Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30029856
Length (bp)1498
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30029856) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30029856) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30029856) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30029856) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029856

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30029856h1SMcG0002908 dd_Smed_v4_14989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029856h1SMcG0002908 dd_Smed_v4_14989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029856h1SMcG0002908 dd_Smed_v6_14989_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: IGLON5 (IgLON family member 5 [Source:HGNC Symbol;Acc:HGNC:34550])

HSP 1 Score: 66.6254 bits (161), Expect = 2.314e-11
Identity = 57/198 (28.79%), Postives = 82/198 (41.41%), Query Frame = 1
Query:  304 NVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            N  L C I+  +       V W+     +L  G  R T D R R     I     F++ I  +   DEG Y CS   ++      V LIV VPA+I     P+  V +   + L+C A G+P P V W  L                    ++ F+   SEG++L+IS + R   G Y CV +N V     S+  L+ 
Sbjct:   49 NATLSCFIDEHVT-----RVAWLNR-SNILYAGNDRWTSDPRVRLL---INTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISSPVT-VNEGGNVNLLCLAVGRPEPTVTWRQL--------------------RDGFT---SEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVT 213          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: OPCML (opioid binding protein/cell adhesion molecule like [Source:HGNC Symbol;Acc:HGNC:8143])

HSP 1 Score: 60.4622 bits (145), Expect = 2.177e-9
Identity = 42/137 (30.66%), Postives = 61/137 (44.53%), Query Frame = 1
Query:  469 FNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEAR 876
            +++ I+ +   DEG Y CS+   N      V LIV+VP +I   +   I V + S + L+C A G+P P V W                    H   +      SE + L+IS + RD +G Y C A N V  P+ R
Sbjct:   57 YSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIM-NISSDITVNEGSSVTLLCLAIGRPEPTVTW-------------------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVR 173          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: OPCML (opioid binding protein/cell adhesion molecule like [Source:HGNC Symbol;Acc:HGNC:8143])

HSP 1 Score: 60.077 bits (144), Expect = 3.351e-9
Identity = 42/137 (30.66%), Postives = 61/137 (44.53%), Query Frame = 1
Query:  469 FNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEAR 876
            +++ I+ +   DEG Y CS+   N      V LIV+VP +I   +   I V + S + L+C A G+P P V W                    H   +      SE + L+IS + RD +G Y C A N V  P+ R
Sbjct:   91 YSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIM-NISSDITVNEGSSVTLLCLAIGRPEPTVTW-------------------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVR 207          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: OPCML (opioid binding protein/cell adhesion molecule like [Source:HGNC Symbol;Acc:HGNC:8143])

HSP 1 Score: 60.077 bits (144), Expect = 3.444e-9
Identity = 63/243 (25.93%), Postives = 102/243 (41.98%), Query Frame = 1
Query:  166 CFKVEMPLTTVILISGFLILFEIKIS---KSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNN--MFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEAR 876
            C  + +P   ++++S   +LF +      +S    F K  + V     ++  L+C I+ ++       V W+     +L  G  + + D R       IL N    +++ I+ +   DEG Y CS+   N      V LIV+VP +I   +   I V + S + L+C A G+P P V W                    H   +      SE + L+IS + RD +G Y C A N V  P+ R
Sbjct:    4 CGYLFLPWKCLVVVS-LRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVT-----RVAWLN-RSTILYAGNDKWSIDPRVI-----ILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIM-NISSDITVNEGSSVTLLCLAIGRPEPTVTW-------------------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVR 214          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: OPCML (opioid binding protein/cell adhesion molecule like [Source:HGNC Symbol;Acc:HGNC:8143])

HSP 1 Score: 60.077 bits (144), Expect = 3.444e-9
Identity = 63/243 (25.93%), Postives = 102/243 (41.98%), Query Frame = 1
Query:  166 CFKVEMPLTTVILISGFLILFEIKIS---KSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNN--MFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEAR 876
            C  + +P   ++++S   +LF +      +S    F K  + V     ++  L+C I+ ++       V W+     +L  G  + + D R       IL N    +++ I+ +   DEG Y CS+   N      V LIV+VP +I   +   I V + S + L+C A G+P P V W                    H   +      SE + L+IS + RD +G Y C A N V  P+ R
Sbjct:    4 CGYLFLPWKCLVVVS-LRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVT-----RVAWLN-RSTILYAGNDKWSIDPRVI-----ILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIM-NISSDITVNEGSSVTLLCLAIGRPEPTVTW-------------------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVR 214          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 62.003 bits (149), Expect = 4.191e-10
Identity = 59/239 (24.69%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  202 LISGFLILFEIKISKSNIHYFIKQS-ETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKV--PRRLLT--RGIYRVTPDTRFRFNFQGILDN--NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            L+ G L++F+   S+       + S  + V ++ ++V+  C++N   +L  +  V ++K   P RLL+    ++R     R ++  +  + +  N + L I+ ++ESD G Y C +  +  I      L VKVP  +       + V + + + L C A G P P V W           +I   N    F    F      G +L +++V R     Y CVA+N + P+     +L+V
Sbjct:   66 LLCGVLLVFKQACSRGAPPTIQQPSMSSAVALLGQDVDFTCIVN---DLGSHM-VAFVKADSPPRLLSFDEKVFR----RRNKYELKPRIGDLHNEWVLTIKNVQESDRGNYSCQINTE-PITLSTGELDVKVPPVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIW------RRQDRQIIRYNGATGFGASVF-----HGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLV 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 61.6178 bits (148), Expect = 4.886e-10
Identity = 59/239 (24.69%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  202 LISGFLILFEIKISKSNIHYFIKQS-ETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKV--PRRLLT--RGIYRVTPDTRFRFNFQGILDN--NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            L+ G L++F+   S+       + S  + V ++ ++V+  C++N   +L  +  V ++K   P RLL+    ++R     R ++  +  + +  N + L I+ ++ESD G Y C +  +  I      L VKVP  +       + V + + + L C A G P P V W           +I   N    F    F      G +L +++V R     Y CVA+N + P+     +L+V
Sbjct:   66 LLCGVLLVFKQACSRGAPPTIQQPSMSSAVALLGQDVDFTCIVN---DLGSHM-VAFVKADSPPRLLSFDEKVFR----RRNKYELKPRIGDLHNEWVLTIKNVQESDRGNYSCQINTE-PITLSTGELDVKVPPVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIW------RRQDRQIIRYNGATGFGASVF-----HGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLV 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 62.003 bits (149), Expect = 4.898e-10
Identity = 59/239 (24.69%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  202 LISGFLILFEIKISKSNIHYFIKQS-ETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKV--PRRLLT--RGIYRVTPDTRFRFNFQGILDN--NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            L+ G L++F+   S+       + S  + V ++ ++V+  C++N   +L  +  V ++K   P RLL+    ++R     R ++  +  + +  N + L I+ ++ESD G Y C +  +  I      L VKVP  +       + V + + + L C A G P P V W           +I   N    F    F      G +L +++V R     Y CVA+N + P+     +L+V
Sbjct:   66 LLCGVLLVFKQACSRGAPPTIQQPSMSSAVALLGQDVDFTCIVN---DLGSHM-VAFVKADSPPRLLSFDEKVFR----RRNKYELKPRIGDLHNEWVLTIKNVQESDRGNYSCQINTE-PITLSTGELDVKVPPVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIW------RRQDRQIIRYNGATGFGASVF-----HGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLV 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 58.9214 bits (141), Expect = 3.657e-9
Identity = 53/212 (25.00%), Postives = 94/212 (44.34%), Query Frame = 1
Query:  280 TVVQVIDKNVELKCMINIKLNLTDYNNVTWMKV--PRRLLT--RGIYRVTPDTRFRFNFQGILDN--NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            + V ++ ++V+  C++N   +L  +  V ++K   P RLL+    ++R     R ++  +  + +  N + L I+ ++ESD G Y C +  +  I      L VKVP  +       + V + + + L C A G P P V W           +I   N    F    F      G +L +++V R     Y CVA+N + P+     +L+V
Sbjct:   42 SAVALLGQDVDFTCIVN---DLGSHM-VAFVKADSPPRLLSFDEKVFR----RRNKYELKPRIGDLHNEWVLTIKNVQESDRGNYSCQINTE-PITLSTGELDVKVPPVVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRR------QDRQIIRYNGATGFGASVF-----HGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLV 233          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 41.9726 bits (97), Expect = 5.580e-7
Identity = 35/130 (26.92%), Postives = 53/130 (40.77%), Query Frame = 1
Query:  475 LFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPP---LKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANN 855
            L I  +K++D G+Y C  +         V++ V VP +I      + P +  +Q+  LQ  C A GKP P++ W               LN           T+ S+   +QI+ V     G Y C A N
Sbjct: 3915 LDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQ--CLAQGKPVPQMRW--------------TLNGTALTHSTPGITVASDSTFIQINNVSLSDKGVYTCYAEN 4028          

HSP 2 Score: 30.4166 bits (67), Expect = 5.580e-7
Identity = 25/96 (26.04%), Postives = 40/96 (41.67%), Query Frame = 2
Query:  965 VMTNSEIHQRLKGD-TVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            V++N    Q ++G+  VIEC+V   P   V WL N  ++   +      + ++Y  VT+              LTI   +  D G Y+C      G
Sbjct: 4046 VISNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGV------QGVRY--VTD-----------GRMLTIIEARSLDSGIYLCSATNEAG 4122          

HSP 3 Score: 51.6026 bits (122), Expect = 1.678e-6
Identity = 39/129 (30.23%), Postives = 49/129 (37.98%), Query Frame = 1
Query:  475 LFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV 861
            L I   K  D G Y C++  +  +  K   L V+VP  I         +E NS L L C  TGKP P V W        D   + +L               SEGQ  +I        G Y C+A N V
Sbjct: 2063 LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGGEYTVIENNS-LVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVL---------------SEGQQFKIVHAEIAHKGSYICMAKNDV 2175          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: DIP-theta (gene:FBgn0051646 transcript:FBtr0079114)

HSP 1 Score: 64.3142 bits (155), Expect = 3.363e-15
Identity = 58/225 (25.78%), Postives = 100/225 (44.44%), Query Frame = 1
Query:  238 ISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKV-PRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSL---VLKNDIIYKVVTLIVKVPAKIYP-PLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            I + ++  F +  + V   + +   L+C+++   NL  Y  + W++V  + +LT   + +T + R         +   + L I  +KESD+G Y C +    +K+ + Y    L V VP  I   P    + + + S + L C ATG P P + W       +    IP+ N  E         +   G  L I++V+R   G Y C+A+N + P    +  LIV
Sbjct:  124 IPEKDLPKFGELLQNVTVPVSREAVLQCVVD---NLQTYK-IAWLRVDTQTILTIQNHVITKNHRMSITHA---EKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGY----LDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRR-----EGGELIPLPNGAE--------AVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIV 324          

HSP 2 Score: 36.5798 bits (83), Expect = 3.363e-15
Identity = 32/110 (29.09%), Postives = 45/110 (40.91%), Query Frame = 2
Query:  944 FPVKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKL 1273
            FP  P I + N  +   L  +  +EC   A P     W+ N+  I P               V    E  Y    I++RLTI+ +  QD+G Y C  + S+G   G  KL
Sbjct:  326 FP--PMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVP-----------GERFVPETFESGY---KITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKL 419          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: DIP-beta (gene:FBgn0259245 transcript:FBtr0343091)

HSP 1 Score: 69.707 bits (169), Expect = 3.814e-15
Identity = 58/214 (27.10%), Postives = 95/214 (44.39%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKV-PRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIY-PPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            F+   E V     ++    C++N   NL  +  V W+K   + +L    + +T + R         D N + L I G+K  D G+Y C  V  + +  +  TL V +P  I        + V +    +LVC A G P PK+ W       +D  +I   N     Q+ +  ++  EG+ML +S++ R   G Y C+A+N V P    + +L V
Sbjct:   90 FVIPLENVTIAQGRDATFTCVVN---NLGGHR-VAWIKADAKAILAIHEHVITNNDRLSVQHN---DYNTWTLNIRGVKMEDAGKYMCQ-VNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRR-----EDGREIIARNG--SHQKTKAQSV--EGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQV 286          

HSP 2 Score: 31.187 bits (69), Expect = 3.814e-15
Identity = 35/150 (23.33%), Postives = 61/150 (40.67%), Query Frame = 2
Query: 1004 DTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEEVKLFYQPRRFQFHNSKNF*QNSPLFLLDIPNLH 1453
            D  + C V ASP     W   N ++   +         +Y L T ++ + Y +  I   L I  LQ  D+G Y C  + S+G   G  +L + E       P +  + D    ++ + ++  +  R +   S+N   N  L+    P+ H
Sbjct:  306 DVTLICNVEASPKAINYWQRENGEM--IIAGD------RYAL-TEKENNMYAIEMI---LHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEME------RPGKKILRDDDLNEVSKNEVVQKDTRSE-DGSRNL--NGRLYKDRAPDQH 434          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: klg (gene:FBgn0017590 transcript:FBtr0084337)

HSP 1 Score: 53.5286 bits (127), Expect = 1.845e-14
Identity = 46/202 (22.77%), Postives = 80/202 (39.60%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLK--NDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV 861
            F+ +  T   V+   + L C +    NL ++  V   +    +LT     VT D R R     ++D   +NL I  ++  D G+Y C +  K   D ++ V  L+   P+    P    +   +   + L C  +G P P ++W      +  T +I                   +G +L + ++ R   G Y C A+N V
Sbjct:  103 FLSRGHTYRAVVGDTLVLPCQVE---NLGNF--VLLWRRGTNVLTASNIMVTRDERVR-----LIDG--YNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVP--PSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARI------------------GDGPILTLEKLERQQAGVYQCTADNGV 272          

HSP 2 Score: 45.0542 bits (105), Expect = 1.845e-14
Identity = 39/156 (25.00%), Postives = 62/156 (39.74%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDI--------SFKQIEEVKLFYQPRRFQFHNS 1399
            P+I +  S IH     +  + C+V A P+  V W  N+  I          +S    ++  R   H         LTI ++Q++D+G+Y C    S+G      +L           PK     D         S+  +EEV+L Y  RR Q + +
Sbjct:  288 PDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPI----------QSTDRRIMATRANRHM--------LTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLY--RRVQMNET 423          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: DIP-beta (gene:FBgn0259245 transcript:FBtr0299901)

HSP 1 Score: 66.6254 bits (161), Expect = 2.664e-14
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 1
Query:  361 VTWMKV-PRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIY-PPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            V W+K   + +L    + +T + R         D N + L I G+K  D G+Y C  V  + +  +  TL V +P  I        + V +    +LVC A G P PK+ W       +D  +I   N     Q+ +  ++  EG+ML +S++ R   G Y C+A+N V P    + +L V
Sbjct:  140 VAWIKADAKAILAIHEHVITNNDRLSVQHN---DYNTWTLNIRGVKMEDAGKYMCQ-VNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRR-----EDGREIIARNG--SHQKTKAQSV--EGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQV 307          

HSP 2 Score: 31.5722 bits (70), Expect = 2.664e-14
Identity = 35/150 (23.33%), Postives = 61/150 (40.67%), Query Frame = 2
Query: 1004 DTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEEVKLFYQPRRFQFHNSKNF*QNSPLFLLDIPNLH 1453
            D  + C V ASP     W   N ++   +         +Y L T ++ + Y +  I   L I  LQ  D+G Y C  + S+G   G  +L + E       P +  + D    ++ + ++  +  R +   S+N   N  L+    P+ H
Sbjct:  327 DVTLICNVEASPKAINYWQRENGEM--IIAGD------RYAL-TEKENNMYAIEMI---LHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEME------RPGKKILRDDDLNEVSKNEVVQKDTRSE-DGSRNL--NGRLYKDRAPDQH 455          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: DIP-beta (gene:FBgn0259245 transcript:FBtr0299898)

HSP 1 Score: 66.6254 bits (161), Expect = 2.664e-14
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 1
Query:  361 VTWMKV-PRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIY-PPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            V W+K   + +L    + +T + R         D N + L I G+K  D G+Y C  V  + +  +  TL V +P  I        + V +    +LVC A G P PK+ W       +D  +I   N     Q+ +  ++  EG+ML +S++ R   G Y C+A+N V P    + +L V
Sbjct:  140 VAWIKADAKAILAIHEHVITNNDRLSVQHN---DYNTWTLNIRGVKMEDAGKYMCQ-VNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRR-----EDGREIIARNG--SHQKTKAQSV--EGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQV 307          

HSP 2 Score: 31.5722 bits (70), Expect = 2.664e-14
Identity = 35/150 (23.33%), Postives = 61/150 (40.67%), Query Frame = 2
Query: 1004 DTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEEVKLFYQPRRFQFHNSKNF*QNSPLFLLDIPNLH 1453
            D  + C V ASP     W   N ++   +         +Y L T ++ + Y +  I   L I  LQ  D+G Y C  + S+G   G  +L + E       P +  + D    ++ + ++  +  R +   S+N   N  L+    P+ H
Sbjct:  327 DVTLICNVEASPKAINYWQRENGEM--IIAGD------RYAL-TEKENNMYAIEMI---LHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEME------RPGKKILRDDDLNEVSKNEVVQKDTRSE-DGSRNL--NGRLYKDRAPDQH 455          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: negr1 (neuronal growth regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040822-27])

HSP 1 Score: 71.2478 bits (173), Expect = 4.802e-13
Identity = 53/207 (25.60%), Postives = 92/207 (44.44%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARS 879
            +   SE+VV        L+C +     L   +   W+     ++  G  + + D R       + D + ++L I+ +  +DEG Y CS+  + ++  K++ LIVKVP KIY  +   I V + S + L+C A+GKP PK+ W  +   +                       +  G+ L I+ + RD  G Y C A N +  P+ ++
Sbjct:   40 YTTSSESVVSRQGDTALLRCYL-----LDGISKGAWLN-RSSIIYAGNDKWSGDPRVSI-VSNVGDKHEYSLQIQKVDVTDEGVYTCSIQSERNLHPKLIQLIVKVPPKIY-DISSDITVNEGSNVSLICAASGKPEPKISWRHISPSARK---------------------YESGEYLNITGISRDQAGDYECGAENDIASPDTKT 217          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: opcml (opioid binding protein/cell adhesion molecule-like [Source:ZFIN;Acc:ZDB-GENE-040927-3])

HSP 1 Score: 65.4698 bits (158), Expect = 3.652e-11
Identity = 56/237 (23.63%), Postives = 105/237 (44.30%), Query Frame = 1
Query:  196 VILISGFLILFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDN---NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            V++    L L    +   +   ++K + TV Q    +  LKC ++ K++      V W       L R     T + ++  + + +L N   N +++ I  +   DEG Y CS++         V LIV+VPA+I   +   + V + S + L+C A G+P P + W                     F+  + + I +EG+ ++++ + +DM+G Y C+ +N + P      Q+ V
Sbjct:   15 VVVALRLLFLVPAGVPARSGDSYLKDNITVRQ--GDSAVLKCSVDNKVS-----RVAW-------LNRTTILFTGNEKWSLDPRVVLLNTAVNEYSIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVN-VSTDVSVNEGSNVSLMCLAIGRPEPSILW--------------------KFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTV 216          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: IGLON5 (zgc:110372 [Source:ZFIN;Acc:ZDB-GENE-050417-297])

HSP 1 Score: 59.3066 bits (142), Expect = 3.185e-9
Identity = 52/199 (26.13%), Postives = 85/199 (42.71%), Query Frame = 1
Query:  301 KNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            ++V L+C I+      +  +  W+     L T G  + + D+R         +N+ F++ IE +  +DEG Y CS   +N      V LIV+VPA+I   +     V +   + L C A G+P P + W           K  +LN               EG+ L+I+ + R     + C+ NN V P    K ++ V
Sbjct:   23 ESVVLRCKID-----EEVTHKAWLNRSNILFT-GTDKWSLDSRVSLENN---NNSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIV-NISQDKSVNEGEDVNLFCLAVGRPEPTITWKDF--------KYGLLN---------------EGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTV 188          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: IGLON5 (zgc:110372 [Source:ZFIN;Acc:ZDB-GENE-050417-297])

HSP 1 Score: 58.9214 bits (141), Expect = 4.469e-9
Identity = 52/199 (26.13%), Postives = 85/199 (42.71%), Query Frame = 1
Query:  301 KNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            ++V L+C I+      +  +  W+     L T G  + + D+R         +N+ F++ IE +  +DEG Y CS   +N      V LIV+VPA+I   +     V +   + L C A G+P P + W           K  +LN               EG+ L+I+ + R     + C+ NN V P    K ++ V
Sbjct:   42 ESVVLRCKID-----EEVTHKAWLNRSNILFT-GTDKWSLDSRVSLENN---NNSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIV-NISQDKSVNEGEDVNLFCLAVGRPEPTITWKDF--------KYGLLN---------------EGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTV 207          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: ncam1a (neural cell adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-990415-31])

HSP 1 Score: 58.151 bits (139), Expect = 7.170e-9
Identity = 47/156 (30.13%), Postives = 72/156 (46.15%), Query Frame = 1
Query:  409 RVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKI---YPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV 861
            R+ P+T  R     +L NN  +L I GIK++DEG+Y C   ++ + +I  +V+ +IV V   I   Y  L     +  N  + L C+A G P P V W                   E    E++S ++ +G  L I  V++   G Y C+A NK 
Sbjct:  143 RIQPETDVRLK---VLSNN--HLQIRGIKKTDEGDYTCEGRIMARGEIDLRVIKVIVNVLPSIRTRYTELNATADI--NQAVTLACHADGYPEPTVKWAR--------------GNTELESDEKYS-LNEDGSELTIKDVNKLDEGDYKCIARNKA 276          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: carhsp1 (calcium regulated heat stable protein 1 [Source:Xenbase;Acc:XB-GENE-489416])

HSP 1 Score: 70.0922 bits (170), Expect = 1.404e-12
Identity = 66/244 (27.05%), Postives = 108/244 (44.26%), Query Frame = 1
Query:  175 VEMPLTTVILIS-GFLILFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDN--NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            ++ PL  V L S G ++L ++   +     F+  ++        N  L C+I+ K+       V W+     +L  G  + + D+R +     +L N  + +++ I  +  +DEG Y CS   ++      V LIV+VPAKI   +   + V + S + L C A GKP P + W  L                     E FS   SEG++L+I+ ++R   G Y CV +N V      K Q+ V
Sbjct:    1 MKAPLQRVSLASLGIVMLAQVLFVQCT--EFVPPADNYTVSQGDNATLSCLIDDKVT-----RVAWLNR-SNILYAGKDKWSIDSRVQ-----LLTNTKSEYSIVITHVDVADEGLYTCSFQTEDKPHTSQVYLIVQVPAKIVN-ISSSVTVNEGSNVNLQCLAVGKPEPTITWQQL--------------------SEGFS---SEGELLEITEINRQQAGDYECVTSNGVSVPDTKKVQITV 207          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: pllp (plasmolipin [Source:Xenbase;Acc:XB-GENE-6036173])

HSP 1 Score: 56.6102 bits (135), Expect = 2.457e-11
Identity = 39/145 (26.90%), Postives = 64/145 (44.14%), Query Frame = 1
Query:  463 NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            + +++ I+ +   DEG Y CS+   N      V LIV+VP +I   +   I V + S + L+C A G+P P V W                     +   +     SE + L+I+ + R+ +G Y C A+N V      + +L V
Sbjct:   91 SQYSIEIQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPRIV-DISSSIAVNEGSNVSLICIANGRPEPVVNW--------------------RYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTV 214          

HSP 2 Score: 32.3426 bits (72), Expect = 2.457e-11
Identity = 23/98 (23.47%), Postives = 40/98 (40.82%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            P  ++    I   L    +++C   A P     W   +++++          S +   V NR+        IS R+T  N+  QDYG+Y C  +  +G
Sbjct:  217 PPYILDAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRLS---------DSWRGVKVENRET-------IS-RVTFLNVSEQDYGNYTCMAKNLLG 297          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: pllp (plasmolipin [Source:Xenbase;Acc:XB-GENE-6036173])

HSP 1 Score: 56.6102 bits (135), Expect = 2.625e-11
Identity = 39/145 (26.90%), Postives = 64/145 (44.14%), Query Frame = 1
Query:  463 NMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            + +++ I+ +   DEG Y CS+   N      V LIV+VP +I   +   I V + S + L+C A G+P P V W                     +   +     SE + L+I+ + R+ +G Y C A+N V      + +L V
Sbjct:   91 SQYSIEIQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPRIV-DISSSIAVNEGSNVSLICIANGRPEPVVNW--------------------RYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTV 214          

HSP 2 Score: 32.3426 bits (72), Expect = 2.625e-11
Identity = 23/98 (23.47%), Postives = 40/98 (40.82%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            P  ++    I   L    +++C   A P     W   +++++          S +   V NR+        IS R+T  N+  QDYG+Y C  +  +G
Sbjct:  217 PPYILDAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRLS---------DSWRGVKVENRET-------IS-RVTFLNVSEQDYGNYTCMAKNLLG 297          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lsamp (limbic system associated membrane protein [Source:NCBI gene;Acc:100124984])

HSP 1 Score: 60.8474 bits (146), Expect = 5.383e-11
Identity = 54/229 (23.58%), Postives = 97/229 (42.36%), Query Frame = 1
Query:  175 VEMPLTTVILISGFLILFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV 861
            ++ P   + L+   L +     ++S  +  ++Q +T +        L+C +  +      + V W+     ++  G  + + D R     + +L+   ++L I+ +  SDEG Y CS+  K       V LIV+VP KI   +   I V + S + L+C A G+P P + W  L   + D                       E + L+I  + R+ +G Y C A N+V
Sbjct:    6 LDSPFQLLCLLPTGLPVRSGDFNRSTDNITVRQGDTAI--------LRCFVEDR-----SSRVAWLNR-SGIIFAGDDKWSLDPRVELEKRSLLE---YSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVPPKI-SNISADITVNEGSNVTLMCIAYGRPEPMITWRHLTPTARD--------------------FEGEEEFLEIQGITREQSGRYECKAANEV 196          

HSP 2 Score: 26.9498 bits (58), Expect = 5.383e-11
Identity = 18/97 (18.56%), Postives = 37/97 (38.14%), Query Frame = 2
Query:  965 VMTNSEIHQRLKG-DTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGM 1252
            ++T S+ ++   G   ++ C   A P    EW  ++ +IN      + N   +  L+                  + N+  + YG+Y C     +G+
Sbjct:  213 IITESKSNEATTGKQAILRCEASAVPAPDFEWYKDDTRINSAQGLEIRNTGSRSVLM------------------VANVTEEHYGNYTCVAANKLGI 291          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lsamp (limbic system associated membrane protein [Source:NCBI gene;Acc:100124984])

HSP 1 Score: 59.3066 bits (142), Expect = 8.764e-11
Identity = 43/147 (29.25%), Postives = 65/147 (44.22%), Query Frame = 1
Query:  421 DTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV 861
            D R     + +L+   ++L I+ +  SDEG Y CS+  K       V LIV+VP KI   +   I V + S + L+C A G+P P + W  L   + D                       E + L+I  + R+ +G Y C A N+V
Sbjct:   65 DPRVELEKRSLLE---YSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVPPKI-SNISADITVNEGSNVTLMCIAYGRPEPMITWRHLTPTARD--------------------FEGEEEFLEIQGITREQSGRYECKAANEV 187          

HSP 2 Score: 27.7202 bits (60), Expect = 8.764e-11
Identity = 18/97 (18.56%), Postives = 37/97 (38.14%), Query Frame = 2
Query:  965 VMTNSEIHQRLKG-DTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGM 1252
            ++T S+ ++   G   ++ C   A P    EW  ++ +IN      + N   +  L+                  + N+  + YG+Y C     +G+
Sbjct:  204 IITESKSNEATTGKQAILRCEASAVPAPDFEWYKDDTRINSAQGLEIRNTGSRSVLM------------------VANVTEEHYGNYTCVAANKLGI 282          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 59.3066 bits (142), Expect = 5.893e-12
Identity = 51/157 (32.48%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN--SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARSKFQLIVKCK 906
            +L NN   L I GIK++DEG YRC   ++ + +I +K + +IV VP  +    + I+    N    + LVC+A G P P + W     D +     PI N  E  ++  FS   SE   L I  V ++    Y C+A NK  E +A    ++  K K
Sbjct:  168 VLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQ-ARQSIVNATANLGQSVTLVCDADGFPEPTMSWT---KDGE-----PIENEEEDDEKHIFSDDSSE---LTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPK 310          

HSP 2 Score: 31.187 bits (69), Expect = 5.893e-12
Identity = 22/101 (21.78%), Postives = 42/101 (41.58%), Query Frame = 2
Query:  950 VKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISV-RLTIFNLQRQDYGDYVCQMRTSMG 1249
             KP+I    ++    L+    + C     P+ ++ W  +   I+       E ++L        D H  V +   V  LT+ ++Q  D G+Y+C    ++G
Sbjct:  307 AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS------EEKTL--------DGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIG 393          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 59.3066 bits (142), Expect = 6.624e-12
Identity = 51/157 (32.48%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN--SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARSKFQLIVKCK 906
            +L NN   L I GIK++DEG YRC   ++ + +I +K + +IV VP  +    + I+    N    + LVC+A G P P + W     D +     PI N  E  ++  FS   SE   L I  V ++    Y C+A NK  E +A    ++  K K
Sbjct:  168 VLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQ-ARQSIVNATANLGQSVTLVCDADGFPEPTMSWT---KDGE-----PIENEEEDDEKHIFSDDSSE---LTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPK 310          

HSP 2 Score: 31.187 bits (69), Expect = 6.624e-12
Identity = 22/101 (21.78%), Postives = 42/101 (41.58%), Query Frame = 2
Query:  950 VKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISV-RLTIFNLQRQDYGDYVCQMRTSMG 1249
             KP+I    ++    L+    + C     P+ ++ W  +   I+       E ++L        D H  V +   V  LT+ ++Q  D G+Y+C    ++G
Sbjct:  307 AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS------EEKTL--------DGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIG 393          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 59.3066 bits (142), Expect = 6.649e-12
Identity = 51/157 (32.48%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN--SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARSKFQLIVKCK 906
            +L NN   L I GIK++DEG YRC   ++ + +I +K + +IV VP  +    + I+    N    + LVC+A G P P + W     D +     PI N  E  ++  FS   SE   L I  V ++    Y C+A NK  E +A    ++  K K
Sbjct:  168 VLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQ-ARQSIVNATANLGQSVTLVCDADGFPEPTMSWT---KDGE-----PIENEEEDDEKHIFSDDSSE---LTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPK 310          

HSP 2 Score: 30.8018 bits (68), Expect = 6.649e-12
Identity = 22/101 (21.78%), Postives = 42/101 (41.58%), Query Frame = 2
Query:  950 VKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISV-RLTIFNLQRQDYGDYVCQMRTSMG 1249
             KP+I    ++    L+    + C     P+ ++ W  +   I+       E ++L        D H  V +   V  LT+ ++Q  D G+Y+C    ++G
Sbjct:  307 AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS------EEKTL--------DGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIG 393          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 59.3066 bits (142), Expect = 6.758e-12
Identity = 51/157 (32.48%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN--SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARSKFQLIVKCK 906
            +L NN   L I GIK++DEG YRC   ++ + +I +K + +IV VP  +    + I+    N    + LVC+A G P P + W     D +     PI N  E  ++  FS   SE   L I  V ++    Y C+A NK  E +A    ++  K K
Sbjct:  168 VLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQ-ARQSIVNATANLGQSVTLVCDADGFPEPTMSWT---KDGE-----PIENEEEDDEKHIFSDDSSE---LTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPK 310          

HSP 2 Score: 30.8018 bits (68), Expect = 6.758e-12
Identity = 22/101 (21.78%), Postives = 42/101 (41.58%), Query Frame = 2
Query:  950 VKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISV-RLTIFNLQRQDYGDYVCQMRTSMG 1249
             KP+I    ++    L+    + C     P+ ++ W  +   I+       E ++L        D H  V +   V  LT+ ++Q  D G+Y+C    ++G
Sbjct:  307 AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS------EEKTL--------DGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIG 393          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Iglon5 (IgLON family member 5 [Source:MGI Symbol;Acc:MGI:2686277])

HSP 1 Score: 66.6254 bits (161), Expect = 1.662e-11
Identity = 57/198 (28.79%), Postives = 82/198 (41.41%), Query Frame = 1
Query:  304 NVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            N  L C I+  +       V W+     +L  G  R T D R R     I     F++ I  +   DEG Y CS   ++      V LIV VPA+I     P+  V +   + L+C A G+P P V W  L                    ++ F+   SEG++L+IS + R   G Y CV +N V     S+  L+ 
Sbjct:   49 NATLSCFIDEHVT-----RVAWLNR-SNILYAGNDRWTSDPRVRLL---INTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISSPVA-VNEGGNVNLLCLAVGRPEPTVTWRQL--------------------RDGFT---SEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVT 213          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q26474|LACH_SCHAM (Lachesin OS=Schistocerca americana OX=7009 GN=LAC PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.513e-13
Identity = 58/216 (26.85%), Postives = 97/216 (44.91%), Query Frame = 1
Query:  274 SETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRL------LTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLK-NDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK 900
            S+  ++ I   VEL+C +       DY  V WMKV R        ++ G   +  D+RF   +     ++ + L I+ I+E+D G Y+C +++  N+ I   V L V+ P  I       + V +   ++L C A G P P+V W       ++   +P   ++              G +L+ISR+ ++  G Y CVA N V   AR    + V+
Sbjct:   28 SQEQIKDIGGTVELECSVQYA---QDYP-VLWMKVDRNRQVDPLPISTGSSLIIRDSRFALRYD--TASSTYTLQIKDIQETDAGFYQCQVIIGLNNKITAEVDLQVRRPPVISDNSTRSLVVSEGQAVRLECYAGGYPAPRVSW-----RRENNAILPTGGSIYR------------GNVLKISRIGKEDRGTYYCVAENGVGKGARRNIAVEVE 220          

HSP 2 Score: 30.0314 bits (66), Expect = 3.513e-13
Identity = 22/102 (21.57%), Postives = 41/102 (40.20%), Query Frame = 2
Query:  944 FPVKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            FP  P I +    + Q L+ D  +EC V A P  A+ WL +   +         + +  Y +      H    +  +    +  ++++ YG Y C+    +G
Sbjct:  221 FP--PVITVPRPRLGQALQYDMDLECHVEAYPPPAITWLKDETVL---------SNNQHYSI-----SHFATADEFTDTTRVITIEKRQYGKYQCKAANKLG 306          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q24372|LACH_DROME (Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 2.629e-11
Identity = 56/215 (26.05%), Postives = 91/215 (42.33%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRR--LLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKV---VTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYS-----LPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEAR 876
            +I Q +  ++ I   VE  C +          NV ++K       L+ G   V  D+RF   +    +++ + L I+ I+E+D G Y C +V+    ++KV   V L V+ P  I       +   + S++Q+ C A+G P P + W       LP+DS   T +                    G  L+I  V ++  G Y CVA+N V    R
Sbjct:   33 YITQEQ--IKDIGGTVEFDCSVQYAKEY----NVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDP--NSSTYKLQIKDIQETDAGTYTCQVVIST--VHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDS--ATYV--------------------GNTLRIKSVKKEDRGTYYCVADNGVSKGDR 215          

HSP 2 Score: 33.8834 bits (76), Expect = 2.629e-11
Identity = 24/107 (22.43%), Postives = 42/107 (39.25%), Query Frame = 2
Query:  929 NKNKSFPVKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            N N      P I +    + Q L+ D  +EC + A P  A+ W  ++ ++         N+          DE+          L +  ++++ YGDYVC+     G
Sbjct:  217 NINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQL-------ANNQHYSISHFATADEY------TDSTLRVITVEKRQYGDYVCKATNRFG 310          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P13596|NCAM1_RAT (Neural cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ncam1 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.604e-11
Identity = 51/157 (32.48%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN--SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARSKFQLIVKCK 906
            +L NN   L I GIK++DEG YRC   ++ + +I +K + +IV VP  +    + I+    N    + LVC+A G P P + W     D +     PI N  E  ++  FS   SE   L I  V ++    Y C+A NK  E +A    ++  K K
Sbjct:  168 VLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQ-ARQSIVNATANLGQSVTLVCDADGFPEPTMSWT---KDGE-----PIENEEEDDEKHIFSDDSSE---LTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPK 310          

HSP 2 Score: 31.187 bits (69), Expect = 3.604e-11
Identity = 22/101 (21.78%), Postives = 41/101 (40.59%), Query Frame = 2
Query:  950 VKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISV-RLTIFNLQRQDYGDYVCQMRTSMG 1249
             KP+I    ++    L+    + C     P+ ++ W  +   I+    A       +  L    D H  V +   V  LT+ ++Q  D G+Y+C    ++G
Sbjct:  307 AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETL----DGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIG 403          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P13595|NCAM1_MOUSE (Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3)

HSP 1 Score: 58.9214 bits (141), Expect = 4.176e-11
Identity = 51/157 (32.48%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN--SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARSKFQLIVKCK 906
            +L NN   L I GIK++DEG YRC   ++ + +I +K + +IV VP  +    + I+    N    + LVC+A G P P + W     D +     PI N  E  ++  FS   SE   L I  V ++    Y C+A NK  E +A    ++  K K
Sbjct:  168 VLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQ-ARQSIVNATANLGQSVTLVCDADGFPEPTMSWT---KDGE-----PIENEEEDDEKHIFSDDSSE---LTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPK 310          

HSP 2 Score: 31.187 bits (69), Expect = 4.176e-11
Identity = 21/100 (21.00%), Postives = 42/100 (42.00%), Query Frame = 2
Query:  950 VKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
             KP+I    ++    L+    + C     P+ ++ W  +   I+       E ++L   +V     H  V +     LT+ ++Q  D G+Y+C    ++G
Sbjct:  307 AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNIS------SEEKTLDGHMVVRS--HARVSS-----LTLKSIQYTDAGEYICTASNTIG 393          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P31836|NCAM1_BOVIN (Neural cell adhesion molecule 1 OS=Bos taurus OX=9913 GN=NCAM1 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 8.337e-11
Identity = 52/159 (32.70%), Postives = 78/159 (49.06%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCS--LVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN--SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQER--FSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARSKFQLIVKCK 906
            +L NN   L I GIK++DEG YRC   ++ + +I +K + +IV VP  +    + I+    N    + LVCNA G P P V W      + D  +I      E+ + E+  FS   SE   L I +V ++    Y C+A NK  E +A    ++  K K
Sbjct:  168 VLTNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQ-ARQSIVNATANLGQSVTLVCNAEGFPEPTVSW------TKDGEQI------ENEEDEKYLFSDDSSE---LTIRKVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPK 308          

HSP 2 Score: 31.5722 bits (70), Expect = 8.337e-11
Identity = 23/101 (22.77%), Postives = 41/101 (40.59%), Query Frame = 2
Query:  950 VKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVR-LTIFNLQRQDYGDYVCQMRTSMG 1249
             KP+I    ++    L+    + C     P+ ++ W  +   I+    A       +  L    D H  V +   V  LT+ ++Q  D G+YVC    ++G
Sbjct:  305 AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETL----DGHMVVRSHARVSSLTLKSIQYTDAGEYVCTASNTIG 401          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4E0RRX9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000267 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.500e-47
Identity = 82/246 (33.33%), Postives = 128/246 (52.03%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWY---SLP------------SDSDDTTKI------------------PILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK 900
            F  Q +T   V    VEL C I +KL+ +D+ NV+W+K+PRR+LTRG  RVT D R     Q +++ + F L I+ ++E D GEYRC   L +++ +KVV L+VKVP         ++  ++   L+L CNA+G P PK+ W+   SLP             +   TT++                  PI   L  ++ + F      G +L  SR++R M+G+Y C A+N + P A S  +++V+
Sbjct:   60 FFNQLQTYDAVNGTRVELSCHIELKLSASDFTNVSWLKMPRRILTRGPLRVTRDNRIHLLPQTVMNTSEFPLIIDPVREQDAGEYRCLFQLGSELHHKVVILVVKVPPYFEQRPAKLVKADERGNLRLFCNASGAPQPKIRWWVRLSLPPTHEPLISSTPEGNRSGTTRVSSPANDENSLLVGKERLRPIEIMLSRYRNDIF----VRGGLLVFSRLNRHMSGWYLCEADNGISPAALSLSRVLVR 301          

HSP 2 Score: 77.411 bits (189), Expect = 5.500e-47
Identity = 51/152 (33.55%), Postives = 65/152 (42.76%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLV----------------------------TNRD---------EHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNS 1300
            PEI M+NSEI Q L G T+I C V A P G+VEW  N   I    C   E + LKYC +                            T  D         + H       VRLTI N+   D G Y C++RTS G+G G T+L    ++ +S
Sbjct:  304 PEIRMSNSEIQQHLGGSTIIGCTVRAYPAGSVEWELNGVPIQAPYCGYFEVKKLKYCQIEYHKYAGDFSSLVDSSPNSRVSTVGSFYTGADNILPRRMDPDDHEFYRLSDVRLTIANITHSDLGLYTCRVRTSAGVGEGYTRLDAHRFKFHS 455          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4S2ME04 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000678 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 6.497e-47
Identity = 76/222 (34.23%), Postives = 118/222 (53.15%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQ-----ERFS----TIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK 900
            F      V  V     EL C +N+ L+ ++ +NVTW++ PR++LTRGI+RVT D R       +L    F+LFI  +   D GEYRC++ LKN++  + VTL V +P KI     P + V++ + L++ C A G P P+  W+      +   ++   N  + FQ      E+FS     I S    L I+++HR+M G+  CVA N V P+  +  +L V+
Sbjct:   31 FTNAENMVTAVNGSKAELDCQLNVDLDPSEMDNVTWVRAPRQILTRGIFRVTEDPRISTAPLVLLKRRDFSLFIHPVLFEDAGEYRCAITLKNNVYIRTVTLKVLLPPKITRSPVPFLKVDEGASLEITCVAKGYPNPQTNWFVSKRSPNMFARLDQRN--QTFQDLIPVTEKFSDFAGKILSLNGTLWITKLHRNMNGYLVCVAQNGVPPDDTTTLELSVR 250          

HSP 2 Score: 85.8853 bits (211), Expect = 6.497e-47
Identity = 47/113 (41.59%), Postives = 63/113 (55.75%), Query Frame = 2
Query:  944 FPVKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNE-KINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQ 1279
            FP  P+I M N  I Q L  +TV+ C V A+P G V+W  N + +I    C  L N   K+CL+ +R   + VL PI  +LTIF L   D+GDY C +   MG  YG T L++
Sbjct:  251 FP--PDIQMANRVIKQSLGMNTVLSCTVFANPPGTVQWYFNQKTRIIASSCDILSNEEKKHCLLEHRPHPNNVLAPIISKLTIFRLNSADFGDYTCSVSNIMGERYGTTSLQR 361          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4E0RBU5 (IgLON family member 5 OS=Fasciola hepatica OX=6192 GN=D915_005635 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.023e-45
Identity = 74/216 (34.26%), Postives = 115/216 (53.24%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWY-SLPSDS--DDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK 900
            F+   + V  V     +L+C   + L + D +NVTW++ PR++LTRGI+RVT DTR       +L    F+LFI  +   D GEYRC++  ++ +  + V L V VP KI     P + V++ + L++ C ATG P P+  W    P  +  ++         +E F +     I+ +G  L+ISR+HR+M     CVA+N VEP  R   +L V+
Sbjct:   38 FVSTKDVVSVVNGTEAKLECQSKVDLQIEDLDNVTWVRSPRQILTRGIFRVTEDTRISTAPLVLLKRRDFSLFIRPVFFEDRGEYRCTITFRDRVYIRTVELRVLVPPKIIRSPVPFLKVDEGASLEMDCLATGHPTPETTWLVQTPRQTTVENNWHESAQTVMEAFAKFGGRIINLKG-TLKISRLHRNMNQRLVCVASNGVEPNDRRTVELSVR 252          

HSP 2 Score: 87.8113 bits (216), Expect = 1.023e-45
Identity = 47/115 (40.87%), Postives = 64/115 (55.65%), Query Frame = 2
Query:  944 FPVKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNE-KINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSE 1285
            FP  P + M N  I Q +  +T++ C V A+P G + W  N++ KI    C  L N   KYCL  +R     VL+PI+ +LTIF L   D+GDY+C + T MG  YG T L+  E
Sbjct:  253 FP--PNVRMANRIIKQIVGKNTMLSCYVTANPSGTIHWFFNHQVKIEASSCDILANEEKKYCLQEHRPPTTDVLSPITSKLTIFRLNHMDFGDYICSVTTIMGEAYGTTTLQAFE 365          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A094ZZ25 (IgLON family member 5 OS=Schistosoma haematobium OX=6185 GN=MS3_06836 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.402e-45
Identity = 71/200 (35.50%), Postives = 107/200 (53.50%), Query Frame = 1
Query:  307 VELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFW--YSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK 900
             EL C I+I L   +   +TW++ PR+LLT+G+YRVT + R       +L     +LF+      DEGEYRC+L LK+ I    V+L + VP  I     P + V++ S L+L C ATG P P+V W  +S P   DD T   +L+  + F        H  G ++ I ++HR M   + C+A N V+P+ + +  L V+
Sbjct:   43 AELSCPIDIVLTRKELETLTWIRAPRQLLTKGVYRVTENPRVFLAPMDLLKTKALSLFLRPTLPDDEGEYRCTLTLKDRIHVHTVSLNISVPPIIIKSPVPYLKVDEGSSLELNCLATGNPPPQVTWKVFSNPLLKDDKTDRKLLSIPDAFSGLGVPINHHNGTLI-IGKLHRKMNQRFLCIAANGVQPDDQREVFLSVR 241          

HSP 2 Score: 89.3521 bits (220), Expect = 1.402e-45
Identity = 51/141 (36.17%), Postives = 79/141 (56.03%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNE-KINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIF----MEDISFKQIEEVKL 1363
            PE+ MTN  I Q +  +TV+ C V A P G++ WL N+   I    C  + N   KYCL  +R + +  L+ I+ +L IFNL+  D+GDYVC + T MG  +G+T L++ + E+      QI     +E +S KQ+   ++
Sbjct:  244 PEVKMTNRIIKQGIGMNTVLTCQVSAHPPGSIRWLFNHHYPITATSCDVMTNSEKKYCLQEHRPQSYNSLSAITSKLAIFNLKVGDFGDYVCSVSTIMGESFGVTTLQRFKTERFGTDIAQIMHQKQIERLSDKQVARDRI 384          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A504ZCU9 (IgLON family member 5 OS=Fasciola gigantica OX=46835 GN=FGIG_08334 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.587e-45
Identity = 74/216 (34.26%), Postives = 116/216 (53.70%), Query Frame = 1
Query:  262 FIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWY-SLPSDS--DDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK 900
            F+   + V  V     +L+C   + L + D +NVTW++ PR++LTRGI+RVT DTR       +L    F+LFI  +   D GEYRC++  ++ +  + V L V VP KI     P + V++ + L++ C ATG P P+  W    P  +  ++     +   +E F +     I+ +G  L+ISR+HR+M     CVA+N VEP  R   +L V+
Sbjct:   38 FVSTKDVVSVVNGTEAKLECQSKVDLQIEDLDNVTWVRSPRQILTRGIFRVTEDTRISTAPLVLLKRRDFSLFIRPVFFEDRGEYRCTITFRDRVYIRTVELRVLVPPKIIRSPVPFLKVDEGASLEMDCLATGHPTPETTWLVQTPRQTTVENNWHESVQTVMEAFGKFGGRIINLKG-TLKISRLHRNMNQRLVCVASNGVEPNDRRTVELSVR 252          

HSP 2 Score: 86.2705 bits (212), Expect = 1.587e-45
Identity = 45/112 (40.18%), Postives = 63/112 (56.25%), Query Frame = 2
Query:  944 FPVKPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNE-KINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLK 1276
            FP  P + M N  I Q +  +T++ C V A+P G + W  N++ KI    C  L N   KYCL  +R     VL+P++ +LTIF L   D+GDY+C + T MG  YG T L+
Sbjct:  253 FP--PNVRMANRIIKQIVGKNTMLSCYVTANPSGTIHWFFNHQVKIEASSCDILANEEKKYCLQEHRPPTTDVLSPVTSKLTIFRLNHMDFGDYICSVTTIMGEAYGTTTLQ 362          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ntm (neurotrimin [Source:NCBI gene;Acc:103040165])

HSP 1 Score: 58.5362 bits (140), Expect = 6.149e-13
Identity = 43/148 (29.05%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  454 LDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            L+ + F + IE +  SDEG + C++   +      V +IV+VP KI    K +I V + S + L+C ATGKP P + W  L    D                       S+ + L+I  + R   G Y C A N +  + ++  QL+V
Sbjct:   91 LNRDEFTIKIENVDMSDEGLFVCAVQTSSKPRTTSVHIIVQVPPKIVNFSKDLI-VNEGSNVSLMCLATGKPEPAISWRMLSPSGDGP--------------------GSDEEYLEIPSISRQRAGEYECTAVNDIATDTKT-VQLVV 216          

HSP 2 Score: 35.039 bits (79), Expect = 6.149e-13
Identity = 24/99 (24.24%), Postives = 37/99 (37.37%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKI-NPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            P  V+   ++   L    V++C   A P    EW  ++ +I N F    +EN                       +LT FN+   DYG+Y C     +G
Sbjct:  219 PPTVLEGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNGFDGIEIENSGAL------------------SKLTFFNVSEADYGNYTCIAINKLG 299          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ntm (neurotrimin [Source:NCBI gene;Acc:103040165])

HSP 1 Score: 58.5362 bits (140), Expect = 7.650e-13
Identity = 43/148 (29.05%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  454 LDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            L+ + F + IE +  SDEG + C++   +      V +IV+VP KI    K +I V + S + L+C ATGKP P + W  L    D                       S+ + L+I  + R   G Y C A N +  + ++  QL+V
Sbjct:   91 LNRDEFTIKIENVDMSDEGLFVCAVQTSSKPRTTSVHIIVQVPPKIVNFSKDLI-VNEGSNVSLMCLATGKPEPAISWRMLSPSGDGP--------------------GSDEEYLEIPSISRQRAGEYECTAVNDIATDTKT-VQLVV 216          

HSP 2 Score: 34.6538 bits (78), Expect = 7.650e-13
Identity = 24/99 (24.24%), Postives = 37/99 (37.37%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKI-NPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            P  V+   ++   L    V++C   A P    EW  ++ +I N F    +EN                       +LT FN+   DYG+Y C     +G
Sbjct:  219 PPTVLEGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNGFDGIEIENSGALS------------------KLTFFNVSEADYGNYTCIAINKLG 299          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ntm (neurotrimin [Source:NCBI gene;Acc:103040165])

HSP 1 Score: 58.151 bits (139), Expect = 7.857e-13
Identity = 43/148 (29.05%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  454 LDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            L+ + F + IE +  SDEG + C++   +      V +IV+VP KI    K +I V + S + L+C ATGKP P + W  L    D                       S+ + L+I  + R   G Y C A N +  + ++  QL+V
Sbjct:   91 LNRDEFTIKIENVDMSDEGLFVCAVQTSSKPRTTSVHIIVQVPPKIVNFSKDLI-VNEGSNVSLMCLATGKPEPAISWRMLSPSGDGP--------------------GSDEEYLEIPSISRQRAGEYECTAVNDIATDTKT-VQLVV 216          

HSP 2 Score: 35.039 bits (79), Expect = 7.857e-13
Identity = 24/99 (24.24%), Postives = 37/99 (37.37%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKI-NPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            P  V+   ++   L    V++C   A P    EW  ++ +I N F    +EN                       +LT FN+   DYG+Y C     +G
Sbjct:  219 PPTVLEGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNGFDGIEIENSGALS------------------KLTFFNVSEADYGNYTCIAINKLG 299          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ntm (neurotrimin [Source:NCBI gene;Acc:103040165])

HSP 1 Score: 58.151 bits (139), Expect = 7.996e-13
Identity = 43/148 (29.05%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  454 LDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            L+ + F + IE +  SDEG + C++   +      V +IV+VP KI    K +I V + S + L+C ATGKP P + W  L    D                       S+ + L+I  + R   G Y C A N +  + ++  QL+V
Sbjct:   91 LNRDEFTIKIENVDMSDEGLFVCAVQTSSKPRTTSVHIIVQVPPKIVNFSKDLI-VNEGSNVSLMCLATGKPEPAISWRMLSPSGDGP--------------------GSDEEYLEIPSISRQRAGEYECTAVNDIATDTKT-VQLVV 216          

HSP 2 Score: 35.039 bits (79), Expect = 7.996e-13
Identity = 24/99 (24.24%), Postives = 37/99 (37.37%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKI-NPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMG 1249
            P  V+   ++   L    V++C   A P    EW  ++ +I N F    +EN                       +LT FN+   DYG+Y C     +G
Sbjct:  219 PPTVLEGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNGFDGIEIENSGALS------------------KLTFFNVSEADYGNYTCIAINKLG 299          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: negr1 (neuronal growth regulator 1 [Source:NCBI gene;Acc:103032866])

HSP 1 Score: 63.5438 bits (153), Expect = 1.010e-10
Identity = 41/142 (28.87%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  457 DNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARS 879
            D + ++L I+ +  +DEG Y CS+  + +   K++ LIVKVP KIY  +   + V +   + L C A+GKP P + W  +   S  T                       G+ + I+ + RD  G Y C A N +  P+ R+
Sbjct:   97 DKHEYSLQIQKVDVTDEGLYTCSIQSERNPRPKLIQLIVKVPPKIY-DISSDVTVNEGGNISLFCLASGKPEPTITWKHISPSSKHTWT---------------------GENMNITAITRDAAGEYECGAGNDIASPDTRT 216          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 46.595 bits (109), Expect = 9.203e-8
Identity = 58/224 (25.89%), Postives = 88/224 (39.29%), Query Frame = 1
Query:  211 GFLILFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRC---SLVLKNDIIYKVVTLIVKVPAK-------IYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVAN 852
            G L+    ++  S +  F +  + VV         +C+IN + +      VTW K  R  LT        D R+ F   G+L        I G++  D G +RC   ++  +   +  ++T+   VPAK       +  P    + V Q + L+  C ATG P P V W  L     D   I     +E  Q      +   G ++ IS V     G Y C AN
Sbjct:   85 GLLLSRRARVLASTLPRFSQHPQPVVVEEGGVARFQCLINARPDPL----VTWEKN-RTALTED------DDRYTFLPSGVLQ-------ITGVRPEDSGYFRCIASNVAGRRRSMDALLTVTPAVPAKSSKDPVILSGPQNLTLTVHQTAILE--CIATGNPRPIVSWSRL-----DGRPI----GVEGIQ------VVGTGNLM-ISDVAVQHAGVYVCAAN 272          

HSP 2 Score: 26.9498 bits (58), Expect = 9.203e-8
Identity = 10/38 (26.32%), Postives = 16/38 (42.11%), Query Frame = 2
Query:  956 PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNN 1069
            PE +     + + L    V+ C    +P   + WLHN 
Sbjct:  292 PEFMQPPQSVTRSLGASAVLTCSAQGTPSPRIIWLHNG 329          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO49554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL8])

HSP 1 Score: 53.1434 bits (126), Expect = 1.924e-7
Identity = 53/192 (27.60%), Postives = 80/192 (41.67%), Query Frame = 1
Query:  367 WMKVPRRLLTRGI---YRVTPDTRF----RFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPP-----LKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKCK 906
            W ++P +   R I   YR T  TR     RF      +N+M++L I+  +  D G Y+C  V  ND       L + V  K+  P     +KP I V+   +        GKP PKV WY             +L   ++ Q +     +S    ++I R   +  G Y C A NK    +R KF + +K +
Sbjct:  394 WFEIPIQGYPRPIVEWYRGT--TRIKDGGRFTISESEENDMYSLVIDEARTEDSGPYKC--VASNDAGKTTALLNLDVNEKVVQPEFDKEVKP-IEVKHGEEATTSLEIKGKPKPKVTWYK---------DGKVLRESKNIQLKSIGDTYS----IRIVRTAPEDVGTYMCEATNKAGLASR-KFDITIKGR 566          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM31])

HSP 1 Score: 49.6766 bits (117), Expect = 5.469e-7
Identity = 48/169 (28.40%), Postives = 72/169 (42.60%), Query Frame = 1
Query:  358 NVTWMKVPRRLLTRG--IYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDII---YKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVA 849
             VTW+K  +  +  G  I +V+P                 NL I   +++D G Y+C  V  N +     +V T+ +K   +I    K ++ VE N+ L   C ATG P P VFW      S      P+ +    F       + S G+ L+IS V ++  G Y C A
Sbjct:   34 TVTWLKNTKAYVPDGVRIQKVSPG----------------NLVISIAQKADMGTYQC--VAANAVGRRKSRVATVTIKAKPEIIQRPKDVVIVEGNTAL-FTCKATGSPLPTVFWE---KKSKGQPMFPMQDYGRFF-------VSSNGE-LRISSVKKEDEGEYVCSA 172          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: zgc:110372 (igLON family member 5 [Source:NCBI gene;Acc:101170460])

HSP 1 Score: 62.7734 bits (151), Expect = 2.341e-10
Identity = 40/147 (27.21%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  457 DNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIV 897
            +N+ F++ I+ ++ +DEG Y C+    N      V LIV+VPA+I   +   + V +   + L C A G+P P V W                      + +++  + SEG+ L I+ + R     Y C+ NN V P  + K ++ V
Sbjct:   85 NNSDFSIHIDKVQVTDEGPYTCTFQANNQPRIAHVYLIVQVPARIVN-ISKNVSVNEGENVNLYCLAVGRPEPTVTW----------------------KDQKYGLV-SEGEFLDITEIKRQQDEEYECITNNGVAPPDQRKVKVTV 207          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: negr1 (neuronal growth regulator 1 [Source:NCBI gene;Acc:101174821])

HSP 1 Score: 61.6178 bits (148), Expect = 6.065e-10
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSL-PSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVA-NNKVEPEARS 879
            + D + ++L I+ +   D+G Y CS+  + +   K++ LIVKVP KIY  +   I V + S + L+C A+GKP P + W  + PS                         +  G+ L I+ + RD  G Y C A N+   P+ ++
Sbjct:   95 VRDKHEYSLQIQKVDVFDDGVYTCSIQSERNPRPKLLNLIVKVPPKIY-DISSDITVNEGSNVSLICTASGKPQPAISWRHITPSGKK----------------------YESGEYLNITGITRDQGGNYECSALNDIASPDTKT 216          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: negr1 (neuronal growth regulator 1 [Source:NCBI gene;Acc:101174821])

HSP 1 Score: 61.6178 bits (148), Expect = 6.065e-10
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSL-PSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVA-NNKVEPEARS 879
            + D + ++L I+ +   D+G Y CS+  + +   K++ LIVKVP KIY  +   I V + S + L+C A+GKP P + W  + PS                         +  G+ L I+ + RD  G Y C A N+   P+ ++
Sbjct:   95 VRDKHEYSLQIQKVDVFDDGVYTCSIQSERNPRPKLLNLIVKVPPKIY-DISSDITVNEGSNVSLICTASGKPQPAISWRHITPSGKK----------------------YESGEYLNITGITRDQGGNYECSALNDIASPDTKT 216          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: negr1 (neuronal growth regulator 1 [Source:NCBI gene;Acc:101174821])

HSP 1 Score: 61.2326 bits (147), Expect = 7.512e-10
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  451 ILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSL-PSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVA-NNKVEPEARS 879
            + D + ++L I+ +   D+G Y CS+  + +   K++ LIVKVP KIY  +   I V + S + L+C A+GKP P + W  + PS                         +  G+ L I+ + RD  G Y C A N+   P+ ++
Sbjct:   95 VRDKHEYSLQIQKVDVFDDGVYTCSIQSERNPRPKLLNLIVKVPPKIY-DISSDITVNEGSNVSLICTASGKPQPAISWRHITPSGKK----------------------YESGEYLNITGITRDQGGNYECSALNDIASPDTKT 216          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: opcml (opioid-binding protein/cell adhesion molecule [Source:NCBI gene;Acc:101165039])

HSP 1 Score: 59.3066 bits (142), Expect = 3.271e-9
Identity = 56/235 (23.83%), Postives = 102/235 (43.40%), Query Frame = 1
Query:  187 LTTVILISGFLILFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNM---FNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKV-EPEARS 879
            L  V++  G  +     + K NI   ++Q ++ V        LKC ++ K++   + N T       +L  G  + + D R       +L+N     +++ I+ +   DEG Y CS++         V L V+VPA+I    K +  V +   + L+C A G+P   V W                    H       T  +EGQ L+++ + ++ +G Y C+A+N + +P+ R+
Sbjct:   13 LFAVLVFPGVPVRSGDSVLKDNIA--VRQGDSAV--------LKCSVDSKVSRVAWLNRT------TILFAGKEKWSLDPRVI-----LLENTAVTEYSIKIQNVNVHDEGPYVCSILTNKKPKSTKVHLFVQVPARITNITKDVT-VNEGRSISLICLAVGRPEASVVW-------------------RHHSPRGIYTFVAEGQHLELAEITKEQSGSYECIASNDISDPDIRT 206          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067482.1 (SMESG000067482.1)

HSP 1 Score: 464.922 bits (1195), Expect = 0.000e+0
Identity = 226/230 (98.26%), Postives = 226/230 (98.26%), Query Frame = 1
Query:  217 LILFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKCK 906
            L LF  KISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK K
Sbjct:    2 LTLFRNKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKFK 231          

HSP 2 Score: 285.419 bits (729), Expect = 0.000e+0
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 2
Query:  953 KPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEE 1354
            KPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEE
Sbjct:  231 KPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEE 364          

HSP 3 Score: 98.9821 bits (245), Expect = 3.175e-22
Identity = 53/71 (74.65%), Postives = 55/71 (77.46%), Query Frame = 1
Query: 1306 SKTNIYGRHFF-------QAN*RSKVILSTPSFPIPQFQKLLTEFSTVSSGYTKFTFEDLYSTLLLFYYIF 1497
             K +IY +  F       Q    SKVILSTPSFPIPQFQKLLTEFSTVSSGYTKFTFEDLYSTLLLFYYIF
Sbjct:  343 EKNSIYPKQIFMEDISFKQIEEESKVILSTPSFPIPQFQKLLTEFSTVSSGYTKFTFEDLYSTLLLFYYIF 413          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067482.1 (SMESG000067482.1)

HSP 1 Score: 462.996 bits (1190), Expect = 0.000e+0
Identity = 225/228 (98.68%), Postives = 225/228 (98.68%), Query Frame = 1
Query:  223 LFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKCK 906
            LF  KISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVK K
Sbjct:   20 LFRNKISKSNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKFK 247          

HSP 2 Score: 285.804 bits (730), Expect = 0.000e+0
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 2
Query:  953 KPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEE 1354
            KPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEE
Sbjct:  247 KPEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKLKQSEYEKNSIYPKQIFMEDISFKQIEE 380          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000012554.1 (SMESG000012554.1)

HSP 1 Score: 111.309 bits (277), Expect = 3.065e-28
Identity = 61/167 (36.53%), Postives = 89/167 (53.29%), Query Frame = 1
Query:  358 NVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVH-----RDMTGFYAC 843
            N++W+K PR++LTRG YRVT + RF      IL+   FNL I  +   DEG+YRC+ +    I  K VTL+V VP KI      ++ V++++K++L C A GKP P + WY +     +    PI  AL  F  E    +    +M  ISR++     +   G Y C
Sbjct:    2 NISWIKSPRQILTRGFYRVTENNRFHPQSPAILNTQSFNLKISPVLIEDEGQYRCNFIFGRKIYVKEVTLVVHVPPKITKHPAALVKVDEDNKIKLTCQAFGKPQPNISWYLVTYPIGEMKLTPIHFALGGFDTEEQRPVSETNEMKVISRLNLINLAKPDYGIYTC 168          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000029293.1 (SMESG000029293.1)

HSP 1 Score: 110.923 bits (276), Expect = 1.775e-27
Identity = 61/167 (36.53%), Postives = 89/167 (53.29%), Query Frame = 1
Query:  358 NVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVH-----RDMTGFYAC 843
            N++W+K PR++LTRG YRVT + RF      IL+   FNL I  +   DEG+YRC+ +    I  K VTL+V VP KI      ++ V++++K++L C A GKP P + WY +     +    PI  AL  F  E    +    +M  ISR++     +   G Y C
Sbjct:    2 NISWIKSPRQILTRGFYRVTENNRFHPQSPAILNTQSFNLKISPVLIEDEGQYRCNFIFGRKIYVKEVTLVVHVPPKITKHPAALVKVDEDNKIKLTCQAFGKPQPNISWYLVTYPIGEMKLTPIHFALGGFDTEEQRPVSETNEMKVISRLNLINLAKPDYGIYTC 168          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006452.1 (SMESG000006452.1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.662e-19
Identity = 63/222 (28.38%), Postives = 107/222 (48.20%), Query Frame = 1
Query:  247 SNIHYFIKQSETVVQVIDKNVELKCMINIKLNLTDYNN--VTWM-KVPRRLLTRGIYRVTPDTRFRFNFQGILDNN--MFNLFIEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYP--PLKPIIYVEQNSKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIHSEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQL 891
            +N+H   K+ E V+ +++K+V L C + + L      N  + W  K+ ++ LT     +T D RF      I  +N  +  L I+ +K +D+GEY C    +  I  K V L V VPA I P    +  + V++  K+ + CN+ G P P + WY+   +         LNA  +  ++     ++   +  +SR+H    G Y C+ +NKVE +    F+L
Sbjct:   82 TNVHK--KKWELVIGIVNKSVSLPCRLEVSLKNPLNLNNNIVWRRKMDKQYLTFQHQLLTKDKRFSLK---IYQSNYVLMELKIDNLKITDDGEYECLYSTEKYIDRKTVKLRVLVPAVILPTGTSQDHLIVKEREKVIISCNSYGIPSPNISWYANWKNG--------LNARLYNNKKDIFVNYNTVTIFNVSRIH---NGSYTCIVDNKVEGKQSKSFKL 287          

HSP 2 Score: 43.8986 bits (102), Expect = 2.662e-19
Identity = 31/120 (25.83%), Postives = 58/120 (48.33%), Query Frame = 2
Query:  932 KNKSFPVK----PEIVMTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKIN--PFLCAPLENRSLKYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLTKL 1273
            ++KSF ++    P I M N  I Q    +T+I+ ++   P+ +++W  N++ +N     C  +  R+ KYC   ++  H         +L I+NL   D+  Y   + +  G  +G TK+
Sbjct:  281 QSKSFKLEIWYEPSIKMGNDVIEQSQGRETMIQAIINGHPINSIQWEKNSKILNLSANKCFYI-GRTKKYCFYLDKTGH---FQEQKAQLWIYNLSAIDFTSYRLLIVSPFGNIFGTTKI 396          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IGLON52.314e-1128.79IgLON family member 5 [Source:HGNC Symbol;Acc:HGNC... [more]
OPCML2.177e-930.66opioid binding protein/cell adhesion molecule like... [more]
OPCML3.351e-930.66opioid binding protein/cell adhesion molecule like... [more]
OPCML3.444e-925.93opioid binding protein/cell adhesion molecule like... [more]
OPCML3.444e-925.93opioid binding protein/cell adhesion molecule like... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rig-54.191e-1024.69NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-54.886e-1024.69NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-54.898e-1024.69NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
rig-53.657e-925.00NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
him-45.580e-726.92High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIP-theta3.363e-1525.78gene:FBgn0051646 transcript:FBtr0079114[more]
DIP-beta3.814e-1527.10gene:FBgn0259245 transcript:FBtr0343091[more]
klg1.845e-1422.77gene:FBgn0017590 transcript:FBtr0084337[more]
DIP-beta2.664e-1428.18gene:FBgn0259245 transcript:FBtr0299901[more]
DIP-beta2.664e-1428.18gene:FBgn0259245 transcript:FBtr0299898[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
negr14.802e-1325.60neuronal growth regulator 1 [Source:ZFIN;Acc:ZDB-G... [more]
opcml3.652e-1123.63opioid binding protein/cell adhesion molecule-like... [more]
IGLON53.185e-926.13zgc:110372 [Source:ZFIN;Acc:ZDB-GENE-050417-297][more]
IGLON54.469e-926.13zgc:110372 [Source:ZFIN;Acc:ZDB-GENE-050417-297][more]
ncam1a7.170e-930.13neural cell adhesion molecule 1a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
carhsp11.404e-1227.05calcium regulated heat stable protein 1 [Source:Xe... [more]
pllp2.457e-1126.90plasmolipin [Source:Xenbase;Acc:XB-GENE-6036173][more]
pllp2.625e-1126.90plasmolipin [Source:Xenbase;Acc:XB-GENE-6036173][more]
lsamp5.383e-1123.58limbic system associated membrane protein [Source:... [more]
lsamp8.764e-1129.25limbic system associated membrane protein [Source:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ncam15.893e-1232.48neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam16.624e-1232.48neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam16.649e-1232.48neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam16.758e-1232.48neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Iglon51.662e-1128.79IgLON family member 5 [Source:MGI Symbol;Acc:MGI:2... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26474|LACH_SCHAM3.513e-1326.85Lachesin OS=Schistocerca americana OX=7009 GN=LAC ... [more]
sp|Q24372|LACH_DROME2.629e-1126.05Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac... [more]
sp|P13596|NCAM1_RAT3.604e-1132.48Neural cell adhesion molecule 1 OS=Rattus norvegic... [more]
sp|P13595|NCAM1_MOUSE4.176e-1132.48Neural cell adhesion molecule 1 OS=Mus musculus OX... [more]
sp|P31836|NCAM1_BOVIN8.337e-1132.70Neural cell adhesion molecule 1 OS=Bos taurus OX=9... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RRX95.500e-4733.33Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4S2ME046.497e-4734.23Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0RBU51.023e-4534.26IgLON family member 5 OS=Fasciola hepatica OX=6192... [more]
A0A094ZZ251.402e-4535.50IgLON family member 5 OS=Schistosoma haematobium O... [more]
A0A504ZCU91.587e-4534.26IgLON family member 5 OS=Fasciola gigantica OX=468... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntm6.149e-1329.05neurotrimin [Source:NCBI gene;Acc:103040165][more]
ntm7.650e-1329.05neurotrimin [Source:NCBI gene;Acc:103040165][more]
ntm7.857e-1329.05neurotrimin [Source:NCBI gene;Acc:103040165][more]
ntm7.996e-1329.05neurotrimin [Source:NCBI gene;Acc:103040165][more]
negr11.010e-1028.87neuronal growth regulator 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
igdcc39.203e-825.89immunoglobulin superfamily, DCC subclass, member 3... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO495541.924e-727.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352405.469e-728.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1103722.341e-1027.21igLON family member 5 [Source:NCBI gene;Acc:101170... [more]
negr16.065e-1028.97neuronal growth regulator 1 [Source:NCBI gene;Acc:... [more]
negr16.065e-1028.97neuronal growth regulator 1 [Source:NCBI gene;Acc:... [more]
negr17.512e-1028.97neuronal growth regulator 1 [Source:NCBI gene;Acc:... [more]
opcml3.271e-923.83opioid-binding protein/cell adhesion molecule [Sou... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067482.13.175e-2298.26SMESG000067482.1[more]
SMESG000067482.10.000e+098.68SMESG000067482.1[more]
SMESG000012554.13.065e-2836.53SMESG000012554.1[more]
SMESG000029293.11.775e-2736.53SMESG000029293.1[more]
SMESG000006452.12.662e-1928.38SMESG000006452.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029856 ID=SMED30029856|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1498bp
TCTTTTGCAATTAAATCTTTTCTAGGAGGTTCTTTGAGATTTTCTTGGAT
GTAAATGGTTAGTGAATAATAACAATTTTATTTGGTTGAGACCTTTTCAA
ATCTTCGAATTCATGGCCATCCTTTTTGTGTAGAATCGAACGTTTAGTAC
ATACCAAATATTTAATGTTTCAAAGTTGAAATGCCTTTAACCACAGTCAT
ATTGATAAGTGGATTTTTAATACTCTTTGAAATAAAAATATCCAAATCGA
ATATTCATTATTTTATCAAACAATCGGAAACGGTGGTTCAAGTCATCGAC
AAGAATGTCGAATTAAAATGCATGATCAACATCAAACTTAATTTAACGGA
TTACAATAATGTCACTTGGATGAAAGTACCAAGAAGACTTTTAACAAGAG
GAATCTATCGAGTTACTCCAGATACACGCTTTCGGTTCAACTTTCAAGGA
ATTCTTGACAATAATATGTTTAATTTATTTATTGAAGGCATCAAAGAATC
CGATGAAGGAGAATATAGATGTAGTTTAGTTCTCAAAAATGATATCATTT
ATAAAGTAGTAACTTTAATAGTAAAAGTACCAGCAAAAATTTATCCTCCT
TTAAAGCCGATAATTTACGTTGAACAGAATAGCAAATTGCAGTTAGTCTG
CAATGCAACTGGGAAACCATTTCCTAAAGTTTTTTGGTATTCTCTTCCTT
CTGATTCGGACGACACCACAAAAATACCTATTTTAAATGCGTTGGAACAT
TTTCAACAAGAAAGATTTAGTACAATCCACAGTGAAGGTCAGATGTTGCA
AATATCAAGAGTGCATCGAGATATGACAGGCTTTTACGCGTGCGTTGCCA
ATAACAAAGTAGAACCGGAAGCCCGGTCTAAATTTCAGTTAATTGTTAAA
TGCAAGAATTTGAATTTCTTTTTCATTTAATAAAAACAAATCGTTTCCAG
TTAAACCGGAAATTGTGATGACAAACTCGGAAATTCATCAGCGGTTAAAA
GGAGATACAGTAATTGAATGTGTTGTTTTAGCATCTCCCATGGGGGCAGT
TGAGTGGCTTCATAACAATGAAAAAATAAATCCGTTTCTGTGTGCACCCT
TAGAAAATAGATCTTTAAAATATTGTTTGGTTACCAACCGAGATGAGCAC
CATTATGTTTTAAATCCTATATCAGTAAGGTTGACTATTTTCAATCTGCA
AAGGCAAGATTATGGAGATTACGTTTGTCAAATGAGAACAAGTATGGGAA
TGGGCTACGGACTGACAAAACTAAAACAATCTGAATATGAGAAAAATTCC
ATTTATCCAAAACAAATATTTATGGAAGACATTTCTTTCAAGCAAATTGA
AGAAGTAAAGTTATTTTATCAACCCCGTCGTTTCCAATTCCACAATTCCA
AAAACTTTTAACAGAATTCTCCACTGTTTCTTCTGGATATACCAAATTTA
CATTTGAGGATTTATATTCGACATTGTTATTATTTTATTATATTTTCG
back to top

protein sequence of SMED30029856-orf-1

>SMED30029856-orf-1 ID=SMED30029856-orf-1|Name=SMED30029856-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=250bp
MPLTTVILISGFLILFEIKISKSNIHYFIKQSETVVQVIDKNVELKCMIN
IKLNLTDYNNVTWMKVPRRLLTRGIYRVTPDTRFRFNFQGILDNNMFNLF
IEGIKESDEGEYRCSLVLKNDIIYKVVTLIVKVPAKIYPPLKPIIYVEQN
SKLQLVCNATGKPFPKVFWYSLPSDSDDTTKIPILNALEHFQQERFSTIH
SEGQMLQISRVHRDMTGFYACVANNKVEPEARSKFQLIVKCKNLNFFFI*
back to top

protein sequence of SMED30029856-orf-2

>SMED30029856-orf-2 ID=SMED30029856-orf-2|Name=SMED30029856-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MTNSEIHQRLKGDTVIECVVLASPMGAVEWLHNNEKINPFLCAPLENRSL
KYCLVTNRDEHHYVLNPISVRLTIFNLQRQDYGDYVCQMRTSMGMGYGLT
KLKQSEYEKNSIYPKQIFMEDISFKQIEEVKLFYQPRRFQFHNSKNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013106Ig_V-set
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005104fibroblast growth factor receptor binding
GO:0008092cytoskeletal protein binding
GO:0008201heparin binding
GO:0019902phosphatase binding
GO:0030275LRR domain binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030426growth cone
GO:0043025neuronal cell body
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007411axon guidance
GO:0007413axonal fasciculation
GO:0007568aging
GO:0007611learning or memory
GO:0010035response to inorganic substance
GO:0010288response to lead ion
GO:0014012peripheral nervous system axon regeneration
GO:0014823response to activity
GO:0016338calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules
GO:0021794thalamus development
GO:0031100animal organ regeneration
GO:0033555multicellular organismal response to stress
GO:0042220response to cocaine
GO:0042493response to drug
GO:0048666neuron development
GO:0051930regulation of sensory perception of pain
GO:0060045positive regulation of cardiac muscle cell proliferation
GO:0060548negative regulation of cell death
GO:0071219cellular response to molecule of bacterial origin
GO:0071241cellular response to inorganic substance
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 95..193
e-value: 1.9E-7
score: 40.8
coord: 26..85
e-value: 18.0
score: 9.3
NoneNo IPR availablePFAMPF13927Ig_3coord: 95..178
e-value: 8.9E-10
score: 39.0
NoneNo IPR availablePANTHERPTHR12231:SF105coord: 12..192
NoneNo IPR availablePANTHERPTHR12231CTX-RELATED TYPE I TRANSMEMBRANE PROTEINcoord: 12..192
NoneNo IPR availableCDDcd00096Igcoord: 106..186
e-value: 6.15494E-7
score: 43.3849
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 88..199
e-value: 1.6E-13
score: 52.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 2..87
e-value: 3.3E-9
score: 38.7
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 92..191
score: 9.264
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 79..192
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 12..90