTVVSGTRMCTDTLQRDE--KMSQLLGVFHCQGKGSSPQLMSLS------------KEGN---LRRENTC--ASEENGNIRMKTCSKKAQFNERWAY--ENKMIRNLKSGKCMSTANLKPGDNAIVVECDEKDEHQKW 571          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 376.326 bits (965), Expect = 5.880e-122
Identity = 223/547 (40.77%), Postives = 306/547 (55.94%), Query Frame = 1
Query:  280 NYRANRYHIYNTNQYYQKG----PGENGELV-----SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTD-VGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNS--KSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWE 1884
            N    ++ +   +  Y+KG     GE G+ V      L+ EE    D  M   AFN+  SD IS+ R+LP   ++ECK   Y+E+LP TSVII FHNEAWS LLRT HSV+ R+P   L+EV+L DD S        LE Y+ +Q+    V+I+R + R GLIRARL GA  A GEVL +LDSHCE   GW+EP+L RI +   T++ P+I+ ID   F Y+ S      VG F W + F W  IPE  +K      D V+S TMAGGLF+ D++YF ++G+YD G +IWGGENLE+SF+ WMCGGTLE  PCSHVGH+FR   PY +    +    NS R+ +VWLDDYK  +Y  R   +  + G+IS R KLR  L CKSF W++ N+ PE F+P  ++   G V+NS  +   CLD +V       N   G Y C +G    Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:   89 NLAKPKFMVDPNDPIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYM-SQF-GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGEVRNSAVQPARCLDCMVGRH--EKNRPVGTYQC-HGQGGNQYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 608          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 376.326 bits (965), Expect = 5.880e-122
Identity = 223/547 (40.77%), Postives = 306/547 (55.94%), Query Frame = 1
Query:  280 NYRANRYHIYNTNQYYQKG----PGENGELV-----SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTD-VGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNS--KSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWE 1884
            N    ++ +   +  Y+KG     GE G+ V      L+ EE    D  M   AFN+  SD IS+ R+LP   ++ECK   Y+E+LP TSVII FHNEAWS LLRT HSV+ R+P   L+EV+L DD S        LE Y+ +Q+    V+I+R + R GLIRARL GA  A GEVL +LDSHCE   GW+EP+L RI +   T++ P+I+ ID   F Y+ S      VG F W + F W  IPE  +K      D V+S TMAGGLF+ D++YF ++G+YD G +IWGGENLE+SF+ WMCGGTLE  PCSHVGH+FR   PY +    +    NS R+ +VWLDDYK  +Y  R   +  + G+IS R KLR  L CKSF W++ N+ PE F+P  ++   G V+NS  +   CLD +V       N   G Y C +G    Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:   89 NLAKPKFMVDPNDPIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYM-SQF-GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGEVRNSAVQPARCLDCMVGRH--EKNRPVGTYQC-HGQGGNQYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 608          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 376.326 bits (965), Expect = 5.880e-122
Identity = 223/547 (40.77%), Postives = 306/547 (55.94%), Query Frame = 1
Query:  280 NYRANRYHIYNTNQYYQKG----PGENGELV-----SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTD-VGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNS--KSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWE 1884
            N    ++ +   +  Y+KG     GE G+ V      L+ EE    D  M   AFN+  SD IS+ R+LP   ++ECK   Y+E+LP TSVII FHNEAWS LLRT HSV+ R+P   L+EV+L DD S        LE Y+ +Q+    V+I+R + R GLIRARL GA  A GEVL +LDSHCE   GW+EP+L RI +   T++ P+I+ ID   F Y+ S      VG F W + F W  IPE  +K      D V+S TMAGGLF+ D++YF ++G+YD G +IWGGENLE+SF+ WMCGGTLE  PCSHVGH+FR   PY +    +    NS R+ +VWLDDYK  +Y  R   +  + G+IS R KLR  L CKSF W++ N+ PE F+P  ++   G V+NS  +   CLD +V       N   G Y C +G    Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:   89 NLAKPKFMVDPNDPIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYM-SQF-GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGEVRNSAVQPARCLDCMVGRH--EKNRPVGTYQC-HGQGGNQYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 608          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 375.941 bits (964), Expect = 6.590e-122
Identity = 220/545 (40.37%), Postives = 307/545 (56.33%), Query Frame = 1
Query:  280 NYRANRYHIYNTNQYYQKG----PGENGELV-----SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTD-VGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWE 1884
            N    ++ +   +  Y+KG     GE G+ V      L+ EE    D  M   AFN+  SD IS+ R+LP   ++ECK   Y+E+LP TSVII FHNEAWS LLRT HSV+ R+P   L+EV+L DD S        LE Y+ +Q+    V+I+R + R GLIRARL GA  A GEVL +LDSHCE   GW+EP+L RI +   T++ P+I+ ID   F Y+ S      VG F W + F W  IPE  +K      D V+S TMAGGLF+ D++YF ++G+YD G +IWGGENLE+SF+ WMCGGTLE  PCSHVGH+FR   PY +    +    NS R+ +VWLDDYK  +Y  R   +  + G+IS R KLR  L CKSF W++ N+ PE F+P  ++   G ++N++++ CLD  V  E +  N     Y C     + Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:   89 NLAKPKFMVDPNDPIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYM-SQF-GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGELRNAQTSQCLDSAVGEEVE--NKAITPYPCHEQGGN-QYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 606          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant1 (gene:FBgn0034025 transcript:FBtr0087331)

HSP 1 Score: 433.335 bits (1113), Expect = 2.067e-144
Identity = 229/533 (42.96%), Postives = 323/533 (60.60%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSEC-KAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSY-YGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVK------SATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELR-EANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNG---KVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q  + G GE G  V L+    +  D++ KK A N   S++++  RS+ D RN  C K    S+SLPT SV+IIF NE +S LLRT HS ++    + LKE+IL DD S  V LG +L+ YV+T+ P   V I+R K RLGLIRARL GA+ A G+VL+FLD+HCE   GW EP+L RI + R +++VPII+ IDA  F Y        QVG F W+ HF W ++PE  K+  + +    +      S TMAGGLFA DR+YF+E+GSYDE M+ WGGENLE+SFR W CGGT+ET PCS VGHIFR  HPY FP ++D HG+N+ RM  VW+D+Y  +F+L RP+L+  A+ G+++ R+ LR  L+CKSF+W++KN+ PEKF+P +++ G+G V    SN+CLD L+QN  +    + G+Y C      +Q+FS +               N   +R E  C T   +     +V  + C+      + W Y  E+  +++     CLD   LK++D   + PC+  +  Q+W
Sbjct:   84 QKQKVGLGEQGVAVHLSGAAKERGDEIYKKIALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGINTARMALVWMDEYINIFFLNRPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNSNICLDDLLQN--NEKPYNAGLYPCGKVLQKSQLFSFT---------------NTNVLRNELSCATVQHSESPPYRVVMVPCMENDEFNEQWRY--EHQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQRW 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant1 (gene:FBgn0034025 transcript:FBtr0087332)

HSP 1 Score: 433.335 bits (1113), Expect = 2.067e-144
Identity = 229/533 (42.96%), Postives = 323/533 (60.60%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSEC-KAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSY-YGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVK------SATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELR-EANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNG---KVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q  + G GE G  V L+    +  D++ KK A N   S++++  RS+ D RN  C K    S+SLPT SV+IIF NE +S LLRT HS ++    + LKE+IL DD S  V LG +L+ YV+T+ P   V I+R K RLGLIRARL GA+ A G+VL+FLD+HCE   GW EP+L RI + R +++VPII+ IDA  F Y        QVG F W+ HF W ++PE  K+  + +    +      S TMAGGLFA DR+YF+E+GSYDE M+ WGGENLE+SFR W CGGT+ET PCS VGHIFR  HPY FP ++D HG+N+ RM  VW+D+Y  +F+L RP+L+  A+ G+++ R+ LR  L+CKSF+W++KN+ PEKF+P +++ G+G V    SN+CLD L+QN  +    + G+Y C      +Q+FS +               N   +R E  C T   +     +V  + C+      + W Y  E+  +++     CLD   LK++D   + PC+  +  Q+W
Sbjct:   84 QKQKVGLGEQGVAVHLSGAAKERGDEIYKKIALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGINTARMALVWMDEYINIFFLNRPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNSNICLDDLLQN--NEKPYNAGLYPCGKVLQKSQLFSFT---------------NTNVLRNELSCATVQHSESPPYRVVMVPCMENDEFNEQWRY--EHQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQRW 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant5 (gene:FBgn0031681 transcript:FBtr0111024)

HSP 1 Score: 409.453 bits (1051), Expect = 1.155e-134
Identity = 224/552 (40.58%), Postives = 330/552 (59.78%), Query Frame = 1
Query:  259 GINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIP-EHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGN-KDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGY---GYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW--ESQF 1893
            GI+++  +    ++ +  + Q  +  PGE G+ V +  +    + +  K+  FN   SD ISL RSL D R+  C+   Y+  LPTTS++I+FHNEAW+ LLRT  SV+NRSP   LKE+IL DD+S +  LG +LE YV  + P     ++R++ R GLIRARL GA+   GEV+ FLD+HCE T GWLEP+L RI Q R T++ PII+ I  + F Y  ++D    G F W ++F W  +P     +    +T  +++ TMAGGLF+ D+ YF+EIGSYDEGM+IWGGENLE+SFR WMCGG LE  PCS VGH+FR + PYTFPG   +    N+ R+V+VWLDD+K  +Y + P  R+A+AG++S R  LR+ L+CKSF W+++NV PE  +P    L Y   G ++N+++  CLD + +    + N   G+  C +G    Q+F+ +  +  +SD+                CL A+ +NG V+ + C   +   Q W+Y+ E   + +    QCL  +   + +   ++PC S    Q+W  ES+F
Sbjct:  103 GISMTYPSVVLKKWFLAPSVQEAKGKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYV-AKLPVKTF-VLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASD-STWGGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRVWMCGGVLEIAPCSRVGHVFRKSTPYTFPGGTTEIVNHNNARLVEVWLDDWKEFYYSFYPGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMP----LDYYYLGEIRNAETETCLDTMGR----KYNEKVGISYC-HGLGGNQVFAYTKRQQIMSDDL---------------CLDASSSNGPVNMVRC-HNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPC-SYGKGQQWLMESKF 625          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant5 (gene:FBgn0031681 transcript:FBtr0079026)

HSP 1 Score: 399.053 bits (1024), Expect = 1.160e-130
Identity = 221/552 (40.04%), Postives = 326/552 (59.06%), Query Frame = 1
Query:  259 GINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIP-EHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGL-NSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGY---GYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW--ESQF 1893
            GI+++  +    ++ +  + Q  +  PGE G+ V +  +    + +  K+  FN   SD ISL RSL D R+  C+   Y+  LPTTS++I+FHNEAW+ LLRT  SV+NRSP   LKE+IL DD+S +  LG +LE YV  + P     ++R++ R GLIRARL GA+   GEV+ FLD+HCE T GWLEP+L RI Q R T++ PII+ I  + F Y  ++D    G F W ++F W  +P     +    +T  +++ TMAGGLF+ D+ YF+EIGSYDEGM+IWGGENLE+SFR W CGG LE  PCSHVGH+FR   PYTFPG      L N+ R+ +VWLD+++  +Y      R+A+AG++S R  LR+ L+CKSF W+++NV PE  +P    L Y   G ++N+++  CLD + +    + N   G+  C +G    Q+F+ +  +  +SD+                CL A+ +NG V+ + C   +   Q W+Y+ E   + +    QCL  +   + +   ++PC S    Q+W  ES+F
Sbjct:  103 GISMTYPSVVLKKWFLAPSVQEAKGKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYV-AKLPVKTF-VLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASD-STWGGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRIWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVAKIVLHNAARVAEVWLDEWRDFYYSMSTGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMP----LDYYYLGEIRNAETETCLDTMGR----KYNEKVGISYC-HGLGGNQVFAYTKRQQIMSDDL---------------CLDASSSNGPVNMVRC-HNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPC-SYGKGQQWLMESKF 625          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0087113)

HSP 1 Score: 363.229 bits (931), Expect = 1.194e-116
Identity = 213/525 (40.57%), Postives = 301/525 (57.33%), Query Frame = 1
Query:  325 YQKGPGENGELVSL----TDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECK-AFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVG-QVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            +++ PGE G+ V L    +DE  K +DD   K AFN+  SD IS+ R+LPD R++ CK    Y  +LP T VII FHNEAW+ LLRT HSV++RSP   + ++IL DD S    L  +LE Y    +P   V+I+R + R GLIRAR+ GA  A   VL +LDSHCE T GWLEP+L RI +   T++ P+I+ I  +   Y+     G  VG F W++ F+W  +PE  +K      + V S TMAGGLF+ DR++F  +G+YD G +IWGGENLE+SF+TWMCGGTLE  PCSHVGHIFR   PY +    +    NS R+ +VW+D+Y + +Y +R    + + G++S R KLRN L+CKSF W++ N+ PE FIP  ++  +G + N  + +CLD   ++E +       +Y C +G    Q + LS            KA    +IRR+  CL     +  V    C       Q W Y +    L +    +CL  S  K  D++ ++ C +S   Q+W
Sbjct:  142 FEENPGELGKPVRLPKEMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYF-AAYPK--VQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVNVLKKNSVRLAEVWMDEYSQ-YYYHRIGNDKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSV-AHGEIANVPNGMCLDAKEKSEEE---TPVSIYEC-HGQGGNQYWMLS------------KAG---EIRRDDSCLDYAGKD--VTLFGCHGGK-GNQFWTYRENTKQLHHGTSGKCLAISESK--DKLLMEECSASLSRQQW 637          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 415.616 bits (1067), Expect = 6.477e-138
Identity = 220/524 (41.98%), Postives = 317/524 (60.50%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYV-KTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q    GPGE G+ V +  ++ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAW+ LLRT HSV++RSP   L+E++L DD+S +  L  +LE YV K + P   VR+VR + R GLIRARL+GA  + G+V+ FLD+HCE TTGWLEP+L RI   ++T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R  LR  LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    SL+++   QCLD ++  +    +++ C  +   Q+W
Sbjct:   50 QRPHDGPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVP---VRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 415.616 bits (1067), Expect = 6.477e-138
Identity = 220/524 (41.98%), Postives = 317/524 (60.50%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYV-KTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q    GPGE G+ V +  ++ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAW+ LLRT HSV++RSP   L+E++L DD+S +  L  +LE YV K + P   VR+VR + R GLIRARL+GA  + G+V+ FLD+HCE TTGWLEP+L RI   ++T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R  LR  LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    SL+++   QCLD ++  +    +++ C  +   Q+W
Sbjct:   50 QRPHDGPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVP---VRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 407.912 bits (1047), Expect = 5.171e-135
Identity = 230/578 (39.79%), Postives = 331/578 (57.27%), Query Frame = 1
Query:  154 ILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            +L  +FL+ +       S+ N   N KD S L AL   +S       R H         + PGE G+ V +  EE   + ++ K   FN   SD I+L RSLPD R   CK   Y + LP TS++I+FHNEAWS LLRT HS +NRSP + L E++L DD+S +  L  +LE YV T   +  VRI+R + R GLIRARL GA A  G+V+ FLD+HCE TTGWLEP++ RI + R  ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR SL+CK F W+++NV P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL A+  NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C S    Q+W
Sbjct:   18 VLVDVFLLLYF------SECNKCDNRKDHSLLPALRAVMS-------RAH---------EAPGEMGKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATL--EVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDASRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLKDC-SGRRSQQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 394.045 bits (1011), Expect = 2.767e-130
Identity = 217/525 (41.33%), Postives = 304/525 (57.90%), Query Frame = 1
Query:  154 ILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITC 1722
            +L  +FL+ +       S+ N   N KD S L AL   +S       R H         + PGE G+ V +  EE   + ++ K   FN   SD I+L RSLPD R   CK   Y + LP TS++I+FHNEAWS LLRT HS +NRSP + L E++L DD+S +  L  +LE YV T   +  VRI+R + R GLIRARL GA A  G+V+ FLD+HCE TTGWLEP++ RI + R  ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR SL+CK F W+++NV P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL A+  NG V  + C
Sbjct:   18 VLVDVFLLLYF------SECNKCDNRKDHSLLPALRAVMS-------RAH---------EAPGEMGKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATL--EVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDASRLNGPVVMLKC 496          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNT3 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) [Source:NCBI gene;Acc:100331984])

HSP 1 Score: 375.17 bits (962), Expect = 2.719e-121
Identity = 222/535 (41.50%), Postives = 298/535 (55.70%), Query Frame = 1
Query:  334 GPGENGELV---SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSL-PDFRNSEC--KAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQ---VGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPE----LREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLS---PVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVT---ELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
             PG +G+     +L+  E K  +   +K  FN   SDRISL R L PD R  EC  + F     LPTTSVII+FHNEAWS LLRT +SV++ SP  FLKE+IL DD+S    L  +L+ ++K     ++VR+VR   R GLI ARL GA  A G+ L FLD+HCE   GWLEP+L RI +    ++ P I +ID   F +   +  GQ    G F W + F W+ +P+H ++  K +T  +K+ T AGGLF+  R YF+ IGSYDE MEIWGGEN+E+SFR W CGG LE  PCS VGH+FR   P+TFP        N  R+ +VW+DDYK +FY    +     +E + G++S R+ LR  LQCKSF W++KNV PE F+PD N L +G ++N     CLD+   NE   G     +Y C +G    Q F  S    ++++I     +   +   +R E  C     N      IT      EL E QL+ YNK +        KQCL A      +  ++ PC   + YQ W
Sbjct:  114 APGASGKAFHTDNLSSSEQKEKERGEEKHCFNLYASDRISLSRDLGPDTRPPECIEQTFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPALFLKEIILVDDASVDEHLKDKLDEFLKQL---HIVRVVRQHERKGLITARLLGASVATGDTLTFLDAHCECFHGWLEPLLARIAENSSAVVSPDITTIDLNTFEFMKPSPYGQHHNRGNFDWGLSFGWETLPDHERRRRKDETYPIKTPTFAGGLFSISRDYFYHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTQVIARNQVRLAEVWMDDYKEIFYRRNQQAAQIAKEHSFGDVSRRVDLRERLQCKSFSWYLKNVYPEVFMPDLNPLQFGAIRNMGKEACLDVGESNE---GGKPLIMYPC-HGMGGNQYFEYSTHHEIRHNIQKELCLDGTDGAMVRLE-ECQYKGHNT-----ITSPQQKWELREDQLF-YNKAS--------KQCLSA----RPENPSLVPCNPDDKYQLW 622          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 426.402 bits (1095), Expect = 5.374e-142
Identity = 226/526 (42.97%), Postives = 318/526 (60.46%), Query Frame = 1
Query:  310 NTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            + NQ   +GPGE G+ V +  EE + + ++ K   FN   S+ I+L RSLPD R   CK  +Y +SLPTTSV+I+FHNEAW+ LLRT HSV+NRSP   L+E+IL DD+S +  L   LE YVK       V ++R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   48 DINQKPHEGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKL--TVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 426.017 bits (1094), Expect = 8.540e-142
Identity = 226/526 (42.97%), Postives = 318/526 (60.46%), Query Frame = 1
Query:  310 NTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            + NQ   +GPGE G+ V +  EE + + ++ K   FN   S+ I+L RSLPD R   CK  +Y +SLPTTSV+I+FHNEAW+ LLRT HSV+NRSP   L+E+IL DD+S +  L   LE YVK       V ++R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 DINQKPHEGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKL--TVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 423.705 bits (1088), Expect = 6.311e-141
Identity = 224/520 (43.08%), Postives = 315/520 (60.58%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
             +GPGE G+ V +  EE + + ++ K   FN   S+ I+L RSLPD R   CK  +Y +SLPTTSV+I+FHNEAW+ LLRT HSV+NRSP   L+E+IL DD+S +  L   LE YVK       V ++R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   50 HEGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKL--TVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 543          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 423.32 bits (1087), Expect = 1.198e-140
Identity = 224/520 (43.08%), Postives = 315/520 (60.58%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
             +GPGE G+ V +  EE + + ++ K   FN   S+ I+L RSLPD R   CK  +Y +SLPTTSV+I+FHNEAW+ LLRT HSV+NRSP   L+E+IL DD+S +  L   LE YVK       V ++R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   57 HEGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKL--TVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 422.935 bits (1086), Expect = 1.503e-140
Identity = 224/520 (43.08%), Postives = 315/520 (60.58%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
             +GPGE G+ V +  EE + + ++ K   FN   S+ I+L RSLPD R   CK  +Y +SLPTTSV+I+FHNEAW+ LLRT HSV+NRSP   L+E+IL DD+S +  L   LE YVK       V ++R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   57 HEGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKL--TVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 420.239 bits (1079), Expect = 1.377e-139
Identity = 221/524 (42.18%), Postives = 317/524 (60.50%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKT-QWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q   +GPGE G+ V +  E+ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y ++LPTTSV+I+FHNEAWS LLRT HSV+NRSP   ++E++L DD+S +  L   LE+YVK  + P   V ++R + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   52 QKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 420.239 bits (1079), Expect = 1.377e-139
Identity = 221/524 (42.18%), Postives = 317/524 (60.50%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKT-QWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q   +GPGE G+ V +  E+ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y ++LPTTSV+I+FHNEAWS LLRT HSV+NRSP   ++E++L DD+S +  L   LE+YVK  + P   V ++R + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   52 QKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 420.239 bits (1079), Expect = 1.377e-139
Identity = 221/524 (42.18%), Postives = 317/524 (60.50%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKT-QWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q   +GPGE G+ V +  E+ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y ++LPTTSV+I+FHNEAWS LLRT HSV+NRSP   ++E++L DD+S +  L   LE+YVK  + P   V ++R + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   52 QKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 412.92 bits (1060), Expect = 8.530e-137
Identity = 220/520 (42.31%), Postives = 315/520 (60.58%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q+GPGE G+ V +  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAWS LLRT +SV+NRSP   L EVIL DD+S +  L   LE YVKT   +  V+I+R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI + R+T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PYTFPG   +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +  +G V  + C   +   QLW Y+ E  +L +    QCLD  + ++    T+Q C  S   Q+W
Sbjct:   54 QEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTL--EVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLSGPVIMLKC-HHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 412.92 bits (1060), Expect = 8.530e-137
Identity = 220/520 (42.31%), Postives = 315/520 (60.58%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q+GPGE G+ V +  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAWS LLRT +SV+NRSP   L EVIL DD+S +  L   LE YVKT   +  V+I+R + R GLIRARL GA A+ G+V+ FLD+HCE T GWLEP+L RI + R+T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PYTFPG   +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +  +G V  + C   +   QLW Y+ E  +L +    QCLD  + ++    T+Q C  S   Q+W
Sbjct:   54 QEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTL--EVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLSGPVIMLKC-HHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q9U2C4|GALT9_CAEEL (Probable N-acetylgalactosaminyltransferase 9 OS=Caenorhabditis elegans OX=6239 GN=gly-9 PE=2 SV=1)

HSP 1 Score: 461.07 bits (1185), Expect = 1.804e-154
Identity = 239/524 (45.61%), Postives = 327/524 (62.40%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYS-ESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPG---NKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKN--SKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            ++GPGE G+ V LT ++ +     MKK   N   SD+ISL R +PD R   CK   Y   +LP TSVIIIF +EAW+ LLRT HSV+NRSPP  L+EVIL DD+S +  L   L+ ++K       VR++R  +R GLIRA+L GA+ A G+++VFLDSHCE   GWLEPI+ RI  +R  ++ P+I+SI     +Y+G   +   G F W++HFTW+ + E  +K     TD ++S TMAGGL A++R+YFFE+G YDE M+IWGGENLEISFR WMCGG++E  PCSHVGHIFRA HPY   G   NKD HG NSKR+ +VW+DDYKRL+Y++R +LR  + G+++ R +LR  L CK F WF+ N+   KFI D +++ YG +    S + +C D L ++E  + +   GV+ CQ   SS Q+ SLS            K  N   +RRE  C  A+E NG +   TC  +    + W Y  EN  + NLK  +C+  +NLK  D   +  C+  + +QKW
Sbjct:   72 REGPGEKGKPVVLTGKDAELGQADMKKWFMNVHASDKISLDRDVPDPRIQACKDIKYDYAALPKTSVIIIFTDEAWTPLLRTVHSVINRSPPELLQEVILLDDNSKRQELQEPLDEHIKRF--GGKVRLIRKHVRHGLIRAKLAGAREAVGDIIVFLDSHCEANHGWLEPIVQRISDERTAIVCPMIDSISDNTLAYHGDWSL-STGGFSWALHFTWEGLSEEEQKRRTKPTDYIRSPTMAGGLLAANREYFFEVGGYDEEMDIWGGENLEISFRAWMCGGSIEFIPCSHVGHIFRAGHPYNMTGRNNNKDVHGTNSKRLAEVWMDDYKRLYYMHREDLRTKDVGDLTARHELRKRLNCKPFKWFLDNIAKGKFIMDEDVVAYGALHTVVSGTRMCTDTLQRDE--KMSQLLGVFHCQGKGSSPQLMSLS------------KEGN---LRRENTC--ASEENGNIRMKTCSKKAQFNERWAY--ENKMIRNLKSGKCMSTANLKPGDNAIVVECDEKDEHQKW 571          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q6WV20|GALT1_DROME (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Pgant1 PE=1 SV=2)

HSP 1 Score: 433.335 bits (1113), Expect = 2.072e-143
Identity = 229/533 (42.96%), Postives = 323/533 (60.60%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSEC-KAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSY-YGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVK------SATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELR-EANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNG---KVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q  + G GE G  V L+    +  D++ KK A N   S++++  RS+ D RN  C K    S+SLPT SV+IIF NE +S LLRT HS ++    + LKE+IL DD S  V LG +L+ YV+T+ P   V I+R K RLGLIRARL GA+ A G+VL+FLD+HCE   GW EP+L RI + R +++VPII+ IDA  F Y        QVG F W+ HF W ++PE  K+  + +    +      S TMAGGLFA DR+YF+E+GSYDE M+ WGGENLE+SFR W CGGT+ET PCS VGHIFR  HPY FP ++D HG+N+ RM  VW+D+Y  +F+L RP+L+  A+ G+++ R+ LR  L+CKSF+W++KN+ PEKF+P +++ G+G V    SN+CLD L+QN  +    + G+Y C      +Q+FS +               N   +R E  C T   +     +V  + C+      + W Y  E+  +++     CLD   LK++D   + PC+  +  Q+W
Sbjct:   84 QKQKVGLGEQGVAVHLSGAAKERGDEIYKKIALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGINTARMALVWMDEYINIFFLNRPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNSNICLDDLLQN--NEKPYNAGLYPCGKVLQKSQLFSFT---------------NTNVLRNELSCATVQHSESPPYRVVMVPCMENDEFNEQWRY--EHQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQRW 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q10472|GALT1_HUMAN (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GALNT1 PE=1 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 4.729e-139
Identity = 221/524 (42.18%), Postives = 318/524 (60.69%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKT-QWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q   +GPGE G+ V +  E+ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y ++LPTTSV+I+FHNEAWS LLRT HSV+NRSP   ++E++L DD+S +  L   LE+YVK  + P   V ++R + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   52 QKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q07537|GALT1_BOVIN (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Bos taurus OX=9913 GN=GALNT1 PE=1 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 6.192e-139
Identity = 221/524 (42.18%), Postives = 319/524 (60.88%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKT-QWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q   +GPGE G+ V +  E+ + + ++ K   FN   S+ I+L RSLPD R   CK  +Y ++LPTTSV+I+FHNEAWS LLRT HSV+NRSP   L+E++L DD+S +  L   LE+YVK  + P   V ++R + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI   R+T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQC+ F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   52 QKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATDEDSQVPSIRDCSGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q10473|GALT1_RAT (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Galnt1 PE=1 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 7.683e-139
Identity = 221/524 (42.18%), Postives = 317/524 (60.50%), Query Frame = 1
Query:  319 QYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKT-QWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Q   +GPGE G+ V +  E+ + + ++ K   FN   S+ I+  RSLPD R   CK  +Y +SLPTTSV+I+FHNEAWS LLRT HSV+NRSP   ++E++L DD+S +  L   LE+YVK  + P   V ++R + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI   R T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R+ LR+ LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   52 QKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIAFNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A267ENR0 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000326g1 PE=3 SV=1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 295/559 (52.77%), Postives = 377/559 (67.44%), Query Frame = 1
Query:  241 SFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNL--DDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL--REANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPD--RNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWE 1884
            S    L +    Y  R  R+  Y  ++ +++GPGE G  V LT +E   L  D +  KEAFNR +SDRISL RSL D R  EC++  Y   LPT SV+IIFH EAWS+L+RT HSVVNR+PPR+LKEV+L DD S K  L   L+ Y+   +PD VVR+VRS+ RLGLIRARLEGAKAA G+V+ FLDSHCE T GW EP+L RI + R  ++ PIIES+ A   SY G      VG+FWWS HFTW  IPEH  +  +  TD ++SATMAGGLFA DR+YFFE+G+YDEGM IWGGENLEISFR WMCGGTLE  PCS VGHIFRA+HPY+FPG+KDYHGLN+ R+VDVW+D+YKRLFY++R +L  R A+ G++S R+ LR  L CK F W+++NV+PEKFIPD  R++  YG ++N  +N+C+DLL  NEFDR     G+YSCQ GAS  QIFS S  +               +IRREWGCL A   + +V FITC T + +      Q W  + +  ++ +    +CL A  +KN +   +  C ++NP+Q WE
Sbjct:   58 SICRQLDVTPDVYQARLRRFTEYQKSEPFRQGPGEQGHGVYLTADEKNRLGYDAMFTKEAFNRISSDRISLDRSLNDMRAMECRSISYPADLPTLSVVIIFHEEAWSSLMRTVHSVVNRTPPRYLKEVVLLDDFSTKEHLLRNLDNYLARTFPDGVVRVVRSRERLGLIRARLEGAKAATGDVVAFLDSHCEATKGWAEPLLARIKESRSAVLCPIIESVSADSLSYNGGGSSYSVGSFWWSGHFTWDMIPEHELRRRQKHTDPIRSATMAGGLFAVDRKYFFEVGAYDEGMGIWGGENLEISFRVWMCGGTLEFIPCSRVGHIFRASHPYSFPGHKDYHGLNTMRLVDVWMDEYKRLFYMHRHDLVSRTADRGDVSSRVALRKRLNCKPFSWYLENVIPEKFIPDSTRDVTAYGMLRNPITNMCVDLLNYNEFDRNPTAAGLYSCQGGASGRQIFSYSRKQ---------------EIRREWGCLQAGPGSDRVSFITCTTRVTDPEAGAGQRWQLDPQAKTIRHSASGRCLSAEGVKNGEAAKLSDCSATNPHQVWE 601          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A267ENX5 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000649g1 PE=3 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 295/559 (52.77%), Postives = 377/559 (67.44%), Query Frame = 1
Query:  241 SFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNL--DDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL--REANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPD--RNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWE 1884
            S    L +    Y  R  R+  Y  ++ +++GPGE G  V LT +E   L  D +  KEAFNR +SDRISL RSL D R  EC++  Y   LPT SV+IIFH EAWS+L+RT HSVVNR+PPR+LKEV+L DD S K  L   L+ Y+   +PD VVR+VRS+ RLGLIRARLEGAKAA G+V+ FLDSHCE T GW EP+L RI + R  ++ PIIES+ A   SY G      VG+FWWS HFTW  IPEH  +  +  TD ++SATMAGGLFA DR+YFFE+G+YDEGM IWGGENLEISFR WMCGGTLE  PCS VGHIFRA+HPY+FPG+KDYHGLN+ R+VDVW+D+YKRLFY++R +L  R A+ G++S R+ LR  L CK F W+++NV+PEKFIPD  R++  YG ++N  +N+C+DLL  NEFDR     G+YSCQ GAS  QIFS S  +               +IRREWGCL A   + +V FITC T + +      Q W  + +  ++ +    +CL A  +KN +   +  C ++NP+Q WE
Sbjct:   55 SICRQLDVTPDVYQVRLRRFTEYQKSEPFRQGPGEQGHGVYLTADEKNRLGYDAMFAKEAFNRISSDRISLDRSLNDMRAMECRSISYPADLPTLSVVIIFHEEAWSSLMRTVHSVVNRTPPRYLKEVVLLDDFSTKEHLLRNLDNYLARTFPDGVVRVVRSRERLGLIRARLEGAKAATGDVVAFLDSHCEATKGWAEPLLARIKESRSAVLCPIIESVSADSLSYNGGGSSYSVGSFWWSGHFTWDMIPEHELRRRQKHTDPIRSATMAGGLFAVDRKYFFEVGAYDEGMGIWGGENLEISFRVWMCGGTLEFIPCSRVGHIFRASHPYSFPGHKDYHGLNTMRLVDVWMDEYKRLFYMHRHDLVSRTADRGDVSSRVALRKRLNCKPFSWYLENVIPEKFIPDSTRDVTAYGMLRNPITNMCVDLLNYNEFDRNPTAAGLYSCQGGASGRQIFSYSRKQ---------------EIRREWGCLQAGPGSDRVSFITCTTRVTDPEAGAGQRWQLDPQAKTIRHNASGRCLSAEGVKNGEAAKLSDCSATNPHQVWE 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1I8GE26 (Ricin B-type lectin domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 293/556 (52.70%), Postives = 375/556 (67.45%), Query Frame = 1
Query:  241 SFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNL--DDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL--REANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPD--RNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQ 1875
            S    L +    Y  R  R+  Y  ++ +++GPGE G  V LT +E   L  D +  KEAFNR +SDRISL RSL D R  EC++  Y   LPT SV+IIFH EAWS+L+RT HSVVNR+PPR+LKEV+L DD S K  L   L+ Y+   +PD VVR+VRS+ RLGLIRARLEGAKAA G+V+ FLDSHCE T GW EP+L RI + R  ++ PIIES+ A   SY G      VG+FWWS HFTW  IPEH  +  +  TD ++SATMAGGLFA DR+YFFE+G+YDEGM IWGGENLEISFR WMCGGTLE  PCS VGHIFRA+HPY+FPG+KDYHGLN+ R+VDVW+D+YKRLFY++R +L  R A+ G++S R+ LR  L CK F W+++NV+PEKFIPD  R++  YG ++N  +N+C+DLL  NEFDR     G+YSCQ GAS  QIFS S  +               +IRREWGCL A   + +V FITC T + +      Q W  + +  ++ +    +CL A  +KN +   +  C ++NP+Q
Sbjct:  729 SICRQLDVTPDVYQVRLRRFTEYQKSEPFRQGPGEQGHGVYLTADEKNRLGYDAMFAKEAFNRISSDRISLDRSLNDMRAMECRSISYPADLPTLSVVIIFHEEAWSSLMRTVHSVVNRTPPRYLKEVVLLDDFSTKEHLLRNLDNYLARTFPDGVVRVVRSRERLGLIRARLEGAKAATGDVVAFLDSHCEATKGWAEPLLARIKESRSAVLCPIIESVSADSLSYNGGGSSYSVGSFWWSGHFTWDMIPEHELRRRQKHTDPIRSATMAGGLFAVDRKYFFEVGAYDEGMGIWGGENLEISFRVWMCGGTLEFIPCSRVGHIFRASHPYSFPGHKDYHGLNTMRLVDVWMDEYKRLFYMHRHDLVSRTADRGDVSSRVALRKRLNCKPFSWYLENVIPEKFIPDSTRDVTAYGMLRNPITNMCVDLLNYNEFDRNPTAAGLYSCQGGASGRQIFSYSRKQ---------------EIRREWGCLQAGPGSDRVSFITCTTRVTDPEAGAGQRWQLDPQAKTIRHNASGRCLSAEGVKNGEAAKLSDCSATNPHQ 1269          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A210Q169 (Polypeptide N-acetylgalactosaminyltransferase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19066 PE=3 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 275/533 (51.59%), Postives = 355/533 (66.60%), Query Frame = 1
Query:  286 RANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTAT-ENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            R  R+  Y  ++  +KGPGENGE V L  EE      + KKEAFN   SD+ISLQRS+ D R+S+CK   Y + LP+ SV+IIFHNEAWS LLRTAHSVVNRSPP +L EVIL DD S +  LG +L  YV   WPD VVRIVR+  R GLIRARL GA AA G+VL+FLDSHCE + GWLEP+L RI++    M+ P I+ ID K    YG T    VG FWWS+HF+W+ IP+H K+  K   D ++S TMAGGLFA DR++FF+IG+YD GME+WGGENLEISFR WMCGG LE  PCS VGHIFRA+HPYTFPGNKD HGLNS R+ +VW+D+YKRLFY +R +L   + G+IS R  LR  L+CK+F W++ NV PEKFIPD N+  +G V+N  SNLCLD L ++E  +     G++SCQNGAS++++FSLS                  ++RRE GC+    ++ G    + C       Q W ++K  G++++ +   CLD   +++     +  C ++   QKW
Sbjct:   49 RRKRFEDYQVSESSRKGPGENGEPVILEREEKALAASLFKKEAFNIIASDKISLQRSVKDVRDSKCKDIQYPKKLPSASVVIIFHNEAWSPLLRTAHSVVNRSPPEYLHEVILLDDFSDRPELGEKLNKYVDETWPDGVVRIVRTMERSGLIRARLAGAVAAKGDVLIFLDSHCEASAGWLEPLLGRINEDPTAMLCPEIDLID-KDTLQYGGTGSYSVGGFWWSLHFSWRPIPKHEKERRKSDVDPIRSPTMAGGLFAVDREFFFKIGAYDNGMEVWGGENLEISFRVWMCGGKLEFIPCSRVGHIFRASHPYTFPGNKDTHGLNSMRLAEVWMDEYKRLFYSHRRDLLGQDYGDISERKALREKLKCKNFKWYLDNVYPEKFIPDENVHAWGMVRNPSSNLCLDTLGKDE--KMTFDVGLFSCQNGASASEVFSLSMEN---------------ELRREEGCMAYNGKSGGHPHLVNCNG--AANQKWKHDKNTGTIIHTESGLCLDREKVESGGYSMVITCVANKDSQKW 561          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1S3INW8 (Polypeptide N-acetylgalactosaminyltransferase OS=Lingula unguis OX=7574 GN=LOC106166068 PE=3 SV=1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 275/526 (52.28%), Postives = 363/526 (69.01%), Query Frame = 1
Query:  307 YNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNG-KVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Y     +++GPGE G  V L  EE KN D++ KKEAFN   SD I+L RSLPD RN  CK+  Y + LPT SV+IIFHNEAW+ LLRTAHSVVNRSPP++L EVIL DD+SY+  LG EL+ YV+  WPD VV++VR K R GLIRAR+ GAKAA G+VL+FLDSHCE   GWLEP+L RI +K + ++VP I+ I ++   Y   T  G VG FWWS+HF+W+ +P+      K + D V+S TM GGLFA+DR+YFF++G+YD GM++WGGENLEISFR WMCGG+LE  PCS VGHIFR++HPYTFPGNKD HG+NS R+ +VW+D+YKRLFY++R +L + + G+IS R  LR  L+CKSF W+++NV PEKFI D  +L YG V+N  SNLCLD + ++E  R ++  G++ CQNGAS+ ++FSLS                  ++RRE  CL +    G KV    C       Q W ++K++G ++++   +CLD S LK+ D V ++ C   N  QKW
Sbjct:   60 YENRNRHKQGPGEYGAGVFLQGEEKKNADELAKKEAFNIIASDGIALDRSLPDVRNPACKSVEYPKDLPTASVVIIFHNEAWTPLLRTAHSVVNRSPPQYLHEVILLDDASYRDRLGEELDKYVQDTWPDGVVKVVRVKERAGLIRARIAGAKAATGDVLIFLDSHCEANEGWLEPLLARIKEKTDAVLVPDIDMISSETLQYI-PTGSGSVGGFWWSLHFSWRPMPKREAVRRKSEIDPVRSPTMPGGLFAADRKYFFDVGAYDPGMDVWGGENLEISFRVWMCGGSLEFIPCSRVGHIFRSSHPYTFPGNKDTHGINSMRLAEVWMDEYKRLFYMHRRDLLKQDMGDISERKALRERLKCKSFSWYLENVYPEKFIIDEKVLAYGMVRNPGSNLCLDTMGKDEKTRFDI--GLFHCQNGASANEVFSLS---------------QKNELRREEACLDSVGAEGSKVSLNPCHGHK-GNQEWRHHKDSGVIVHVPSGKCLDVSGLKSGDSVQLKKCNGGND-QKW 565          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 418.698 bits (1075), Expect = 3.869e-139
Identity = 223/519 (42.97%), Postives = 317/519 (61.08%), Query Frame = 1
Query:  334 GPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYV-KTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            GPGE G+ V +  E+++ + ++ K   FN   S+ I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAW+ LLRT HSV+NRSP   L+EV+L DD+S +  L  +LE YV K + P   VRIVR + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI Q ++T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+I+ R  LR  LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    SL+++   QCLD ++  +    +++ C  S   Q+W
Sbjct:   55 GPGEMGKPVVIPKEQHEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVP---VRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDCTGSRS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 411.379 bits (1056), Expect = 3.530e-136
Identity = 216/521 (41.46%), Postives = 314/521 (60.27%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMD-RVTIQPCESSNPYQKW 1881
             +GPGE G+ V +  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y + LP TS++I+FHNEAWS LLRT HSV+NRSP   L E++L DD+S +  L  +LE YVKT   +  VRI+R + R GLIRARL GA A  G+V+ FLD+HCE T GWLEP+L RI + R+ ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR +LQCK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  +  NG V  + C   +   Q++ Y+ E G+ M++  + CL  S L++     T++ C+ S P Q W
Sbjct:   54 HEGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTL--EVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIP-RRYFSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAEKGTFMHIITQSCLTISRLEDGTYGPTVEYCDDS-PLQTW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 409.453 bits (1051), Expect = 1.229e-135
Identity = 214/520 (41.15%), Postives = 313/520 (60.19%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
             +GPGE G+ V +  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y + LP TS++I+FHNEAWS LLRT HSV+NRSP   L E++L DD+S +  L  +LE YVKT   +  VRI+R + R GLIRARL GA A  G+V+ FLD+HCE T GWLEP+L RI + R+ ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR +LQCK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  +  NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   54 HEGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTL--EVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIP-RRYFSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 384.8 bits (987), Expect = 1.639e-126
Identity = 211/519 (40.66%), Postives = 297/519 (57.23%), Query Frame = 1
Query:  334 GPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYV-KTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            GPGE G+ V +  E+++ + ++ K   FN   S+ I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAW+ LLRT HSV+NRSP   L+EV+L DD+S +  L  +LE YV K + P   VRIVR + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI Q ++T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+I+ R  LR  LQCK F W+++NV P+  IP                                                +SL  V +S + N +I+ ++         CL  ++ NG V  + C   L   QLW Y+    SL+++   QCLD ++  +    +++ C  S   Q+W
Sbjct:   55 GPGEMGKPVVIPKEQHEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVP---VRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIP---------------------------------------------RHYYSLGEV-FSYTANKEIRTDD--------LCLDVSKLNGPVMMLKC-HHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDCTGSRS-QQW 513          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 381.333 bits (978), Expect = 4.363e-125
Identity = 204/520 (39.23%), Postives = 296/520 (56.92%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
             +GPGE G+ V +  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y + LP TS++I+FHNEAWS LLRT HSV+NRSP   L E++L DD+S +  L  +LE YVKT   +  VRI+R + R GLIRARL GA A  G+V+ FLD+HCE T GWLEP+L RI + R+ ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR +LQCK F W+++N+ P+  IP R                                              FSL  V +S + + +I+ ++         CL  +  NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   54 HEGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTL--EVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRR---------------------------------------------YFSLGEV-FSYTADKEIRTDD--------LCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 514          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 368.622 bits (945), Expect = 8.218e-122
Identity = 199/472 (42.16%), Postives = 281/472 (59.53%), Query Frame = 1
Query:  481 CKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYV-KTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLM--NLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            CK  +Y + LP TSV+I+FHNEAWS LLRT HS++ RSP   L+E+IL DD+S +  L + LE Y  K   P   V IVR + R GLIRARL GA  + G+V+ FLD+HCE TTGWLEP+L RI   R+ ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V+S TMAGGLFA DR YF EIG+YD GM+IWGGENLE+SFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + +   G++S R  LR+ L+CK F WF++NV P   IP R+    G V+N ++N CLD + + E    N   G+++C +   + Q+FS +  K               ++R +  CL  +  NG V  + C   +   QLW Y+++   L+  +    QCLD +  ++    T++ C+     Q+W
Sbjct:    1 CKTKVYPDGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEYASKLPVP---VHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEYLAGSDM-TYGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDNFKDFFYIISPGVTKVEYGDVSQRKALRDRLKCKPFSWFLENVYPNSQIP-RHYYSLGEVRNVETNQCLDNMGRKE----NEKIGIFNCHSMGGN-QVFSYTADK---------------ELRTDDLCLDVSRMNGPVLMLKC-HHMKGNQLWDYDQQMQKLIMRHTNSNQCLDKATEQDRQVPTMRECDGGRS-QQW 445          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt12 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 [Source:ZFIN;Acc:ZDB-GENE-060503-704])

HSP 1 Score: 358.607 bits (919), Expect = 5.719e-117
Identity = 213/535 (39.81%), Postives = 297/535 (55.51%), Query Frame = 1
Query:  325 YQKGP------GENGELV--SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYS-ESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSK-SNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCV------TELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            Y+K P      GE G+ V  +L  EE +  ++ + K   N   SDRISL R LP+  N  C+   Y+   LPTTSV+I F+NEAWS LLRT HSV+  SP   L E+IL DD S +  L   LE Y+ T      VR+VR++ R GL+RARL GA  A G+VL FLD HCE   GWLEP+L RI ++   ++ P+I+ I+   F Y G+    Q+G F W + FTW  +P H +K  K   D ++S TMAGGLFA  ++YF  +G+YD GME+WGGENLE SFR W CGGTLE HPCSHVGH+F    PY+    +     NS R  +VW+D YK L+Y   P  R    G+++ R  LR  LQCK+F WF++NV P+  +P+     +G +KN   SN C D    +E         +Y C +G    Q F         +   +I+ N     R+   C  A  +NG +D++T        + + E Q + + +E+GS+ ++  ++CL+A    N   + +      N  Q+W
Sbjct:   17 YEKPPLDSNALGEMGKAVRLNLEGEEKRKEEESINKHQINIYVSDRISLHRQLPEKWNPLCREKKYNYRQLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDALLNEIILVDDYSDREHLRDRLEQYIATL---RKVRLVRARKREGLVRARLLGAGVATGDVLTFLDCHCECHVGWLEPLLERIAEEESAVVCPVIDVIEWNTFEYMGNAGEPQIGGFDWRLVFTWHTVPGHEQKRRKSPIDVIRSPTMAGGLFAVSKKYFDYLGTYDTGMEVWGGENLEFSFRIWQCGGTLEVHPCSHVGHVFPKQAPYS----RSKALANSVRAAEVWMDGYKELYYHRNPHARMEPFGDVTERRNLRERLQCKTFKWFLENVYPDIHVPEDRPGKFGMLKNRGLSNYCFDYNPPDENQVTGQRIILYGC-HGMGQNQFFEY-------TSEQEIRYNT----RQPEAC--AAVDNG-MDYLTMYYCHSKNSPVTENQKFDF-REDGSIFHILTQKCLEAVEQPNSGPLPLLRTCDGNTRQRW 528          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 357.836 bits (917), Expect = 4.995e-116
Identity = 199/511 (38.94%), Postives = 284/511 (55.58%), Query Frame = 1
Query:  376 ENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYS-ESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSK-SNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTEL---IETQLWIYNKENGSLMNLKFKQCLDA-SNLKNMDRVTIQPCESSNPYQKWESQ 1890
            E K  ++ +++ A N   SDRISL R +PD R  ECKA  +    LPTTSV+I F+NEAWS LLRT HSV+  SP   L+E+IL DD S +  L + LE Y+ T      VR+VR+  R GL+RARL GA  A G+VL FLD HCE   GW+EP+L RI +K   ++ P+I++ID   F +Y  T    +G F W + F W  +PEH +     + + ++S TMAGGLFA  ++YF  IG+YD+GME+WGGENLE+SFR W CGG+LE HPCSHVGH+F    PY  P        N+ R  +VW+D YK  FY   P  R+   G++S R  LR  L CKSF+W++KN+ P+  +P+     +G ++N    + C+D    +    G +   +Y C +G    Q F  +  K       D++ N+  ++     C    +   +V    C  +      + +W + +E+G++ N     CL A         + I+PC   +  Q W  Q
Sbjct:   94 ERKLEEESIERYALNIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYISTL---ERVRLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFYMQTSEPAIGGFDWRLTFQWHGVPEHERSRRASRIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPYPRPRFLQ----NTVRAAEVWMDSYKEHFYNRNPPGRKEKYGDLSERKTLREKLGCKSFEWYLKNIYPDLHVPEDRPGFHGAIQNKGIQSECIDYNAPDNNPTGAM-LSLYPC-HGQGGNQFFEYTTRK-------DLRFNSATEL-----CAEVRDGKPQVAMRHCPPDSQSNPPSVMWDF-REDGTVYNAHRNACLTAFRKPDGRADIEIRPCMPDDKNQMWTFQ 582          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 352.443 bits (903), Expect = 7.320e-115
Identity = 202/511 (39.53%), Postives = 272/511 (53.23%), Query Frame = 1
Query:  349 GELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            G + S  D+E ++L    +K AFN   S+R+   R++PD R+  C    Y   LPT SV+I F+NEA SALLRT HSV  R+PP  L EV+L DD S  V L   LE  +K ++P  V ++VR++ R GLIR R+ GA  A G+VLVFLDSHCEV   WLEP+L R+ +   T++ PII+ ++   F Y  S  V   G F W +HF W  +P         +   +KS TMAGGLFA DR+YF ++G YD GM+IWGGENLEISFR WMCGG+LE  PCS +GHIFR   PY  P   D    NS R+  VWLD+YK  +   RPELRE   G++S R  LR  L C+ F W+++NV PE             ++  +  L   +L         +H      Q G    ++  L   K  ++ N+                   +E  G V    C +  IE Q+W+YN+  G  + L    CLD   ++      +  C  S   Q+W
Sbjct:    1 GMIYSREDQETRDLG--YQKHAFNLLISNRLDPHRTIPDTRHPRCATKSYPAQLPTASVVICFYNEAVSALLRTVHSVTERTPPALLHEVLLVDDFSDLVDLREGLEKELKEKFPKKV-KLVRNEKREGLIRGRMVGANHATGDVLVFLDSHCEVNVAWLEPLLARVAENPSTVVCPIIDIVNPDTFLYSASPLV--RGGFNWGLHFRWDPVPSSLLSGPDGEMAPIKSPTMAGGLFAMDRKYFNKLGQYDGGMDIWGGENLEISFRIWMCGGSLEIIPCSRIGHIFRKRRPYGSPAGADTMSRNSLRLAHVWLDEYKEQYLALRPELREREYGDVSERKALRERLGCRPFRWYLQNVYPE-------------IEVGRPQLPQAVL-------SKMHKRPKPVQRG----RLRHLQTGKCLVAHND------------------PSEKGGLVVVRPCDSGDIE-QVWVYNE--GQELQLANLLCLDMPEMEPRASPRLMKCHGSGGSQQW 461          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008097.1 (pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1 gene:ENSPMAG00000007303.1 transcript:ENSPMAT00000008097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 343.584 bits (880), Expect = 7.274e-110
Identity = 212/536 (39.55%), Postives = 291/536 (54.29%), Query Frame = 1
Query:  334 GPGENGELVS---LTDEENKNLDDVMKKEAFNRPTSDRISLQRSL-PDFRNSEC--KAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQV---GTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELRE----ANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDL-LVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCV----TELIET-QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWE 1884
             PG +G       L+ EE    +  M+K  FN   SD++SL R L PD R  EC  + F    S+P+TSVII+FHNEAWS LLRT HSV+  SP   LKE+IL DD+S    L   L+ YVK      +V++VR + R GLI ARL GA  A GEVL FLD+HCE   GWLEP+L RI Q   +++ P I +ID   F     +        G F W + F W+ IP   +   K +T  ++S T AGGLF+  ++YF  +G+YD+ MEIWGGEN+E+SFR W CGG LE  PCS VGH+FR   P+TFP        N  R+ +VW+DDYK +FY    +  E       G+++ R +LR+ LQCK+F W++ NV PE F+PD +   +G +KN     CLD    QNE  +  +   +Y C +G    Q F  S  K       +++ N    + +E  CL A    G +    C     + L  T +LW    E     N+  +QCL +      +  T+ PC+  + +Q+WE
Sbjct:  120 APGASGRAYKTDDLSPEEKAIKEKGMEKHCFNVYASDKVSLHRDLGPDTRPPECIEQKFKRCPSMPSTSVIIVFHNEAWSTLLRTVHSVMYTSPSVLLKEIILVDDASVDDYLKGPLDEYVKQF---GIVKVVRQQERKGLITARLLGASVAQGEVLTFLDAHCECFNGWLEPLLARIRQNETSVVSPDISTIDMNTFEVNKPSAYSPAHNRGNFDWGLTFGWEPIPSRERTLRKDQTYPIRSPTFAGGLFSISKKYFEYLGTYDDQMEIWGGENIEMSFRVWQCGGQLEIIPCSIVGHVFRTKSPHTFPQGVSVITRNLVRLAEVWMDDYKDIFYRRNSQAAEIVKNKAYGDVTWRKRLRDKLQCKNFTWYLTNVYPEMFVPDLHPNIFGAIKNKAKGNCLDTGSFQNEVGKPLI---LYPC-HGMGGNQYFEYSSQK-------ELRHN----VAKEM-CLHAA--MGAMHLEDCKYKGGSSLPPTYELWELRPEK-LFFNMGTQQCLTSKG----ENPTMAPCDHMDEHQQWE 629          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 398.282 bits (1022), Expect = 3.214e-132
Identity = 221/521 (42.42%), Postives = 302/521 (57.97%), Query Frame = 1
Query:  340 GENGELVSLTDEENKNL-DDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAF--IYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRA-THPYTFP-GNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNN--DIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            G  G+   L  EENK L +      +FN   SD+ISL R+L D R+  CKA    Y   LPTTSVII FH E  S LLRT HSV+NR+PP  L EVI+ DD S    LG  L+ +V  Q+    V+++R K R GL+RARL+GA  A G+VL FLDSHCE T GW EP+L RI   R  ++ P IE I+A  F+Y GST+  Q G F W + F W+ IP   +K     +D +++ TMAGGLF+  RQYFF+IGSYDE M+IWGGENLE+SFR WMCGG LE   CS VGH+FR  T PY FP G +     N  R+ +VW+D+YK L+Y  +P+ + ++ G+IS R++LR  L+CKSF W++ N+ P+  +P+ +    G V+N  SN CLD L        N   G+Y+C +G    Q+    P +    + N  D+   +P                  V+ + C   +   Q W +++E G+LM+   +QCLD  +  +   V + PC+     Q+W
Sbjct:    8 GGGGKPAFLESEENKKLAEKYFANHSFNWLLSDKISLDRTLDDVRSERCKAKHNTYPAKLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHV-AQF--TKVKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTFAYQGSTNADQRGGFSWDLFFKWKGIPPEEQKLRNDDSDPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVERTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNSDYGDISKRLELRKRLKCKSFKWYINNIYPDVQMPELDPPARGEVRNPSSNQCLDSLGAKP--EHNARVGIYTC-HGQGGNQVSKYMPRELIFEEENCFDVSKTHP---------------GAPVELMKC-HGMRGNQEWKHDREKGTLMHFTTQQCLDRGSPSDQYAV-MNPCDGRE-SQRW 504          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV8])

HSP 1 Score: 386.341 bits (991), Expect = 3.273e-129
Identity = 194/388 (50.00%), Postives = 252/388 (64.95%), Query Frame = 1
Query:  415 FNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSY--KVG-LGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTF-PGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQN 1566
            FN   S +++L RS+PD R   C +  Y   LPT SVIIIFHNEAWS LLRT HSV+ RSPP  L+E++L DD S     G LG++LE+Y+ +Q+    V+++R+  R GLIRARL GAK A GEVLVFLDSHCE   GWLEP+L RI + R  ++ P IE ID + F Y         G F W + F W+ IPE+ ++  K  +D ++S TMAGGLFA D+ YF+EIGSYD  M  WGGEN+EISFR WMCGG+LE  PCS VGH+FR + PY    G  D    N+ R+ +VW+DDYK++FY  RP+L+  + G++SGR  LR  L CKSF W++ NV+ E  IPD   +G G ++N  +N CLD L +NE        G+Y C  
Sbjct:   15 FNELASSKVALDRSIPDNRPQSCLSLSYPTKLPTASVIIIFHNEAWSTLLRTVHSVLARSPPYLLREIVLVDDHSRLDTYGHLGSKLESYI-SQF--TKVQLIRAPKREGLIRARLIGAKQAKGEVLVFLDSHCEANLGWLEPLLARIGENRSIVVTPDIEVIDLRTFGYTHEHGANNRGIFNWELTFKWRGIPEYERRRRKSDSDPIRSPTMAGGLFAIDKSYFYEIGSYDTEMSFWGGENVEISFRIWMCGGSLEIIPCSKVGHVFRESQPYKIGEGAIDR---NNMRLAEVWMDDYKKIFYAMRPQLKGKDYGDVSGRKALRERLMCKSFKWYLDNVISELAIPDLYPIGRGEIRNLGTNTCLDTLAKNE---AGGEPGMYMCHG 393          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 387.111 bits (993), Expect = 3.578e-128
Identity = 222/525 (42.29%), Postives = 307/525 (58.48%), Query Frame = 1
Query:  334 GPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAF--IYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRA-THPYTFP-GNKDYHGLNSKRMVDVWLDDYKRLFYLYR-PELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKF--IPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENN--GKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            G G+ GE  +L     ++        +FN   SDRISL R L D R  +CK    +Y  +LPTTSVII FHNEA S LLRT HSV+N SPPR + ++IL DD S    L   L  ++      N V+++R   R GL+ ARL GA+ A GEVL FLDSHCE T GWLEP+L RI + R  ++ P+IE I+A  F Y  S  + + G F W + FTW+ IPE  KK  K +TD ++S TMAGGLFA  ++YF+++GSYD  MEIWGGENLE+SFR WMCGG LE  PCS VGH+FR  T PY FP G       N  R+ +VW+D+YK  +Y  +  E R  + G+IS R+ LR  L CKSF W++ N+ P+    +P ++ L    ++N +S+LCLD L +    R     G+Y+C +G    Q F+L       + +N+I  N+         CL +   +    V+ ITC   L   Q W +NK  G+++++  + CLD S  ++   + + PC+ S+  Q+W
Sbjct:    1 GLGDLGEAATLPTRFKEHAAHAFDNHSFNVMLSDRISLDRRLKDVRGPKCKRKHKLYPRALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHISML---NKVKLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRYQASDVIHERGGFTWDLFFTWKAIPEAEKKRRKDETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTTLARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKLPPKSYLYSHQIRNKESSLCLDTLGEKNIKR----VGLYTC-HGMGGNQFFTL-------TKSNEILFNDD-------KCLDSPNGDPGSYVEMITC-HGLKGNQEWKHNKRMGTIVHVWTENCLDIS--QDGQFIIVNPCDGSST-QRW 499          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO43861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK4])

HSP 1 Score: 383.259 bits (983), Expect = 7.855e-128
Identity = 187/417 (44.84%), Postives = 261/417 (62.59%), Query Frame = 1
Query:  349 GELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPG----NKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQI 1587
            GE VS+     +  ++  +  +FN   SD +SL R LPD+RN  CKA  Y   LP +S+II FHNEAWS LLRT HSV+NR+PPR L+E++L DD+S +  L  +LE YV       VVRI+R   R GLIRARL+GA AA G +L FLD+HCE + GWLEP+  +I +    +++P+I+ I    F Y+   +    G F W + F W+ +P++  +  K + D +++  MAGGLF+ D+ YF +IG+YD GM+IWGGENLEISFR WMCGG +E  PCS VGH+FR   PY+FP     N D    N  R+ DVW+D+YK+ FY  R +L+     ++S R+ LR  L+CK+F W++ NV PE  +PD N    G V+N  S++CLD L + +    +   G+Y C +G    Q+
Sbjct:    4 GEAVSVPKRLKEKEEEGYELHSFNLVASDMMSLYRRLPDYRNDACKAKKYPLHLPKSSIIICFHNEAWSTLLRTVHSVINRTPPRLLEEILLIDDASNRDELKEKLEEYVAKL---KVVRIIRLSKRQGLIRARLKGAAAAKGSILTFLDAHCECSKGWLEPLAAKIAENSSNVVMPVIDEISDTTFYYHAVPEPFHRGVFRWRLEFGWKPVPQYEMERRKDEADGIRTPVMAGGLFSIDKNYFEKIGTYDTGMDIWGGENLEISFRIWMCGGAIEMLPCSRVGHVFRPRFPYSFPARPGHNTDVVSNNLMRVADVWMDEYKKHFYNIRFDLKRKQHDDVSQRLALREKLKCKNFKWYLDNVYPELEVPDTNFAASGQVRNPSSDMCLDTLGKKD----DTPLGLYQC-HGQGGNQV 412          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO49426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGG9])

HSP 1 Score: 348.591 bits (893), Expect = 3.513e-115
Identity = 162/324 (50.00%), Postives = 219/324 (67.59%), Query Frame = 1
Query:  472 NSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIP 1443
              +C +  Y   LP+T+V+I FHNEAWS LLRT HSV++RSP   L+E++L DD S    L ++L AYV        VR++R+  R GLIRARL GA+AA G+V+ FLD+HCE    WL+P+L RIH  R  + VP+I+ I + +F Y G T    +G F W M FTW  +P + + E K +T  +++ TMAGGLF+ DR+YFFE GSYDEGM++WGGENLE+SFR W CGG LE  PCS VGH+FR   PY+FPG      +N  R+V VW+D+Y +  Y+ RP+L+    G+I+ R+ LRN L+CKSF W+++NV PE+  P
Sbjct:   23 QGKCSSKSYPSYLPSTTVVICFHNEAWSTLLRTVHSVIDRSPAHLLREILLIDDFSTHDYLKSKLTAYVAKL---RNVRVLRTSKREGLIRARLIGARAAKGDVITFLDAHCEANVDWLQPLLSRIHSDRTIVAVPVIDIISSTNFMYSG-TPSAVIGGFSWDMQFTWHSLPNNRQSERKDRTAPIRTPTMAGGLFSIDRKYFFESGSYDEGMDVWGGENLEMSFRIWQCGGKLEILPCSRVGHVFRTRFPYSFPGGYSEVSVNLARVVHVWMDEYNQYVYMKRPDLQSLKYGDITSRVALRNKLKCKSFKWYLENVYPEQTFP 342          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 413.305 bits (1061), Expect = 4.094e-137
Identity = 215/511 (42.07%), Postives = 311/511 (60.86%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPC 1854
            + GPGE G+ V +  E  + + ++ K   FN   S+ I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAWS LLRT HSV++RSP   L+E++L DD+S +  L  +LE YV+    +  VR+VR + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI Q + T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R  LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L+++   QCLD ++ ++    +++ C
Sbjct:   53 RDGPGEGGKPVVIPKENQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRL--EVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDSQVPSVRDC 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 413.305 bits (1061), Expect = 4.094e-137
Identity = 215/511 (42.07%), Postives = 311/511 (60.86%), Query Frame = 1
Query:  328 QKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPC 1854
            + GPGE G+ V +  E  + + ++ K   FN   S+ I+L RSLPD R   CK  +Y + LP TSV+I+FHNEAWS LLRT HSV++RSP   L+E++L DD+S +  L  +LE YV+    +  VR+VR + R GLIRARL+GA  + G+V+ FLD+HCE T GWLEP+L RI Q + T++ PII+ I    F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ DR YF EIG+YD GM+IWGGENLEISFR W CGGTLE   CSHVGH+FR   PYTFPG        N++R+ +VW+D++K  FY+  P + + + G+IS R  LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   L   QLW Y+    +L+++   QCLD ++ ++    +++ C
Sbjct:   53 RDGPGEGGKPVVIPKENQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRL--EVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDSQVPSVRDC 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 408.297 bits (1048), Expect = 3.910e-135
Identity = 223/561 (39.75%), Postives = 329/561 (58.65%), Query Frame = 1
Query:  205 SKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            S+ N   + KD S L AL   IS       R H         +GPGE G+ V++  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y++ LPTTS++I+FHNEAWS LLRT HSV++RSP   L E++L DD+S +  L  +LE YV+T   +  V+I+R + R GLIRARL GA A  G+V+ FLD+HCE T GWLEP+L RI + R  ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ D+ YF EIGSYD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  +  NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   29 SECNKCDDRKDRSLLPALRAVIS-------RSH---------EGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTL--EVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 408.297 bits (1048), Expect = 3.910e-135
Identity = 223/561 (39.75%), Postives = 329/561 (58.65%), Query Frame = 1
Query:  205 SKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            S+ N   + KD S L AL   IS       R H         +GPGE G+ V++  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y++ LPTTS++I+FHNEAWS LLRT HSV++RSP   L E++L DD+S +  L  +LE YV+T   +  V+I+R + R GLIRARL GA A  G+V+ FLD+HCE T GWLEP+L RI + R  ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ D+ YF EIGSYD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  +  NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   29 SECNKCDDRKDRSLLPALRAVIS-------RSH---------EGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTL--EVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 408.297 bits (1048), Expect = 3.910e-135
Identity = 223/561 (39.75%), Postives = 329/561 (58.65%), Query Frame = 1
Query:  205 SKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPE-HFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            S+ N   + KD S L AL   IS       R H         +GPGE G+ V++  ++ + + ++ K   FN   SD I+L RSLPD R   CK  +Y++ LPTTS++I+FHNEAWS LLRT HSV++RSP   L E++L DD+S +  L  +LE YV+T   +  V+I+R + R GLIRARL GA A  G+V+ FLD+HCE T GWLEP+L RI + R  ++ PII+ I  + F Y   +D+   G F W ++F W  +P+    +    +T  V++ TMAGGLF+ D+ YF EIGSYD GM+IWGGENLE+SFR W CGG+LE   CSHVGH+FR   PY+FPG        N++R+ +VW+D++K  FY+  P +   + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  +  NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   29 SECNKCDDRKDRSLLPALRAVIS-------RSH---------EGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTL--EVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDM-TYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000011837.1 (SMESG000011837.1)

HSP 1 Score: 1244.18 bits (3218), Expect = 0.000e+0
Identity = 595/598 (99.50%), Postives = 597/598 (99.83%), Query Frame = 1
Query:  109 MRIHFKNKKILICITILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWESQFGPQ 1902
            MRIHFKNKKILICITILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNIS RIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTAT+NNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQ+WESQFGPQ
Sbjct:    1 MRIHFKNKKILICITILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWESQFGPQ 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000081451.1 (SMESG000081451.1)

HSP 1 Score: 363.999 bits (933), Expect = 8.640e-118
Identity = 231/610 (37.87%), Postives = 323/610 (52.95%), Query Frame = 1
Query:  109 MRIHFKNKKILICITILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLALGINISTYN-------------YRANRYHIYNTNQYYQKGPGENGELV-----SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSY-YGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKW 1881
            M+I +K  KI IC  ILF I L    K K  +    +  N+ + + +  L ++    N               A   H  +  +     PGE+G+ V     +LT EE +  D   K  AFN   S+ IS+ R LPD R+ ECK + Y+  LP TSVI+ FHNEAWS LLR+ HS++NRSP   LKEVIL DD S    L + LE Y+       +V+IVR+  R GLIRARL GA AA GEVL FLDSH E T GWLEP+L  I Q  + + VP+I+ I      Y + S    QVG F W++ F W  IP+  K   K  TD V + TMAGGLF+  ++YF  +G YD G +IWGGENLE+SF+ WMCGG +   PCS VGHIFR   PY++    +   +N  R+ +VWLD+YK  +Y+ R      + GNIS R+ LR +LQCK F W++ N+ P+ F+P  + L  G ++N    +C+D  +        + +  Y C N   + Q + LS                  +IRR+  CL   + +GK          +  Q W Y  E+  +  +    C++ +  +  D++ + PC S++  QKW
Sbjct:    1 MKILYKKNKIYICTGILFIIVLYVIFKSKTPEINSEDHKNLPNNNVVAKLSMSDKDKNPVPKLNENNEKNINIAAPKHNGDLKRIL---PGEDGKPVVIDVKNLTKEEKEKFDLGWKNNAFNEYASNLISIHRHLPDMRDEECKNYKYATKLPETSVILCFHNEAWSVLLRSVHSIINRSPKHLLKEVILVDDFSSMEHLKSPLEEYISQL---KIVKIVRATKREGLIRARLLGASAASGEVLTFLDSHIECTEGWLEPLLDPIAQSWKNVTVPVIDVISDDTLQYMHSSAKQVQVGGFSWNLIFNWHVIPDRDKIGRK-PTDPVNTPTMAGGLFSISKKYFDHLGGYDPGFDIWGGENLELSFKIWMCGGIMRIIPCSSVGHIFRKRSPYSWKPKVNVLKVNLVRLAEVWLDEYKEFYYM-RINHDLGDYGNISERVALRKNLQCKPFKWYLDNIYPDLFVPS-DALNSGEIRNMVKPMCVDGNIDGHDQTVPIIS--YPCHNQGGN-QFWMLSKTG---------------EIRRDLSCL---DFDGKQLTGYPCHGALGNQFWKY-MESKQIRQMNHNLCIELA--EKDDKLIMAPC-SNSLRQKW 576          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000025206.1 (SMESG000025206.1)

HSP 1 Score: 358.607 bits (919), Expect = 3.080e-115
Identity = 201/455 (44.18%), Postives = 268/455 (58.90%), Query Frame = 1
Query:  334 GPGENGELVS-----LTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYY-GSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCL 1680
            GPGE G  V      L+ +E +  D   K  A+N   S+ IS++R LPD+R+  C  + Y + LP TSVI+ FHNEAWSALLR+ HS+++RSPP  ++E+IL DD S    L   LE YV        V+I+R+K R GLIRARL G   A GEVL FLDSH E T GWLEP+L RI +    + VP+I+ ID    + +    D  QVG F W++ F W  IPE      + KTD V S TMAGGLF+  ++YF  +G+YD G +IWGGENLEISF+ WMCGG LE  PCSHVGHIFR   PY++ G+ +    NS R+ +VWLDDYK+ +Y  R      N G++S R KLR  L C +F W++ NV PE F+P  + L  G V+N  + +CLD  + ++ + G     +Y C     + Q + LS                  +IRR+ GC+
Sbjct:  116 GPGEMGRDVKIDEKLLSSQEKEKYDKGWKDHAYNEYASNMISVRRKLPDYRHKLCLTYKYLKPLPRTSVILCFHNEAWSALLRSVHSILDRSPPELIEEIILVDDKSTMKHLFEPLENYVSQL---KKVKIIRTKKREGLIRARLIGGSIAKGEVLTFLDSHIECTQGWLEPLLDRIARNWSNVPVPVIDIIDDTTLALHVAEADDVQVGGFDWNLQFNWHVIPERENARREKKTDPVSSPTMAGGLFSISKKYFEYLGTYDSGFDIWGGENLEISFKIWMCGGKLEIIPCSHVGHIFRKRSPYSW-GSGNVLRKNSIRLAEVWLDDYKKYYYT-RFNFDLGNFGDVSERKKLRQKLNCTTFKWYLDNVYPELFVPSES-LRSGEVRNPVTGMCLDASIDSK-ESGPNKVIMYPCHKQGGN-QYWMLS---------------KGGEIRRDEGCM 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000081429.1 (SMESG000081429.1)

HSP 1 Score: 357.451 bits (916), Expect = 3.357e-115
Identity = 185/395 (46.84%), Postives = 254/395 (64.30%), Query Frame = 1
Query:  340 GENGELVSLTDEENKNLDDVM------KKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSY-YGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLD 1503
            GENG +    +E N +  D+       K   FN   S++IS+ R+LPDFR  +C ++ YS++LP TSVII FHNEAWS LLR+ HS+++RSP   LKE+IL DD S+   L ++LE Y+       +V+IVR+  R GLIRAR+ G++ A GE+L FLDSH E T GWLEP+L  I Q    + +P+I++ID   F + + S++  QVG F W + FTW  IP    K  +L TD V S TMAGGLF+  ++YF  +G YD G +IWGGENLEISF+ WMCGGTL   PCS VGHIFR   PY+    KD+   N  R+ +VWLDDYK+ FY  R +   +  G++S RI LR +L C +F W++ N+ P+ FIP  + +  G +KN  +N+C++
Sbjct:  101 GENG-IAEYVNETNISPSDLSRYNEGWKNYCFNEFLSNKISITRNLPDFREKQCFSYKYSDNLPQTSVIICFHNEAWSVLLRSVHSIISRSPKNLLKEIILVDDFSHLDHLKSQLEEYMAQL---KIVKIVRTTQREGLIRARMIGSRTATGEILTFLDSHIECTPGWLEPLLDPIAQNWSNVTIPVIDNIDKSTFEFAHQSSEYIQVGGFTWDLVFTWHYIPTR-DKVGRLPTDPVNSPTMAGGLFSISKKYFEYLGEYDPGFDIWGGENLEISFKIWMCGGTLRIVPCSVVGHIFRMKSPYSSTSKKDFLKNNLVRLAEVWLDDYKQ-FYYSRIKFNRSEIGDLSDRINLRKNLNCHNFKWYIDNIYPDMFIPS-DAVNKGEIKNLATNICIE 488          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000076075.1 (SMESG000076075.1)

HSP 1 Score: 356.681 bits (914), Expect = 1.013e-113
Identity = 220/559 (39.36%), Postives = 309/559 (55.28%), Query Frame = 1
Query:  256 LGINISTYNYRANRYHIYNTNQYYQKGPGENGELV-----SLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQ----VGTFWWSMHFTWQDIPEHFKKEIKLKTDT----VKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKD-YHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIP-DRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPY--QKW 1881
            + I  S++    N + IY         PGE G         LT+ E        +K  FN   SDRIS++RS+PD R+ ECK   + E+LPTTS++I+FHNEAWS LLRT HS+++RSP   LKE++L DD+S    L + L  YVK   P  +V+IVRS+ R+GL++AR+ GA+   GEVL FLD+H E   GWLEP+L RI +   T++ PIIESI+   F    ++++GQ    VG F W M F WQ     F   I ++  T    VKS  MAGGLF+  R YF+E+G+YD GM+IWG EN+E+S R WMCGG LE  PCSHVGH+FR+  PY++  + D    +N +R+V+VWLD+YK ++Y         + GNI GR+KLR  L+C SF W++KNV P  + P     +G      SK N CLD    NE  R      ++ C N   + Q+F +S   +       ++  N C             +  K+   TC  + +E++ W Y+ E     NL + +  +   +   + V +Q C    P   QKW
Sbjct:  154 VKIKNSSFKIEENEFTIY-PRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVK---PLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFE---ASNLGQNTISVGVFDWKMQFNWQ-----FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGN-CLD--SGNENSRT---VKLFPCHNLGGN-QLFLISQTGF-------LRTINKCF------------SQNKLLLNTCDKDPVESR-WKYDDE----TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKW 669          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT19.847e-14042.18polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
GALNT134.094e-13742.31polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT135.107e-13241.65polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT31.371e-11938.59polypeptide N-acetylgalactosaminyltransferase 3 [S... [more]
GALNT61.913e-11740.60polypeptide N-acetylgalactosaminyltransferase 6 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-91.418e-15545.61Probable N-acetylgalactosaminyltransferase 9 [Sou... [more]
gly-55.880e-12240.77Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-55.880e-12240.77Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-55.880e-12240.77Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-56.590e-12240.37Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant12.067e-14442.96gene:FBgn0034025 transcript:FBtr0087331[more]
Pgant12.067e-14442.96gene:FBgn0034025 transcript:FBtr0087332[more]
Pgant51.155e-13440.58gene:FBgn0031681 transcript:FBtr0111024[more]
Pgant51.160e-13040.04gene:FBgn0031681 transcript:FBtr0079026[more]
Pgant91.194e-11640.57gene:FBgn0050463 transcript:FBtr0087113[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt16.477e-13841.98UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt16.477e-13841.98UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt135.171e-13539.79UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt132.767e-13041.33UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
GALNT32.719e-12141.50UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt15.374e-14242.97polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt18.540e-14242.97polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt16.311e-14143.08polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt11.198e-14043.08polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt11.503e-14043.08polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galnt11.377e-13942.18polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt11.377e-13942.18polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt11.377e-13942.18polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt138.530e-13742.31polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
Galnt138.530e-13742.31polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U2C4|GALT9_CAEEL1.804e-15445.61Probable N-acetylgalactosaminyltransferase 9 OS=Ca... [more]
sp|Q6WV20|GALT1_DROME2.072e-14342.96Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q10472|GALT1_HUMAN4.729e-13942.18Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q07537|GALT1_BOVIN6.192e-13942.18Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q10473|GALT1_RAT7.683e-13942.18Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ENR00.000e+052.77Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A267ENX50.000e+052.77Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A1I8GE260.000e+052.70Ricin B-type lectin domain-containing protein OS=M... [more]
A0A210Q1690.000e+051.59Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A1S3INW80.000e+052.28Polypeptide N-acetylgalactosaminyltransferase OS=L... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt13.869e-13942.97polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt133.530e-13641.46polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt131.229e-13541.15polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt11.639e-12640.66polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt134.363e-12539.23polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000477.18.218e-12242.16pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
galnt125.719e-11739.81UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
poc1bl4.995e-11638.94POC1 centriolar protein homolog B (Chlamydomonas),... [more]
galnt117.320e-11539.53UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
ENSPMAT00000008097.17.274e-11039.55pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458293.214e-13242.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458303.273e-12950.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372663.578e-12842.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438617.855e-12844.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494263.513e-11550.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt14.094e-13742.07polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt14.094e-13742.07polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt133.910e-13539.75polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt133.910e-13539.75polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt133.910e-13539.75polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011837.10.000e+099.50SMESG000011837.1[more]
SMESG000081451.18.640e-11837.87SMESG000081451.1[more]
SMESG000025206.13.080e-11544.18SMESG000025206.1[more]
SMESG000081429.13.357e-11546.84SMESG000081429.1[more]
SMESG000076075.11.013e-11339.36SMESG000076075.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029869 ID=SMED30029869|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1958bp
TATAGAATATATTGCTTATTAATATATTTGAATTTCACAATATGCTGCCT
ATTAACTAAATTTGATCAAATATTTAATTACTGAATTAATAATTTTATTA
TCAATGAAATGAGAATCCATTTTAAGAATAAAAAGATTTTAATCTGCATT
ACTATCTTATTTGGAATATTTTTGATTACACACAATAAATTTAAAATTTC
TGATTCCAAATTAAATAATGATTTAAATGTCAAAGATACCTCGTTTTTGT
TAGCTTTAGGAATCAATATCTCGACTTATAATTACCGAGCTAACAGATAC
CATATATATAATACTAATCAATATTATCAGAAAGGACCAGGTGAAAATGG
TGAATTAGTTAGCTTAACAGACGAAGAAAACAAAAATTTGGATGATGTAA
TGAAAAAAGAAGCATTTAATAGGCCAACTAGTGATAGAATATCTTTACAG
AGAAGTCTTCCGGATTTTCGAAATTCAGAATGTAAAGCTTTCATTTATTC
AGAAAGCTTACCAACAACAAGTGTGATAATTATCTTTCATAATGAAGCAT
GGTCAGCTTTACTTCGTACTGCTCATTCTGTTGTGAATCGGTCGCCTCCT
CGATTTTTAAAAGAAGTTATTCTTTTTGATGATTCCAGCTACAAAGTGGG
GCTGGGAACAGAATTAGAGGCATACGTTAAAACTCAATGGCCAGATAATG
TAGTTAGAATAGTACGAAGTAAAATTAGACTGGGATTGATTAGAGCTCGA
TTAGAAGGAGCCAAAGCTGCTTTTGGAGAGGTTTTGGTCTTTCTTGATAG
CCACTGTGAAGTGACAACTGGTTGGTTAGAACCAATACTGTTCAGAATAC
ACCAGAAACGAGAAACTATGATTGTTCCTATTATTGAGAGCATTGATGCT
AAACATTTCAGTTATTATGGGTCTACTGATGTAGGTCAAGTCGGTACGTT
TTGGTGGAGCATGCATTTTACATGGCAAGATATTCCTGAGCATTTCAAAA
AAGAAATCAAGCTCAAAACCGATACTGTAAAAAGTGCTACAATGGCTGGA
GGACTTTTTGCATCTGATAGACAGTACTTCTTCGAAATAGGTTCATATGA
TGAGGGAATGGAAATATGGGGAGGAGAAAATCTTGAAATTTCGTTTCGAA
CATGGATGTGTGGTGGAACATTAGAAACTCATCCTTGCTCTCATGTCGGA
CATATCTTTCGCGCAACTCATCCTTATACTTTCCCCGGTAATAAAGATTA
TCACGGATTAAATTCCAAACGAATGGTGGATGTTTGGCTGGATGATTACA
AAAGGTTATTCTATTTATATAGGCCTGAATTACGTGAAGCTAATGCAGGC
AATATATCGGGTCGAATAAAATTGCGCAACAGTCTCCAATGTAAATCATT
CGATTGGTTTGTAAAGAATGTTGTGCCTGAAAAATTTATTCCTGACAGAA
ATATCCTGGGATATGGTTATGTAAAAAATTCGAAATCTAATCTATGTTTG
GATTTGTTGGTACAAAATGAATTCGATCGAGGTAACTTGCACACGGGGGT
TTATTCCTGTCAGAATGGTGCTAGTTCTGCACAGATATTTTCACTTTCCC
CCGTTAAATATTCAATAAGTGACAACAATGACATCAAAGCAAATAATCCC
TGTCAAATACGTAGGGAATGGGGTTGTCTAACAGCTACCGAAAATAATGG
AAAAGTGGATTTCATTACTTGTGTGACAGAATTAATAGAAACGCAATTAT
GGATTTATAATAAAGAAAATGGCAGCCTTATGAATCTGAAGTTTAAGCAA
TGTTTAGATGCAAGTAATTTGAAAAATATGGACAGGGTTACCATTCAGCC
ATGTGAATCAAGCAATCCTTATCAGAAATGGGAATCTCAATTCGGGCCAC
AATGAGGAAAAGCACTCTATTTATTCTTTCATTTCTAGTTGTTTCTGGTG
CTACGAAG
back to top

protein sequence of SMED30029869-orf-1

>SMED30029869-orf-1 ID=SMED30029869-orf-1|Name=SMED30029869-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=599bp
MRIHFKNKKILICITILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLAL
GINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKK
EAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSA
LLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVR
IVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQK
RETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEI
KLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWM
CGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRL
FYLYRPELREANAGNISGRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNIL
GYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVK
YSISDNNDIKANNPCQIRREWGCLTATENNGKVDFITCVTELIETQLWIY
NKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQKWESQFGPQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035992Ricin_B-like_lectins
IPR000772Ricin_B_lectin
IPR001173Glyco_trans_2-like
IPR029044Nucleotide-diphossugar_trans
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 59..445
e-value: 1.8E-155
score: 519.5
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 115..441
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 138..322
e-value: 1.1E-25
score: 90.5
IPR000772Ricin B, lectin domainPFAMPF00652Ricin_B_lectincoord: 452..591
e-value: 2.9E-15
score: 56.6
IPR000772Ricin B, lectin domainPROSITEPS50231RICIN_B_LECTINcoord: 451..594
score: 18.271
IPR000772Ricin B, lectin domainCDDcd00161RICINcoord: 453..592
e-value: 1.26177E-9
score: 54.4338
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 447..595
e-value: 3.0E-19
score: 71.3
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 74..594
NoneNo IPR availablePANTHERPTHR11675:SF43POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1coord: 74..594
NoneNo IPR availableCDDcd02510pp-GalNAc-Tcoord: 138..438
e-value: 2.25982E-157
score: 450.888
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR035992Ricin B-like lectinsSUPERFAMILYSSF50370Ricin B-like lectinscoord: 444..592