slc24a-5

Overview
Nameslc24a-5 (AKN21565.1)
Smed IDSMED30029849
Length (bp)2128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc24a-5 (SMED30029849) t-SNE clustered cells

Violin plots show distribution of expression levels for slc24a-5 (SMED30029849) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc24a-5 (SMED30029849) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc24a-5 (SMED30029849) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029849

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30029849SMESG000022809.1 slc24a-5smed_ncbi_20200123PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029849SMESG000054424.1 Contig1756GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029849SMESG000022809.1 PL05007B1C09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029849SMESG000022809.1 Contig1756GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029849SMESG000022809.1 dd_Smed_v4_1009_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029849SMESG000022809.1 dd_Smed_v4_1009_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30029849SMESG000022809.1 dd_Smed_v4_9846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029849SMESG000022809.1 dd_Smed_v4_9846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30029849SMESG000054424.1 Contig1756GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029849SMESG000022809.1 Contig1756GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
proximal tubuleSMED30029849SMESG000022809.1 Smed-slc24a-5smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc24a-5 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 161.77 bits (408), Expect = 5.867e-43
Identity = 81/195 (41.54%), Postives = 126/195 (64.62%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVL--IIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGL 1862
            P+++ +W+ +S + K L V + P+ F+L LT+PVV+ ++  + W + LNCLH ++SPL+ +  ++     +   G ++   V+  I G   A      +  + PP  + LFAF+GFLTS  WI A A E+VNIL + GVV  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL
Sbjct:  181 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 375          

HSP 2 Score: 70.8626 bits (172), Expect = 2.711e-12
Identity = 61/163 (37.42%), Postives = 92/163 (56.44%), Query Frame = 3
Query:  279 LRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL-----TTQE---DTQHKKDESGSN-IQYSRENR 737
            L++S N+AGVT LA GNGA D+FS+L   ++ S P+ +      L GAG+LV TV AG I I+ PF    RP  +D++FY++A+     +L R ++ L  ++ +L +YV YV    +   IY +Q+RG L      T E   D++  +  S +N   Y  E R
Sbjct:    3 LKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYR 162          
BLAST of slc24a-5 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 162.155 bits (409), Expect = 4.003e-42
Identity = 95/254 (37.40%), Postives = 157/254 (61.81%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVL--IIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANAR-YGKIKVELKSEXX-XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P+++ +W+ +S + K L V + P+ F+L LT+PVV+ ++  + W + LNCLH ++SPL+ +  ++     +   G ++   V+  I G   A      +  + PP  + LFAF+GFLTS  WI A A E+VNIL + GVV  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +  +R + ++K+E     + VL   + L  + +L+ +P+  F+L  VYG  +++ Y
Sbjct:  255 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFY 508          

HSP 2 Score: 67.3958 bits (163), Expect = 4.821e-11
Identity = 39/96 (40.62%), Postives = 56/96 (58.33%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA 362
            C+++     C  D G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A
Sbjct:   65 CDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVA 160          
BLAST of slc24a-5 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 161.77 bits (408), Expect = 1.271e-41
Identity = 95/254 (37.40%), Postives = 157/254 (61.81%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVL--IIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANAR-YGKIKVELKSEXX-XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P+++ +W+ +S + K L V + P+ F+L LT+PVV+ ++  + W + LNCLH ++SPL+ +  ++     +   G ++   V+  I G   A      +  + PP  + LFAF+GFLTS  WI A A E+VNIL + GVV  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +  +R + ++K+E     + VL   + L  + +L+ +P+  F+L  VYG  +++ Y
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFY 564          

HSP 2 Score: 97.4413 bits (241), Expect = 2.005e-20
Identity = 82/231 (35.50%), Postives = 125/231 (54.11%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL-----TTQE---DTQHKKDESGSN-IQYSRENR 737
            C+++     C  D G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P+ +      L GAG+LV TV AG I I+ PF    RP  +D++FY++A+     +L R ++ L  ++ +L +YV YV    +   IY +Q+RG L      T E   D++  +  S +N   Y  E R
Sbjct:   65 CDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYR 292          
BLAST of slc24a-5 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 161.77 bits (408), Expect = 1.271e-41
Identity = 95/254 (37.40%), Postives = 157/254 (61.81%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVL--IIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANAR-YGKIKVELKSEXX-XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P+++ +W+ +S + K L V + P+ F+L LT+PVV+ ++  + W + LNCLH ++SPL+ +  ++     +   G ++   V+  I G   A      +  + PP  + LFAF+GFLTS  WI A A E+VNIL + GVV  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +  +R + ++K+E     + VL   + L  + +L+ +P+  F+L  VYG  +++ Y
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFY 564          

HSP 2 Score: 97.4413 bits (241), Expect = 2.005e-20
Identity = 82/231 (35.50%), Postives = 125/231 (54.11%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL-----TTQE---DTQHKKDESGSN-IQYSRENR 737
            C+++     C  D G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P+ +      L GAG+LV TV AG I I+ PF    RP  +D++FY++A+     +L R ++ L  ++ +L +YV YV    +   IY +Q+RG L      T E   D++  +  S +N   Y  E R
Sbjct:   65 CDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYR 292          
BLAST of slc24a-5 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 91.6633 bits (226), Expect = 3.626e-20
Identity = 63/166 (37.95%), Postives = 95/166 (57.23%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIEL 569
            C+++     C  D G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P+ +      L GAG+LV TV AG I I+ PF    RP  +D++FY++A+     +L R ++ L
Sbjct:   65 CDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTL 227          
BLAST of slc24a-5 vs. Ensembl Celegans
Match: ncx-8 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16241])

HSP 1 Score: 204.142 bits (518), Expect = 4.126e-56
Identity = 186/635 (29.29%), Postives = 313/635 (49.29%), Query Frame = 3
Query:   45 CNPKNKTFNESFCNYV-INRGSCSFDSGFINYFQWQFCGFD--NRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIR-RQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKK-NMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVD---STLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPL------GSQGFILIHLVLIIGVCAAISAAITSKANAPPEYY-SLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKV 1904
            C       +E  C Y+  N+ SC    G++ +  +  C ++   R++  I+  ++ + L + ++  AD FF P +  +   L+MS+++AGVT LA GNGA DVF S+S+V+ST  P  +LALG + G  I V TV   II+    F V   P ++DLIFY++ L +  F  ++  +IE+W    FL IY +Y+           ++K  K   Q +++   + + S  +    N      +E      S+ +                   LS    +  R+ +I SI N+  G +      NE   E L+A +  + R R +SL           R + +  D E++K + + E  + + +E +       + +  +Q+  ++ +     L T    D  ++        L  H  +K  P + EE+ E ++F K++ +I+    F + +TIP  E       WCK L  LHC  S    I F  FS   +      GS G  L  L        A+ A      N   +Y+  +++++GFL SI WIYA ANEI++++   GVV  + Q +LGLT++++++ IGD+V++I + ++ +P++A AA IGGPLFNLL+G GLPF+IA+A+  +I +
Sbjct:   58 CELHKGWTSEEKCAYIKCNQDSCE-GGGYLTWSHYVKCQYNIGARVVLIIVGIIYLIFLFVVMSTIADDFFCPSISGIVTHLKMSESIAGVTFLAFGNGAPDVFGSISSVLSTPKPKAALALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMITLAFITFCFLKFDKIEVWMPATFLGIYAVYLLTVIAFSIYRTRRKNLKKKKQLESEKDDESAISRPESVASNMPICEKLEKKTESMSVSTLFHVMV------------GLSRFMKKLNRTNKIQSIENKKQGFV------NEGFSESLDADELTLKRNRMISLIF---------RNKTLDTDLESMKTLDEMESSDDEGREEEFAYAHHTVFTSHDQMSLAATEFEFRELTTWRSRDWIID--------LLYH--LKPWP-SREEFSEMNIFVKIIMIIRIIPSFFMKMTIPSNE-----MSWCKPLFLLHCFAS----IQFALFSIQIINLKPFDGSPGLWLYGLAF--SATIALLALCFLPLNKELKYHKEVYSYLGFLMSIAWIYATANEIISVMTMVGVVTGLSQELLGLTVMSWSDCIGDIVADIAVIKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIASAQGKQIDL 642          
BLAST of slc24a-5 vs. Ensembl Celegans
Match: ncx-7 (Putative sodium/calcium exchanger 7 [Source:UniProtKB/Swiss-Prot;Acc:P34322])

HSP 1 Score: 149.058 bits (375), Expect = 2.376e-37
Identity = 92/249 (36.95%), Postives = 148/249 (59.44%), Query Frame = 3
Query: 1296 EEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKF-SAVPL-GSQGFILIHLVLIIGVCAAISAAITSKANAPPEYY-SLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            E+W+E ++FSKV++ I      +  LTIP+ E       W K L  LH    P   +  I+F    P  GS G  +  L   + +  AI   + ++ +  P+YY  ++++ GF+ SI WIY I++E+VN++   GVV  +   +LGLTILA++NSIGDL++++ + ++ +PR+A AA IGGPLFNLL+G GLPF+IA  +   I + +     +LI  + +  +  LI +PV +FRL+  +  ++I IY
Sbjct:  413 EDWEEMNIFSKVMAYINVVPNLLFKLTIPLNE-----MSWSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLA--VSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLATLIGIPVQKFRLQRPHAAVLISIY 654          

HSP 2 Score: 93.9745 bits (232), Expect = 1.007e-19
Identity = 83/245 (33.88%), Postives = 135/245 (55.10%), Query Frame = 3
Query:   39 ESCNPKNKTFNESFCNYV-INRGSCSFDSGFINYFQWQFCGFD--NRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILI-RRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEP 761
            E C        E  C+YV  N  +C    G++ + Q+  C     +R+I  I+  ++ LVL + V+  AD FF+P +  +   LR+S+++AGVT +A GNGA DVF S+++V+S+ +P   LALG + G G+ V T+    I++  PFDV     I+DL+FYL+AL +  F  +   ++ LW  + FL +Y++YV     ++A++  +KR  L  Q  T+ +K         S  +R  I+ V P
Sbjct:   42 EKCELNKTWTQEQVCDYVNCNDNACE-GGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVH-NRKRKALQKQNSTKSRKSIK------SLRSRKSIHSVAP 278          
BLAST of slc24a-5 vs. Ensembl Celegans
Match: ncx-6 (Putative sodium/calcium exchanger 6 [Source:UniProtKB/Swiss-Prot;Acc:P34315])

HSP 1 Score: 147.902 bits (372), Expect = 3.230e-37
Identity = 94/277 (33.94%), Postives = 157/277 (56.68%), Query Frame = 3
Query: 1083 KKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQ------FPGLFKHFLMKIIPI-NFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAV-PL-GSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANAR 1886
             + +K+  K+ E ++     + + +++ I  S     LH      ++ E + V+      F G+   F   + P  + +EW E ++F KV++V+ +   F+  LTIP  E+      W K +  L C++ P+  +  I+  ++ P   S G  +  L+L + + AA+    T     PP Y SL ++ GFL SI WIY I++E+VN++   GVV  +   +LGLTILA++NSIGDL++++ +A++ +PR+A AA IGG LFNLL+G GLPF+IA  +
Sbjct:  255 NRHKKDEEKVDEVKTVD--TDSLEDDDDIYVSHGHHVLHAHEVMKMEAEIEAVEPLKTWSFRGVVHDFKEHLKPWPSMDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAV-LFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQ 523          

HSP 2 Score: 72.4034 bits (176), Expect = 5.264e-13
Identity = 61/182 (33.52%), Postives = 100/182 (54.95%), Query Frame = 3
Query:   39 ESCNPKNKTFNESFCNYV-INRGSCSFDSGFINYFQWQFCGFDN--RIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILI-RRQIELW 572
            E C  +    +   C YV  N  +C    G++ + ++  C      RII  I   ++ LVL + V+  AD FF+P +  +   LR+S+++AGVT +A GNGA DVF ++++V+S+ +P   LALG + GAG+ V T+   + +   PF       I+D+ FYL+AL +  F  +    +E+W
Sbjct:   51 EQCTIQAGWNSTQVCEYVKCNDDNCE-GGGYVLWTRYVECASSPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIW 231          
BLAST of slc24a-5 vs. Ensembl Celegans
Match: ncx-9 (Mitochondrial sodium/calcium exchanger protein [Source:UniProtKB/Swiss-Prot;Acc:O16242])

HSP 1 Score: 135.576 bits (340), Expect = 6.234e-33
Identity = 101/333 (30.33%), Postives = 176/333 (52.85%), Query Frame = 3
Query: 1059 DQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQ--FPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPL------GSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            D E+L+ +   +  + + +E +       + +  +QI       +L  S   +I++ T         LF H  +K  P   +E+ E ++F K+++VI+   +F   LT+P  E       WCK L  LHC  S    I F  FS   +      GS G  L  L     + A ++      +     Y  +++++GFL SI WIYA +NEIV+++   GVV  +   +LGLTI+A++N IGD+V++I + ++ +P++A AA IGGPLFNLL+G GLPF+IA A+  ++++ +     +L+  + +  +   + L + RF +R  + +++I I+
Sbjct:  371 DLESLESLADLDGSDDEGREEKFGYAHHTVFTSHDQI-------SLVASEIEEIEITTWRSWDWVWDLFNH--LKSWPSR-DEFSEMNIFIKIVTVIKVVPVFFFKLTVPSNE-----MSWCKPLFILHCFAS----IQFALFSIQIITLKPFDGSPGLWLYGLGFS-AILAMVAMYFLPLSKEQKYYKEIYSYLGFLMSIAWIYATSNEIVSVVTMIGVVTGLSMELLGLTIMAWSNCIGDIVADIAVVKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIAAAQGKEMELLINPVYRLLMLFLGISLVTTFVALFIQRFTVRRPHAVLLIFIF 683          

HSP 2 Score: 83.9593 bits (206), Expect = 1.505e-16
Identity = 68/182 (37.36%), Postives = 104/182 (57.14%), Query Frame = 3
Query:   39 ESCNPKNKTFNESFCNYV-INRGSCSFDSGFINYFQWQFCGFD--NRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIR-RQIELW 572
            E C       +E  C Y+  N+ SC    G++ +  +  C ++   R+I  IL  L+ ++L + ++  AD FF P +  +   LRMS+++AGVT LA GNGA DVFSS+S+V++T  P   LALG + G  I V TV   II+    F V   P ++DLIFY+  L + +F  ++  +IE+W
Sbjct:   55 EECLIDKSWTSEEKCEYIKCNQDSCE-GGGYLTWSHYVKCQYNIGVRVILIILGILYLIILFVIMSSIADDFFCPAISGIVSHLRMSESIAGVTFLAFGNGAPDVFSSISSVLTTPKPKADLALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMTTLAFIVFCFLKFDKIEVW 235          
BLAST of slc24a-5 vs. Ensembl Celegans
Match: ncx-10 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q965R5])

HSP 1 Score: 115.161 bits (287), Expect = 1.115e-26
Identity = 98/361 (27.15%), Postives = 182/361 (50.42%), Query Frame = 3
Query: 1032 NNRKRFISLDQENLKE--IKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVET-------KDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSA-VPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLF-----------------NLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            NN K F+   +++L++  + +T  +     EF               + KS  +++L  +   +I  +T       +DV+      H  ++  P N +E+ E + FS+ ++V+     F L LTIP  E       W K +  +HC  S  + +  ++ SA  P      + ++ +LI  + + ++   T        Y  +++++GFL SI WIY I++EI+N++   GV   + Q ILGLTI+A++N IGD+VS++ + ++ FP++A AA IGGPLF                 +LL+G GLPF+IA  +  +I + +     +L+  + +    +LI + V RF++R  + + ++ ++
Sbjct:  195 NNVKNFLDGKEDSLEDGLVDETSDDEGVEAEFHY---------AHRHVYKSYDEASLAFTDVEEIQPKTWKSWEWVRDVR-----NH--LRPWPGN-DEFYEMNYFSRFITVVAVIPTFFLKLTIPSNEMP-----WSKPILIIHCFCSIQLALFAVQISAKSPFHGSPGLWLYGLLISIILSLLALRFTPLDREQKYYREVYSYLGFLMSIAWIYTISSEIINVITMIGVATGVSQEILGLTIMAWSNCIGDIVSDVAVVKQGFPKMAMAAAIGGPLFSKLYSRPCQIKITTYISDLLIGFGLPFTIACLQGKQIDLIITPVYRLLMLFLAISLFTSLIAIFVQRFKVRWPHAVALLTVF 533          

HSP 2 Score: 73.559 bits (179), Expect = 2.508e-13
Identity = 56/160 (35.00%), Postives = 92/160 (57.50%), Query Frame = 3
Query:  237 DSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLA-LLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSN 713
            D FF+P +  + + L++S+++AGVT LA GNGA DVF S+++VI+T  P   LA+G I+G GI V TV    I++   F +     I+D++F+++A +   ++ L    +E+W  + FL +Y  YV    + R   +  KR K    E  ++ + ES  N
Sbjct:    6 DDFFSPSIAGIVRHLKISESIAGVTFLAFGNGAPDVFGSIASVITTPKPKADLAIGDIIGGGIFVTTVVLSAIILTKSFRIAILATIRDIVFFIIADIFLAIWFLTFNHVEIWMPLTFLGLYAAYVVSVILMR---LNSKRRKRARHEKIENARKESAMN 162          
BLAST of slc24a-5 vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0088706)

HSP 1 Score: 126.331 bits (316), Expect = 6.101e-30
Identity = 92/316 (29.11%), Postives = 147/316 (46.52%), Query Frame = 3
Query: 1038 RKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFP----------GLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIK---------FSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVG----------IGLPFSIAN--ARYG 1892
            RKR   L++      +  E E   I E  +  P IN I            +TL     + I ++ K  +            GLFK   + + PIN E+W++ ++  +   + + P + I  + IP+V+ E    GW KLLNC+  +L+P + I  IK            V +G +    ++  L I V  A+   I S+ + PP Y+S+F  +    S+F I+  A EI  +LE  G +L +    +G T+ A   S+G L++N+ +A   +PR+AYA+ IGGP F +++            GLP S AN    YG
Sbjct:  248 RKRLSELERNQAIYTRDMEVE---IFERTNSGPNINKIRY----------TTLRMGRSTRISLDRKATRMVLHNRALGRNWGLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMY-SLPITVPIAVFMFIQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFGLPVSEANQTGNYG 549          

HSP 2 Score: 54.299 bits (129), Expect = 3.193e-7
Identity = 48/175 (27.43%), Postives = 90/175 (51.43%), Query Frame = 3
Query:   42 SCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCG------FDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFIL 548
            SC   N    E  C +V +   C+  +  + Y +   C       F+  I   + M L + +L+L + V  + +++P L  V++ L M++++AGVTLLA GN +AD+FS+L++V + + P       + L A + V+ V+ G+I    PF +     ++D++F +   +   + L
Sbjct:   24 SCYAANTFPFEERCAFVASAKDCNRSTNVLPYMRIMACDLNCVNEFEQVIFLALFMGLCYEILVLLIHVC-NKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASV-NANVP----VFANSLAAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFL 192          
BLAST of slc24a-5 vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0339335)

HSP 1 Score: 124.405 bits (311), Expect = 1.156e-29
Identity = 92/316 (29.11%), Postives = 147/316 (46.52%), Query Frame = 3
Query: 1038 RKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFP----------GLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIK---------FSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVG----------IGLPFSIAN--ARYG 1892
            RKR   L++      +  E E   I E  +  P IN I            +TL     + I ++ K  +            GLFK   + + PIN E+W++ ++  +   + + P + I  + IP+V+ E    GW KLLNC+  +L+P + I  IK            V +G +    ++  L I V  A+   I S+ + PP Y+S+F  +    S+F I+  A EI  +LE  G +L +    +G T+ A   S+G L++N+ +A   +PR+AYA+ IGGP F +++            GLP S AN    YG
Sbjct:  139 RKRLSELERNQAIYTRDMEVE---IFERTNSGPNINKIRY----------TTLRMGRSTRISLDRKATRMVLHNRALGRNWGLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMY-SLPITVPIAVFMFIQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFGLPVSEANQTGNYG 440          
BLAST of slc24a-5 vs. Ensembl Fly
Match: CG5348 (gene:FBgn0034156 transcript:FBtr0305318)

HSP 1 Score: 122.094 bits (305), Expect = 1.357e-28
Identity = 78/285 (27.37%), Postives = 146/285 (51.23%), Query Frame = 3
Query: 1056 LDQENLKEIK-KTEKENRKIKEFQSPAPKINIISEENQIEKSSVDST-----------LHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWIT-FIKFSAVPLGSQGFILIHLVLIIGVCA-------AISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLV 1850
            LD++   EI  K +   RK+ E+ S   ++ I+ + + I  + +  T           ++     ++ ++    +  G+F+ F + + PI  + WK+  L ++VL +I++P + I TL IP+V+ E    GW KLLN ++ +++P + I+ F+ F         +I +   LI G  +       A+     ++ + PP Y+ +F  +    S+F I+  A EI  +LE  G +LSI    +G T+ AF  ++G L +N  +A   +P++A+A+ IGG  F ++V
Sbjct:  250 LDEKQTPEIALKLQDLERKL-EYYSQDTRVEILEKSSSISITRIRYTTMRMIRNPRVSVNRRYTRNMKLDYTQSKNQGIFRDFFLALRPIKCQAWKQAELLNRVLLLIRAPAVVICTLYIPLVDYEMEKHGWNKLLNAINVVVNPALSISIFLSFMHRKGNFLWYISLQNTLIYGASSFVLTVPFAVFILFHARTDVPPSYHWVFTIMNLTGSMFLIFLCATEIDTVLEVIGNILSIDDNYMGATVKAFTGNLGTLFANTAVAIHGYPKMAFASAIGGSFFTIVV 533          

HSP 2 Score: 51.6026 bits (122), Expect = 2.551e-6
Identity = 47/167 (28.14%), Postives = 81/167 (48.50%), Query Frame = 3
Query:   33 KMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCG------FDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAV---ISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDL 506
            K  SC   N    E  C +V     C+  +  I Y +   C       F   I   + +   F +L+L +    + +++P L  V++ L M+++LAGVTL+A GN +AD F++L++V   +   + N+S AL  I        T++ G+I  I PF +     ++D+
Sbjct:   29 KTVSCFAANNFPFEERCEFVQKAEDCNSSTNVIPYMRLLACDLKCINQFQEMIFIALFVAFCFQILVLLIYTI-NVYYSPALKAVSRFLHMNEHLAGVTLMAFGNTSADFFANLASVERHVPVFANNLSSALFVI--------TISGGLIFYISPFKMNSYETVRDI 186          
BLAST of slc24a-5 vs. Ensembl Fly
Match: CG14744 (gene:FBgn0033324 transcript:FBtr0307024)

HSP 1 Score: 120.168 bits (300), Expect = 5.429e-28
Identity = 82/294 (27.89%), Postives = 149/294 (50.68%), Query Frame = 3
Query: 1041 KRFISLDQENLKEIKKTEKENRKI---KEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGV-----CAAISAAIT----SKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANAR 1886
            ++ IS ++++   IK T K  R       F +       ++   +     VD  L+ ++  D +   K++Q   LF  F   + P++ E W+     +++  + + P++F+L L IPVV+ E+   GW KLLNC   + +P + IT +  S V   S  +   H+ L   +     C  +  AI     S+ + PP Y+ LF  + F +S+  ++    E+  + E  G+V ++ ++ + +T  A +N+  D+++N  LA + + R+A+AA IGGP+F +LV + L F I N R
Sbjct:  257 RKLISWEEQDDIGIKDTTKYRRSRDTGNHFSNMTSSGYFVTPIPERRSEHVDYELNRTALHDSE-NPKNLQ---LFTEFFQSLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHGWSKLLNCTQIVTNPFVVITLVH-SGV---SSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPPSYHHLFIILTFFSSMVTLWLAVTELEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLALQGYGRMAFAAIIGGPVFAILVSMSLAF-IFNHR 541          
BLAST of slc24a-5 vs. Ensembl Fly
Match: CG14743 (gene:FBgn0033326 transcript:FBtr0307023)

HSP 1 Score: 99.7525 bits (247), Expect = 1.778e-21
Identity = 70/306 (22.88%), Postives = 145/306 (47.39%), Query Frame = 3
Query:  960 LEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHL-----VLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGL 1862
            +E  +     R   L L  +  + NN ++    D+  + E K   K       F +P P I+      +++  +    LH+ +        K++    LF  FL  I PI+ E W      +++L ++++P+  +L L +P+V+ +    GW K+LNCL  +L+P +    ++   V   ++ + +         L++ +  AI   + S+ + PP Y+S +  +   T I + +  A E+  ++   GVV  +  + + +T  + + +  DL++   LA+  + ++A+ A IGG +++L V +G+
Sbjct:  236 IEVLRQSPSSREHDLILTEKIVRLNNLQQ---DDEIQILESKLYRKRTYNAGFFVTPKPLIH----HKEVDVETNRRILHSKANP------KNL---FLFSEFLQAINPIDSEGWYLSGTCARILQILKAPVTLMLHLVVPLVDYQLVKHGWSKMLNCLQIVLTPFVIFALVETMLVHKYAEWYYVPQFRMAIWSLLVTMPLAIVVFLHSRTDIPPFYHSSYCALTISTVIIFFWICAWEMDALISIIGVVFDLAPSYMSITFNSVSAATADLIAYAHLAKHGYGKMAFGAIIGGSVYSLAVNVGI 525          

HSP 2 Score: 49.6766 bits (117), Expect = 9.160e-6
Identity = 28/100 (28.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGF--DNRIIPTILMFLW---FXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAV 365
            C        C + + F NY+   +C F  DN+I   ++M L+   +   L  +    +S+FAP L +    +R+++ +AGV L+ + N   D+  +LS V
Sbjct:   38 CEMATKIDDCKYITNFFNYYVMMYCSFKIDNKITEIVVMLLFALIYCFFLCILYEGVNSYFAPTLKIAALKMRINEYMAGVVLVGVANSTPDLLVNLSPV 137          
BLAST of slc24a-5 vs. Ensembl Zebrafish
Match: slc8b1 (solute carrier family 8 member B1 [Source:ZFIN;Acc:ZDB-GENE-130530-900])

HSP 1 Score: 104.375 bits (259), Expect = 2.247e-24
Identity = 68/166 (40.96%), Postives = 93/166 (56.02%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIEL 569
            C YV N   C+ D GFI Y    FC F   ++P    +  +W L L L + + A  FF P L  +   LR++ N+AGVT LALGNGA DVFS+++A    S P  +      L GAGI V TV AG + ++ PF V  RP ++D+IFY+ A+ W   +L +  I L
Sbjct:   67 CEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFLVLGLIASDFFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAF---SHPQTAGLAIGALFGAGIFVTTVVAGSVALVKPFTVASRPFLRDVIFYMAAVFWTFTVLYKGHISL 229          
BLAST of slc24a-5 vs. Ensembl Zebrafish
Match: slc24a4a (solute carrier family 24 member 4a [Source:ZFIN;Acc:ZDB-GENE-050417-291])

HSP 1 Score: 62.003 bits (149), Expect = 1.686e-9
Identity = 43/154 (27.92%), Postives = 82/154 (53.25%), Query Frame = 3
Query: 1581 NAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIAN--ARYGKIKVELKSE-XXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            N   + +     + F  S  WI A +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+G+P+ I      YG + V++ S   +  +  +L    + ++ + V R+RL    GI ++V+Y
Sbjct:  422 NCAKKRWECCFMLSFFLSTVWIAAFSYILVWMVTIVGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGIQTMAVNYGSV-VKINSRGLVYSVVLLLGSVALTVLGIHVNRWRLDLRLGIYVLVLY 574          
BLAST of slc24a-5 vs. Ensembl Zebrafish
Match: CABZ01081780.1 (sodium/potassium/calcium exchanger 2-like [Source:NCBI gene;Acc:571043])

HSP 1 Score: 59.3066 bits (142), Expect = 1.931e-9
Identity = 32/100 (32.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query: 1617 VGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKS 1916
            V FL +I WI   +  +V      G  + I + I+GLTILA   SI DL++++++ARK    +A ++ +G  +F++ VG+  P+ + +   G + V++ S
Sbjct:   53 VTFLGAICWIAGFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLFSMVNGMVPVQVSS 152          
BLAST of slc24a-5 vs. Ensembl Zebrafish
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 60.077 bits (144), Expect = 2.970e-9
Identity = 30/108 (27.78%), Postives = 59/108 (54.63%), Query Frame = 3
Query: 1581 NAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIAN--ARYGKI 1898
            N     +  +  + F+ S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+G+P+++      YG +
Sbjct:  116 NCAKSRWEKYFMLSFILSTVWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWALQTMAVNYGSV 223          
BLAST of slc24a-5 vs. Ensembl Zebrafish
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 61.2326 bits (147), Expect = 3.032e-9
Identity = 30/108 (27.78%), Postives = 59/108 (54.63%), Query Frame = 3
Query: 1581 NAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIAN--ARYGKI 1898
            N     +  +  + F+ S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+G+P+++      YG +
Sbjct:  458 NCAKSRWEKYFMLSFILSTVWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWALQTMAVNYGSV 565          
BLAST of slc24a-5 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 172.555 bits (436), Expect = 2.226e-45
Identity = 113/325 (34.77%), Postives = 183/325 (56.31%), Query Frame = 3
Query: 1104 RKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFP---GLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIH-------LVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXX-----XXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            R++++ Q   P    I+EE  +   S D  + T   S+   E + +  P     ++    ++ P++  +WK++S   +   +I+ P+  +L LT+PVV+ ++  + W + LNCLH I +PL+ +  I       GS G  +I+       ++LIIG   A    +T+    PP+Y+ LF+F+GF+ S  WI A A EIVN+L TFGV+  +  T+LGLT+LA+ NSIGD VS+I LAR+ +PR+A++AC GG +FN+L+G+GL   +   + G  +  L+ E   L+  IL        + +LI +P   F LR  YG+ +  IY
Sbjct:  242 RRMRQQQLAVP----ITEEPDLLGESEDDCVSTPHGSEYGDEYQPL-LPLQRSTWQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTIN-----AGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLL---QMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIY 553          

HSP 2 Score: 105.145 bits (261), Expect = 6.693e-23
Identity = 74/181 (40.88%), Postives = 103/181 (56.91%), Query Frame = 3
Query:   33 KMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIEL 569
            K + C    K      CN+      CS   G+INY    FC F   + P    L  LW L L + +AVTA+ FF P L  +++ILR+S N+AGVT LA GNGA DVFS+++A   + S    LA+G++ GAG+ V TV AG I I+ PF    RP ++D++FY+ A+    FIL +  + L
Sbjct:   39 KADQCQEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 217          
BLAST of slc24a-5 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 171.014 bits (432), Expect = 7.277e-45
Identity = 113/325 (34.77%), Postives = 183/325 (56.31%), Query Frame = 3
Query: 1104 RKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFP---GLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIH-------LVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXX-----XXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            R++++ Q   P    I+EE  +   S D  + T   S+   E + +  P     ++    ++ P++  +WK++S   +   +I+ P+  +L LT+PVV+ ++  + W + LNCLH I +PL+ +  I       GS G  +I+       ++LIIG   A    +T+    PP+Y+ LF+F+GF+ S  WI A A EIVN+L TFGV+  +  T+LGLT+LA+ NSIGD VS+I LAR+ +PR+A++AC GG +FN+L+G+GL   +   + G  +  L+ E   L+  IL        + +LI +P   F LR  YG+ +  IY
Sbjct:  245 RRMRQQQLAVP----ITEEPDLLGESEDDCVSTPHGSEYGDEYQPL-LPLQRSTWQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTIN-----AGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLL---QMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIY 556          

HSP 2 Score: 86.6557 bits (213), Expect = 4.010e-17
Identity = 66/165 (40.00%), Postives = 93/165 (56.36%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIEL 569
            CN+      CS   G+INY    FC F   + P    L  LW L L + +AVTA+ FF P L  ++    ++  L GVT LA GNGA DVFS+++A   + S    LA+G++ GAG+ V TV AG I I+ PF    RP ++D++FY+ A+    FIL +  + L
Sbjct:   58 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 220          
BLAST of slc24a-5 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 169.088 bits (427), Expect = 3.733e-44
Identity = 101/262 (38.55%), Postives = 157/262 (59.92%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIH-------LVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXX-----XXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P++  +WK++S   +   +I+ P+  +L LT+PVV+ ++  + W + LNCLH I +PL+ +  I       GS G  +I+       ++LIIG   A    +T+    PP+Y+ LF+F+GF+ S  WI A A EIVN+L TFGV+  +  T+LGLT+LA+ NSIGD VS+I LAR+ +PR+A++AC GG +FN+L+G+GL   +   + G  +  L+ E   L+  IL        + +LI +P   F LR  YG+ +  IY
Sbjct:  311 PVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTIN-----AGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLL---QMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIY 564          

HSP 2 Score: 72.0182 bits (175), Expect = 1.999e-12
Identity = 64/179 (35.75%), Postives = 92/179 (51.40%), Query Frame = 3
Query:   39 ESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIEL 569
            + C    K      CN+      CS   G+INY    FC F   + P    L  LW L L + +AVTA+         ++    ++  L GVT LA GNGA DVFS+++A   + S    LA+G++ GAG+ V TV AG I I+ PF    RP ++D++FY+ A+    FIL +  + L
Sbjct:   61 QQCQEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEK-----NQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 232          
BLAST of slc24a-5 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 167.548 bits (423), Expect = 8.040e-44
Identity = 101/262 (38.55%), Postives = 157/262 (59.92%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIH-------LVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXX-----XXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P++  +WK++S   +   +I+ P+  +L LT+PVV+ ++  + W + LNCLH I +PL+ +  I       GS G  +I+       ++LIIG   A    +T+    PP+Y+ LF+F+GF+ S  WI A A EIVN+L TFGV+  +  T+LGLT+LA+ NSIGD VS+I LAR+ +PR+A++AC GG +FN+L+G+GL   +   + G  +  L+ E   L+  IL        + +LI +P   F LR  YG+ +  IY
Sbjct:  287 PVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTIN-----AGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLL---QMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIY 540          

HSP 2 Score: 71.2478 bits (173), Expect = 2.881e-12
Identity = 64/179 (35.75%), Postives = 92/179 (51.40%), Query Frame = 3
Query:   39 ESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIEL 569
            + C    K      CN+      CS   G+INY    FC F   + P    L  LW L L + +AVTA+         ++    ++  L GVT LA GNGA DVFS+++A   + S    LA+G++ GAG+ V TV AG I I+ PF    RP ++D++FY+ A+    FIL +  + L
Sbjct:   61 QQCQEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEK-----NQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 232          
BLAST of slc24a-5 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 103.605 bits (257), Expect = 2.415e-24
Identity = 71/165 (43.03%), Postives = 99/165 (60.00%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIEL 569
            CN+      CS   G+INY    FC F   + P    L  LW L L + +AVTA+ FF P L  +++ILR+S N+AGVT LA GNGA DVFS+++A   + S    LA+G++ GAG+ V TV AG I I+ PF    RP ++D++FY+ A+    FIL +  + L
Sbjct:   54 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAF--SDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 216          
BLAST of slc24a-5 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 169.859 bits (429), Expect = 6.859e-45
Identity = 100/319 (31.35%), Postives = 179/319 (56.11%), Query Frame = 3
Query: 1092 EKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFIL--IHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXX---XXXXXPVMRFRLRPVYGIIMIVIY 2033
             + +R +    S  P++   SEE+Q+  ++            +      VQ        +  + P+++ +W+ QS+  +VL V++ P+ F+L LT+PVV+ ++  + W + LNCL  ++SPL+ +  ++     +   G +L    +V+I+G   A      +    PP  + LFAF+GFLTS  WI A A E+VNIL + GV+  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +   R   ++V+L+ + +++      + +    +L+ +P+  F+L   YG+ +++ Y
Sbjct:  197 RQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYRPLLLGRETTVQI------LIQALNPLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFY 509          

HSP 2 Score: 66.6254 bits (161), Expect = 6.703e-11
Identity = 41/114 (35.96%), Postives = 60/114 (52.63%), Query Frame = 3
Query:   27 KLKMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA 362
            +  M  C           C++V     C  ++G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L A
Sbjct:   47 QTAMADCRAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVA 160          
BLAST of slc24a-5 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 169.088 bits (427), Expect = 2.391e-44
Identity = 100/319 (31.35%), Postives = 179/319 (56.11%), Query Frame = 3
Query: 1092 EKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFIL--IHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXX---XXXXXPVMRFRLRPVYGIIMIVIY 2033
             + +R +    S  P++   SEE+Q+  ++            +      VQ        +  + P+++ +W+ QS+  +VL V++ P+ F+L LT+PVV+ ++  + W + LNCL  ++SPL+ +  ++     +   G +L    +V+I+G   A      +    PP  + LFAF+GFLTS  WI A A E+VNIL + GV+  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +   R   ++V+L+ + +++      + +    +L+ +P+  F+L   YG+ +++ Y
Sbjct:  236 RQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYRPLLLGRETTVQI------LIQALNPLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFY 548          

HSP 2 Score: 58.151 bits (139), Expect = 2.890e-8
Identity = 74/249 (29.72%), Postives = 114/249 (45.78%), Query Frame = 3
Query:   27 KLKMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL------TTQEDTQHKKDESGSNI---QYSRENR 737
            +  M  C           C++V     C  ++G+++Y +  FC F   ++P    L   W L L L + VTA  F  P                GVT LA GNGA D+FS+L   ++ S P  +      L GAG+LV TV AG I I+ PF    RP ++D+ FY++A+      L   +I L  ++ +L +YV YV    +   +Y +Q+   L      T +  ++ ++D+  SN     Y  E R
Sbjct:   47 QTAMADCRAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKF--P---------------HGVTFLAFGNGAPDIFSAL---VAFSDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYR 275          
BLAST of slc24a-5 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 169.088 bits (427), Expect = 2.978e-44
Identity = 105/319 (32.92%), Postives = 181/319 (56.74%), Query Frame = 3
Query: 1092 EKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFIL--IHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXX---XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
             + +R +    S  P++   SEE+Q+  ++            +      VQ        +  + P+++ +W+ QS+  +VL V++ P+ F+L LT+PVV+ ++  + W + LNCL  ++SPL+ +  ++     +   G +L    +V+I+G   A      +    PP  + LFAF+GFLTS  WI A A E+VNIL + GV+  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +   R   ++V+L+ + +   VL S + L  I +L+ +P+  F+L   YG+ +++ Y
Sbjct:  253 RQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYRPLLLGRETTVQI------LIQALNPLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFY 565          

HSP 2 Score: 83.9593 bits (206), Expect = 2.598e-16
Identity = 80/249 (32.13%), Postives = 125/249 (50.20%), Query Frame = 3
Query:   27 KLKMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL------TTQEDTQHKKDESGSNI---QYSRENR 737
            +  M  C           C++V     C  ++G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P  +      L GAG+LV TV AG I I+ PF    RP ++D+ FY++A+      L   +I L  ++ +L +YV YV    +   +Y +Q+   L      T +  ++ ++D+  SN     Y  E R
Sbjct:   47 QTAMADCRAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYR 292          
BLAST of slc24a-5 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 124.405 bits (311), Expect = 2.564e-29
Identity = 77/257 (29.96%), Postives = 132/257 (51.36%), Query Frame = 3
Query: 1092 EKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFIL--IHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGI 1856
             + +R +    S  P++   SEE+Q+  ++            +      VQ        +  + P+++ +W+ QS+  +VL V++ P+ F+L LT+PVV+ ++  + W + LNCL  ++SPL+ +  ++     +   G +L    +V+I+G   A      +    PP  + LFAF+GFLTS  WI A A E+VNIL + GV+  +  T+LGLT+LA+ NSIG          ++   +    C  GP  +LL G+
Sbjct:  253 RQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYRPLLLGRETTVQI------LIQALNPLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGA-------GARRITGVGAGQC-PGPQLDLLPGL 495          

HSP 2 Score: 84.7297 bits (208), Expect = 1.446e-16
Identity = 62/170 (36.47%), Postives = 92/170 (54.12%), Query Frame = 3
Query:   27 KLKMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLAL 527
            +  M  C           C++V     C  ++G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P  +      L GAG+LV TV AG I I+ PF    RP ++D+ FY++A+
Sbjct:   47 QTAMADCRAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAV 213          
BLAST of slc24a-5 vs. Ensembl Mouse
Match: Slc24a3 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 [Source:MGI Symbol;Acc:MGI:2137513])

HSP 1 Score: 63.1586 bits (152), Expect = 7.832e-10
Identity = 30/98 (30.61%), Postives = 58/98 (59.18%), Query Frame = 3
Query: 1581 NAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            N    ++  +  V F +S  WI A +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++L+G+GLP+++
Sbjct:  468 NCNKPHWEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWAL 565          
BLAST of slc24a-5 vs. UniProt/SwissProt
Match: sp|Q6AXS0|NCLX_RAT (Mitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 8.351e-44
Identity = 106/319 (33.23%), Postives = 180/319 (56.43%), Query Frame = 3
Query: 1092 EKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFIL--IHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXX---XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
             + +R +    S  P++   SEE+Q+  ++            +  E    Q        L  + P+++ +W+ QS+  K+L V + P+ F+L LT+PVV+ ++  + W + LNCL  ++SPL+ +  ++     +   G +L    +V+I+G   A      +  + PP  + LFAF+GFLTS  WI A A E+VNIL + GVV  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +   R    +V+L+ + +   VL S + L  + +L+ +P+  F+L   YG+ +++ Y
Sbjct:  253 RQRSRSLVHSISETPELLTDSEEDQMSSNTNSYDYGEEYRPLLLGEETTGQI------LLQALNPLDYRKWRTQSISCKLLKVAKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNSEPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIVRSHASEVKLEPDGLLVWVLASALGLSLVFSLVSVPLQCFQLSKAYGLCLLLFY 565          

HSP 2 Score: 85.5001 bits (210), Expect = 6.209e-16
Identity = 81/249 (32.53%), Postives = 123/249 (49.40%), Query Frame = 3
Query:   27 KLKMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL------TTQEDTQHKKDESGSNI---QYSRENR 737
            +  M  C           C++V     C  + G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P  +      L GAG+LV TV AG I I+ PF    RP ++D+ FY++A+      L   +I L  ++ +L +YV YV    +   +Y +Q+   L      T +  T  ++D+  SN     Y  E R
Sbjct:   47 QTAMADCRAVCSLNTSDRCDFVKRNPDCHSEGGYLDYLKGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTSLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPRTAGLAIGALFGAGVLVTTVVAGGITILRPFMAASRPFLRDITFYMVAVFLTFTALYLGRITLVWALGYLGLYVFYVVTVIICTWVYQRQRSRSLVHSISETPELLTDSEEDQMSSNTNSYDYGEEYR 292          
BLAST of slc24a-5 vs. UniProt/SwissProt
Match: sp|Q925Q3|NCLX_MOUSE (Mitochondrial sodium/calcium exchanger protein OS=Mus musculus OX=10090 GN=Slc8b1 PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 2.083e-43
Identity = 105/319 (32.92%), Postives = 181/319 (56.74%), Query Frame = 3
Query: 1092 EKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFIL--IHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXX---XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
             + +R +    S  P++   SEE+Q+  ++            +      VQ        +  + P+++ +W+ QS+  +VL V++ P+ F+L LT+PVV+ ++  + W + LNCL  ++SPL+ +  ++     +   G +L    +V+I+G   A      +    PP  + LFAF+GFLTS  WI A A E+VNIL + GV+  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +   R   ++V+L+ + +   VL S + L  I +L+ +P+  F+L   YG+ +++ Y
Sbjct:  253 RQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYRPLLLGRETTVQI------LIQALNPLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFY 565          

HSP 2 Score: 83.9593 bits (206), Expect = 1.817e-15
Identity = 80/249 (32.13%), Postives = 125/249 (50.20%), Query Frame = 3
Query:   27 KLKMESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL------TTQEDTQHKKDESGSNI---QYSRENR 737
            +  M  C           C++V     C  ++G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P  +      L GAG+LV TV AG I I+ PF    RP ++D+ FY++A+      L   +I L  ++ +L +YV YV    +   +Y +Q+   L      T +  ++ ++D+  SN     Y  E R
Sbjct:   47 QTAMADCRAVCGLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRSRSLVHSISETPELLSESEEDQMSSNTNSYDYGDEYR 292          
BLAST of slc24a-5 vs. UniProt/SwissProt
Match: sp|Q6J4K2|NCLX_HUMAN (Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 6.104e-41
Identity = 95/254 (37.40%), Postives = 157/254 (61.81%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVL--IIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANAR-YGKIKVELKSEXX-XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P+++ +W+ +S + K L V + P+ F+L LT+PVV+ ++  + W + LNCLH ++SPL+ +  ++     +   G ++   V+  I G   A      +  + PP  + LFAF+GFLTS  WI A A E+VNIL + GVV  +  T+LGLT+LA+ NSIGD  S+  LAR+ +PR+A++AC GG +FN+LVG+GL   +  +R + ++K+E     + VL   + L  + +L+ +P+  F+L  VYG  +++ Y
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFY 564          

HSP 2 Score: 97.4413 bits (241), Expect = 9.626e-20
Identity = 82/231 (35.50%), Postives = 125/231 (54.11%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKL-----TTQE---DTQHKKDESGSN-IQYSRENR 737
            C+++     C  D G+++Y +  FC F   ++P    L   W L L L + VTA  FF P L  ++  L++S N+AGVT LA GNGA D+FS+L   ++ S P+ +      L GAG+LV TV AG I I+ PF    RP  +D++FY++A+     +L R ++ L  ++ +L +YV YV    +   IY +Q+RG L      T E   D++  +  S +N   Y  E R
Sbjct:   65 CDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSAL---VAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYR 292          
BLAST of slc24a-5 vs. UniProt/SwissProt
Match: sp|P34322|NCX7_CAEEL (Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans OX=6239 GN=ncx-7 PE=3 SV=3)

HSP 1 Score: 149.058 bits (375), Expect = 3.022e-36
Identity = 92/249 (36.95%), Postives = 148/249 (59.44%), Query Frame = 3
Query: 1296 EEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKF-SAVPL-GSQGFILIHLVLIIGVCAAISAAITSKANAPPEYY-SLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            E+W+E ++FSKV++ I      +  LTIP+ E       W K L  LH    P   +  I+F    P  GS G  +  L   + +  AI   + ++ +  P+YY  ++++ GF+ SI WIY I++E+VN++   GVV  +   +LGLTILA++NSIGDL++++ + ++ +PR+A AA IGGPLFNLL+G GLPF+IA  +   I + +     +LI  + +  +  LI +PV +FRL+  +  ++I IY
Sbjct:  413 EDWEEMNIFSKVMAYINVVPNLLFKLTIPLNE-----MSWSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLA--VSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLATLIGIPVQKFRLQRPHAAVLISIY 654          

HSP 2 Score: 93.9745 bits (232), Expect = 1.281e-18
Identity = 83/245 (33.88%), Postives = 135/245 (55.10%), Query Frame = 3
Query:   39 ESCNPKNKTFNESFCNYV-INRGSCSFDSGFINYFQWQFCGFD--NRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILI-RRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEP 761
            E C        E  C+YV  N  +C    G++ + Q+  C     +R+I  I+  ++ LVL + V+  AD FF+P +  +   LR+S+++AGVT +A GNGA DVF S+++V+S+ +P   LALG + G G+ V T+    I++  PFDV     I+DL+FYL+AL +  F  +   ++ LW  + FL +Y++YV     ++A++  +KR  L  Q  T+ +K         S  +R  I+ V P
Sbjct:   42 EKCELNKTWTQEQVCDYVNCNDNACE-GGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVH-NRKRKALQKQNSTKSRKSIK------SLRSRKSIHSVAP 278          
BLAST of slc24a-5 vs. UniProt/SwissProt
Match: sp|P34315|NCX6_CAEEL (Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans OX=6239 GN=ncx-6 PE=3 SV=3)

HSP 1 Score: 147.902 bits (372), Expect = 4.108e-36
Identity = 94/277 (33.94%), Postives = 157/277 (56.68%), Query Frame = 3
Query: 1083 KKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQ------FPGLFKHFLMKIIPI-NFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAV-PL-GSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANAR 1886
             + +K+  K+ E ++     + + +++ I  S     LH      ++ E + V+      F G+   F   + P  + +EW E ++F KV++V+ +   F+  LTIP  E+      W K +  L C++ P+  +  I+  ++ P   S G  +  L+L + + AA+    T     PP Y SL ++ GFL SI WIY I++E+VN++   GVV  +   +LGLTILA++NSIGDL++++ +A++ +PR+A AA IGG LFNLL+G GLPF+IA  +
Sbjct:  255 NRHKKDEEKVDEVKTVD--TDSLEDDDDIYVSHGHHVLHAHEVMKMEAEIEAVEPLKTWSFRGVVHDFKEHLKPWPSMDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAV-LFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQ 523          

HSP 2 Score: 72.4034 bits (176), Expect = 6.696e-12
Identity = 61/182 (33.52%), Postives = 100/182 (54.95%), Query Frame = 3
Query:   39 ESCNPKNKTFNESFCNYV-INRGSCSFDSGFINYFQWQFCGFDN--RIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILI-RRQIELW 572
            E C  +    +   C YV  N  +C    G++ + ++  C      RII  I   ++ LVL + V+  AD FF+P +  +   LR+S+++AGVT +A GNGA DVF ++++V+S+ +P   LALG + GAG+ V T+   + +   PF       I+D+ FYL+AL +  F  +    +E+W
Sbjct:   51 EQCTIQAGWNSTQVCEYVKCNDDNCE-GGGYVLWTRYVECASSPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIW 231          
BLAST of slc24a-5 vs. TrEMBL
Match: A0A0H3YF40 (Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc24a-5 PE=2 SV=1)

HSP 1 Score: 1177.54 bits (3045), Expect = 0.000e+0
Identity = 685/685 (100.00%), Postives = 685/685 (100.00%), Query Frame = 3
Query:   36 MESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIYXXXXXXXXXXATNVIKVTL 2090
            MESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKVTL
Sbjct:    1 MESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKVTL 685          
BLAST of slc24a-5 vs. TrEMBL
Match: A0A0H3YFD7 (Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc24a-7 PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.965e-97
Identity = 195/414 (47.10%), Postives = 271/414 (65.46%), Query Frame = 3
Query:  873 RSKRIPSIRNRTMGSIAKIIIENEYHKEILE---AKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKD-----VQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIYXXXXXXXXXXATNVIKVTL 2090
            RS    S  +R++ S+AKIII+NE+ KE +E     K  N  +SLSL +  E    +N + +      +++EI+K + +                I+ E  I + +        +E+  ++ET +     V FPG +KHF + I+P++ EEW+EQS FSK LS+IQSP MFILTLTIP+V+E  YLKGWCK+LNC+HC+LS + W+        P G+  F+L++L +I+G    +  A TSK + PP Y   FAF+G +TSI WIY IANEIVNIL  FGVV +I   ILGL++LAFANS GDLVSN+ LA+  +PRI Y+AC+GGPLFNLLVGIG+PFSI     G I V+L   +IVLI TI+L+T +NL+ LP+M+F+ +  YGII+I IYV++ + V+LFA ++IKVTL
Sbjct:  461 RSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYW------SMREIQKAKSD----------------ITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 851          

HSP 2 Score: 203.371 bits (516), Expect = 1.513e-51
Identity = 136/213 (63.85%), Postives = 167/213 (78.40%), Query Frame = 3
Query:   36 MESCNP-KNKTFNES-FCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLT 668
            M +C P K  +FN S  C+Y+ N   CS +SG INY+QWQ+C F NR  P ILMFLWFL LL  +  +ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSAV S S+PNV LA G+ILGAG+ VN +TAGIIMI+ PF +M+RPI+KDL+FY +AL+WCM I I++QIELWSS+VFL IYVIY+ VT +SR +YV+ ++   T
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSNKT 213          
BLAST of slc24a-5 vs. TrEMBL
Match: A0A0H3YKA1 (Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc24a-2 PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 2.317e-91
Identity = 197/417 (47.24%), Postives = 267/417 (64.03%), Query Frame = 3
Query:  864 QSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILE---AKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTE-----KENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIYXXXXXXXXXXATNVIKVTL 2090
             S R+    S  +R++GS+A+III+ E+ KE +E     K +   RS+SL +  E P    + RF S+ +    +   T      K N KI        K N+ + EN       DS                V FPG +KHF + I+P++ EEW+EQS FSK LS+IQSP MFILTLTIP+V+E  YLKGWCK+LNC+HC+LS + W+        P G+  F+L++L +I+G    +  A TSK + PP Y   FAF+G +TSI WIY IANEIVNIL  FGVV +I   ILGL++LAFANS GDLVSN+ LA+  +PRI Y+AC+GGPLFNLLVGIG+PFSI     G I V+L   +IVLI TI+L+T +NL+ LP+M+F+ +  YGII+I+IY+++ + V+LFA ++IKVTL
Sbjct:  497 HSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESP-LKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENG------DSV---------------VTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMLVTTLNLLCLPLMKFQPKRFYGIILIIIYIIYFVLVILFAVDIIKVTL 890          

HSP 2 Score: 211.075 bits (536), Expect = 3.917e-54
Identity = 142/214 (66.36%), Postives = 165/214 (77.10%), Query Frame = 3
Query:   36 MESCNPKN--KTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTT 671
            M+ C P N   +   + C Y+    SC  + GFINYFQWQ+C FDNR  PTILM LWFL LL  +A  ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSAV STS+PNV LA G ILGAGI VN++TAGIIMII PF +M+RPIIKD +FY  AL+WCMFI IRRQIELWSS+VFLI+Y IY+ VT +SR +YV+  + K TT
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHIKSKATT 214          
BLAST of slc24a-5 vs. TrEMBL
Match: A0A293N1M1 (Na+/Ca2+ exchanger (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 7.876e-69
Identity = 174/596 (29.19%), Postives = 300/596 (50.34%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNR------IIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLS--LIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKE----FQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGL--FKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSP--LIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAAC 1820
            CN+V     C  D  FI Y  + +C F +       ++ TI + + F+ L +      D F AP L+V++  LR+SQN+AG+T LA GNGA D+ SSL+  I  + P++ +      G  +    V AG I +   F +M RP ++D+IFY+ A  W  FI   ++I L+ S+ F+I+Y+I++ V  +SR +Y + K  +L   E+   K+ +S ++I    +      D+                        D   N+L+  + P+ S  +   P      MG I +            E+  +  R+ +++  +     + N+     + +QE + +I+         +      QS  P + +          S  +T   S+   I    ++++ P L   K   + ++PI+  +W E++ + K   V ++PI FILTLT PVV+ E     WC+LLNCLHC++ P  ++ +T +  S V     GF +  +V++     A++   TSK   PP Y+  FA++GF  ++FWIY +ANE+V++L+  G+V+ +    LG+T+LA+ NSIGD +SN+ +A++ +PR+A +AC
Sbjct:   23 CNFVRGCDQCQSDEQFIPYMTFVYCAFGSGNTAPALVVLTIALLIMFVGLGITA----DDFLAPALIVISDTLRLSQNIAGITFLAFGNGAPDIISSLAG-IQQARPDLVIGELFGAGIYV--TCVVAGSICLTQDFKIMERPFLRDIIFYIGATYWAFFIFYTQKITLYHSIGFIILYIIFIIVVLMSRIVYQRMKENELAKAEEA--KRSQSATHISAFHQQMNGPPDI------------------------DQTGNYLAPPIPPLFSKATYEEP--EPEEMGVILR-------RFSFRESISHRTRRPTIT-GVHLHNHRRNSIFMITASEQERMAQIRSRASSKASTRSGSVCTQSGIPPVIL----------SPQATSSLSALVSIATSVEELEAPRLSPLKELALHLMPIDLNDWPEKTWYGKFYEVCKAPIYFILTLTTPVVDYENDKNNWCRLLNCLHCVIGPVFILLVTGVVDSTV----AGFPVAVIVVLGATAVALTVFFTSKYEEPPRYHWAFAYLGFFVAVFWIYGLANEVVSLLKAVGIVIGLSDAFLGMTVLAWGNSIGDFISNLAVAKQGYPRMAISAC 561          
BLAST of slc24a-5 vs. TrEMBL
Match: A0A1V9XJM5 (Sodium/potassium/calcium exchanger 6-like (Fragment) OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_09609 PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.125e-63
Identity = 189/620 (30.48%), Postives = 320/620 (51.61%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDN--RIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHK-----------KDESGSN--IQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPMQS----FRSKRIPSIRNRTM-GSIAKIIIENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEEN---------QIEKSSVDSTLHTSSESDI----------DVETK-DVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAAC 1820
            C++V N   C  D  +I+Y  + +C F +   +   +L+ LW  +L + + VTAD F  P L++++  LR+SQN+AGVT LA GNGA D+ SSL+ V  ++ P++ +      G  +    V  G I +   F +  RP ++D IFY+ A  W   +  + +I L+ S+ F+++Y++Y+ V  VS +IY +  R    +++DTQ+            + ++G N   Q ++ N  + +D +P      +   +   +S  +S     +  LS   ++S    F + R P+  NR+  GSI     ++   +  L  ++ + R R ++ +   E      R R     Q++  +       N K   +   AP  +  S+ N         Q+EK  VD       + ++          D  TK  V  P L + FL +I PI+ E+W+E + F +V+ +I+ P+  IL LT+PVV+E  +   WC++LN LHC+ +PL  +  +K      G  G  +   V   G+  A++  +TS  + PP Y+  F F GF  S+FWIY +ANE+V++L+  G+VL +  T LG+T+LA+ NS+GD +SN+ +AR+ FPR+A +AC
Sbjct:   16 CDFVRNNSGCHEDENYIHYSTFVYCAFGSGEVLPALLLLVLWITILFIGLGVTADDFLTPALILISNTLRLSQNIAGVTFLAFGNGAPDIISSLAGV-ESARPDLVIGELFGAGIFVTCAVV--GSICLTQNFKITERPFLRDAIFYIGATYWAFCMFYKGRISLFHSIGFILLYLVYIVVVVVSSSIYRRHNRKP--SEQDTQYNDQFPESSKGLSETDTGVNKFDQQNQVNCVFKDDGKPQADDPEMVGLVLRRSSFRDSYVHRHKRTLSDSRLRSNSRVFYTSR-PATPNRSREGSICS---QSHSRRSGLSREERLGRHRVMNHNNHQE-----TRNRHGQQQQQHQLDHFHQSDYNLKNPMYTLTAPFADGQSKLNLSCNGQSARQVEKDPVDLKQVAGLDGEVLEKEEPLTNYDFGTKVAVDLPPL-QEFLTQISPIDREDWRELNWFWRVIQIIKGPVYVILALTVPVVDENNHKNNWCRILNALHCVTAPLAVMFNLKVMDSNAG--GVPIAAGVSAAGIALALTVWLTSSYDKPPTYHVAFGFAGFAVSVFWIYMLANEVVSLLKAVGIVLDLSDTFLGMTVLAWGNSVGDFISNLSVARQGFPRMAISAC 618          
BLAST of slc24a-5 vs. Ensembl Cavefish
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:103022341])

HSP 1 Score: 142.51 bits (358), Expect = 2.944e-35
Identity = 96/266 (36.09%), Postives = 150/266 (56.39%), Query Frame = 3
Query: 1260 KHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIH-------LVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXX-XXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            K FL  I P++   W+      + L +IQ P   +L LT+PVV+ ++    W + LNCLH I  PL+ +  + F +   G  G  LI        L  +IGV  +     T+    PP Y+ LF+ +GF+ S  WI  +A+EIV++L   G+VLS+  T+LGLT+LA+ NSIGD  S+I +AR+ +PR+A +AC GG +FN+L G+GL   +     G + +E +     VL   + L  +++ + +P+ RF L   YGI +++ Y
Sbjct:  313 KIFLKSISPVDTRIWRRSHWAWRALKIIQLPFEVVLLLTVPVVDTDKEDHNWKRPLNCLHIITGPLVCV--LTFQS---GHYGLYLIQGDFPVWLLTALIGVFLSGIVFCTTNNERPPPYHFLFSLLGFVVSALWISTVASEIVSVLHLLGIVLSLSNTVLGLTLLAWGNSIGDCFSDITIARQGYPRMAISACFGGIIFNMLFGVGLGCLLQMFHNGVVMLEPEGLLGWVLSGALGLSLVLSFVLVPLQRFHLNRAYGIFLLIFY 573          

HSP 2 Score: 102.064 bits (253), Expect = 4.121e-22
Identity = 84/221 (38.01%), Postives = 126/221 (57.01%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPT--ILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXX-XXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSREN 734
            C +V+N   C+ + GFINY +  FC     ++P    L  +W LV+ L + + A  FF P L  ++  LR++ N+AGVT LALGNGA DVFS+++A    S P  +      L GAGI V TV AG + ++ PF V  RP ++D+IFY+ A+ W   IL +  I+L  ++ +L +YV+YV    VS  IY ++ R      ++++   D   S+  Y REN
Sbjct:   74 CEFVLNTPDCAAEGGFINYPKITFCLLAPNLLPLAIFLYIVWLLVMFLVLGLIASQFFCPNLSAISSTLRLTHNVAGVTFLALGNGAPDVFSAMAAF---SRPQTAGLAIGALFGAGIFVTTVVAGSVTLVKPFTVASRPFLRDIIFYMAAVFWTFTILYKGWIDLKEALGYLGLYVLYVITVVVSTYIYRRRTRSLRGPLQNSEVANDIQASD--YYREN 289          
BLAST of slc24a-5 vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 63.5438 bits (153), Expect = 4.904e-10
Identity = 31/95 (32.63%), Postives = 57/95 (60.00%), Query Frame = 3
Query: 1590 PEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            P +   F F  F++S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+GLP+++
Sbjct:  462 PRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWAL 555          
BLAST of slc24a-5 vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 62.7734 bits (151), Expect = 7.425e-10
Identity = 31/95 (32.63%), Postives = 57/95 (60.00%), Query Frame = 3
Query: 1590 PEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            P +   F F  F++S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+GLP+++
Sbjct:  424 PRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWAL 517          
BLAST of slc24a-5 vs. Ensembl Cavefish
Match: slc24a4b (sodium/potassium/calcium exchanger 4 [Source:NCBI gene;Acc:103043044])

HSP 1 Score: 62.003 bits (149), Expect = 1.727e-9
Identity = 32/97 (32.99%), Postives = 57/97 (58.76%), Query Frame = 3
Query: 1584 APPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            A P +   F  + FL S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+GLP+++
Sbjct:  477 AKPRWEKYF-MLSFLLSTVWIAIFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGLPWAL 572          
BLAST of slc24a-5 vs. Ensembl Cavefish
Match: slc24a4b (sodium/potassium/calcium exchanger 4 [Source:NCBI gene;Acc:103043044])

HSP 1 Score: 61.6178 bits (148), Expect = 2.187e-9
Identity = 32/97 (32.99%), Postives = 57/97 (58.76%), Query Frame = 3
Query: 1584 APPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            A P +   F  + FL S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+GLP+++
Sbjct:  429 AKPRWEKYF-MLSFLLSTVWIAIFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGLPWAL 524          
BLAST of slc24a-5 vs. Ensembl Sea Lamprey
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 139.043 bits (349), Expect = 3.006e-36
Identity = 83/207 (40.10%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 1251 GLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIK---FSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGL 1862
            G    FL+ + P++  EW+ +    ++L V+  P+  +L LT+PV+      + W + LNCL  +  PL  +  +    +  +P+G     L  L+L IG   A+ A IT+ +  PP +   FA +GF+ S  W+ AIANE+VN+L+TFGVV  I  T+LGLT+LA+ NS+ D V++I +AR+ +PR+A +AC GG +FN+LVGIGL
Sbjct:   82 GKLYRFLLSLSPLDPAEWRRRGYIWRLLKVVVLPVELLLILTVPVMNVMHEDRKWNRPLNCLQLMTGPLAALYSLNGGLYFMLPVGGT-LPLWSLILAIGCLLAVVAFITT-SEQPPAFQLAFAVLGFVVSALWMNAIANEVVNLLQTFGVVFGISSTVLGLTLLAWGNSVPDFVADITMARQGYPRMAISACFGGIVFNILVGIGL 286          
BLAST of slc24a-5 vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 60.4622 bits (145), Expect = 8.169e-10
Identity = 33/101 (32.67%), Postives = 58/101 (57.43%), Query Frame = 3
Query: 1623 FLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIAN--ARYGKIKVELKSE 1919
            F+ S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+GLP+++      YG   VE+ S 
Sbjct:  383 FVISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALQTLLVDYGS-HVEINSR 482          
BLAST of slc24a-5 vs. Ensembl Sea Lamprey
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 58.9214 bits (141), Expect = 2.888e-9
Identity = 33/103 (32.04%), Postives = 58/103 (56.31%), Query Frame = 3
Query: 1608 FAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKS 1916
            F  V F  SI WI   +  +V      G  + I + I+GLTILA   SI DL++++++ARK    +A ++ +G  +F++ VG+ +P+ + +   G   V++ S
Sbjct:  391 FFMVTFFGSILWIAIFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPMPWLMFSLVKGFAPVQVSS 493          
BLAST of slc24a-5 vs. Ensembl Yeast
Match: YDL206W_mRNA (Putative protein of unknown function; YDL206W is not an essential protein [Source:SGD;Acc:S000002365])

HSP 1 Score: 62.3882 bits (150), Expect = 1.525e-10
Identity = 56/175 (32.00%), Postives = 81/175 (46.29%), Query Frame = 3
Query: 1338 VIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAI-SAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIG 1859
            ++ +P+  IL L+IP    +         L  +  I SP+I    I        +  F L+ L L+I +     +  I +K N+      +   V FL S+  +    + IV  L  +  V +I +TILGLTI  + NSIGDLVSNI   +     IA  AC G PL   L G+G
Sbjct:  511 LVTTPVSIILYLSIPSEISQTDHDLPLSYLQNIQLIASPIILNQLIT------NNFSFWLLILSLVIAILLYFKTRTIPNKFNS-----DIIFTVAFLLSLACLSKAVHIIVVTLTHWINVFNISETILGLTIFTWGNSIGDLVSNITFVKIGVLEIAIGACFGSPLLYFLFGVG 674          
BLAST of slc24a-5 vs. Ensembl Yeast
Match: ECM27 (Protein involved in calcium homeostasis and exit from quiescence; required for proper trehalose levels during quiescence; may play a role in cell wall biosynthesis, mutants are hypersensitive to antifungal, Papulacandin B; null mutants have increased plasmid loss; interacts with Pdr5p [Source:SGD;Acc:S000003867])

HSP 1 Score: 61.2326 bits (147), Expect = 3.336e-10
Identity = 31/84 (36.90%), Postives = 49/84 (58.33%), Query Frame = 3
Query: 1653 IANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLAR---------------KKFPRIAYAACIGGPLFNLLVGIG 1859
            +AN ++ ++E +  +L + + ILGLTI A+ NS+GDL+SNI + R                KF  I+ A+C+GG + N + GIG
Sbjct:  545 LANSLIEMMEIYQKILGLSKAILGLTIFAWGNSVGDLISNISMCRLYKTQTHYQDRVRLATKFFMISCASCLGGVMLNSMGGIG 628          
BLAST of slc24a-5 vs. Ensembl Nematostella
Match: EDO31950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWG6])

HSP 1 Score: 130.568 bits (327), Expect = 1.503e-32
Identity = 69/197 (35.03%), Postives = 114/197 (57.87%), Query Frame = 3
Query: 1278 IIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGS-QGFILIHLVLIIGVCAAISAAITSKANAPPE-----YYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLV 1850
            ++P    +++   +F+KV  ++++P   +L +TIPV++ +E  + W K LN LH I  P+  +   + + V LG        H V++           TS+     +     +  +F ++ F+ S+ WIY  ANEIVNIL++FG+VL +   ILGLT LA+ NSIGDLV++  +AR+ FP +A  AC GGP+ ++L+
Sbjct:  236 VLPFTSADFELSGIFNKVFLILKAPAAVVLNVTIPVIDYDEPYQNWNKWLNVLHLITGPMFCVLATRAAKVSLGRLYKPPRCHWVVLYKPPRCHWVGFTSRQGFCSQIHKNCFLQMFGYLAFIVSVVWIYVTANEIVNILQSFGIVLGLSNAILGLTFLAWGNSIGDLVADTTMARQGFPNMATGACFGGPMLSILL 432          

HSP 2 Score: 86.2705 bits (212), Expect = 7.101e-18
Identity = 61/165 (36.97%), Postives = 93/165 (56.36%), Query Frame = 3
Query:   81 CNYVINRGSCSFDSGFINYFQWQFCGFDNRI-IPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTS-SPNXXXXXXXXXXXXXXXNT---VTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQ 560
            C +V     C    GFI Y  + +C     I +  +++F+  L L + + +TAD +F P L V++K LR+SQN+AGVT LA GNGA D+FS+++AV + S +PN +     I    ++V +    T G       F +  RP  +D++FYL A+ W MFI + RQ
Sbjct:    1 CAFVQANSDCDLSDGFIQYIHFIYCKLPKAIPLALVILFVLMLFLFIVLGITADDYFCPSLTVISKTLRLSQNVAGVTFLAYGNGAPDIFSAIAAVSAHSKNPNAAQLGAGIFVTTVVVGSVTLCTGG-------FHLNNRPFTRDVLFYLGAVSW-MFITMYRQ 157          
BLAST of slc24a-5 vs. Ensembl Nematostella
Match: EDO41421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I7])

HSP 1 Score: 64.6994 bits (156), Expect = 9.305e-11
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 3
Query: 1590 PEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPF 1868
            PE   L+  + FL SIFWI   +  +V      G    IP  ++GLT LA   S+ DL++++++ARK F  +A ++ IG  LF++ VG+ LP+
Sbjct:  481 PERRHLYP-ITFLMSIFWIAFFSYFMVWWATEVGYTFDIPTEVMGLTFLAAGTSVPDLITSVLVARKGFGDMAVSSSIGSNLFDITVGLPLPW 572          
BLAST of slc24a-5 vs. Ensembl Nematostella
Match: EDO48006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL3])

HSP 1 Score: 60.077 bits (144), Expect = 1.956e-9
Identity = 31/85 (36.47%), Postives = 55/85 (64.71%), Query Frame = 3
Query: 1623 FLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIA 1877
            F  SI W+ A++  +V  +   G   SIP+ I+GLT+LA  +S+ D++S++++A+     +A A CIG  +F++L  +GLP+ +A
Sbjct:  453 FALSIIWMAALSYVLVWTVSIIGETFSIPEYIMGLTLLAAGSSVPDVMSSLIVAKHGMGDMALANCIGSNIFDVLC-LGLPWLLA 536          
BLAST of slc24a-5 vs. Ensembl Nematostella
Match: EDO35212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM57])

HSP 1 Score: 58.151 bits (139), Expect = 6.992e-9
Identity = 29/84 (34.52%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 1623 FLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            F  SI WI  ++  +V ++   G +L++ +  +GL I+A   S+ D +S+I++AR  F  +A +  IG  +F++ +G+GLPF I
Sbjct:  361 FTMSIVWIAILSFGLVTVVGRSGCILNVDKFTMGLVIIAIGTSVPDALSSIIVARDGFGDMAVSNAIGSNVFDINLGLGLPFVI 444          
BLAST of slc24a-5 vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 53.5286 bits (127), Expect = 1.980e-7
Identity = 25/89 (28.09%), Postives = 53/89 (59.55%), Query Frame = 3
Query: 1623 FLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARY 1889
            F+  I WI   +  +V ++   G    IP +++GL+++AF +S+ D +S++ +ARK    +A +  +G  +F++L+ +G+P+ I    +
Sbjct:  325 FIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGDGDMAVSHTVGSNVFDILLCLGIPWLIKTTVW 413          
BLAST of slc24a-5 vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 134.42 bits (337), Expect = 5.088e-33
Identity = 87/257 (33.85%), Postives = 160/257 (62.26%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGS----QGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXX---XXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P++  +W+ +S   +VL V+++P+  +L L +PVV+ ++  K W + LNCLH +++P++ +  + F +   G+    + F L  L+L++G   A     T+  + PP+Y+++FA +GF+ S   I A A+E+V++L   GVVLS+  T+LGLT+LA+ NSIGD  S+I +A++ +PR+A +AC GG +FN+++G+GL   +   +     V+ +SE ++      ++ L  +++ I +P+ +F L   YGI ++  Y
Sbjct:  231 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCV--LAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNS-DVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFY 484          

HSP 2 Score: 98.9821 bits (245), Expect = 2.545e-21
Identity = 78/215 (36.28%), Postives = 125/215 (58.14%), Query Frame = 3
Query:   57 NKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXX-XXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHK 692
            N+T  E  C +V N   C  + GFINY    FC     + P    L  +W   L + + +TA  FF P L  ++  L ++ N+AGVT LALGNGA D+FS+++A    S P+ + LA+G++ GAG+ V TV AG + +  PF V  RP ++D+IFY++A+ W   +L R    L  ++ +L +YV+YV    +S  IY +Q+    T+ ++++++
Sbjct:    2 NRTPAER-CTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKRQRNYVNTSNQNSEYR 212          
BLAST of slc24a-5 vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 134.806 bits (338), Expect = 5.746e-33
Identity = 87/257 (33.85%), Postives = 160/257 (62.26%), Query Frame = 3
Query: 1284 PINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGS----QGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXX---XXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIY 2033
            P++  +W+ +S   +VL V+++P+  +L L +PVV+ ++  K W + LNCLH +++P++ +  + F +   G+    + F L  L+L++G   A     T+  + PP+Y+++FA +GF+ S   I A A+E+V++L   GVVLS+  T+LGLT+LA+ NSIGD  S+I +A++ +PR+A +AC GG +FN+++G+GL   +   +     V+ +SE ++      ++ L  +++ I +P+ +F L   YGI ++  Y
Sbjct:  261 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCV--LAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNS-DVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFY 514          

HSP 2 Score: 102.449 bits (254), Expect = 1.824e-22
Identity = 88/253 (34.78%), Postives = 135/253 (53.36%), Query Frame = 3
Query:   57 NKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIP--TILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXX-XXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKD-------------ESGSNIQ--YSRENRAYINDVEP 761
            N+T  E  C +V N   C  + GFINY    FC     + P    L  +W   L + + +TA  FF P L  ++  L ++ N+AGVT LALGNGA D+FS+++A    S P+ + LA+G++ GAG+ V TV AG + +  PF V  RP ++D+IFY++A+ W   +L R    L  ++ +L +YV+YV    +S  IY +Q+    T+ ++  H ++              +G NIQ  Y  E R  +   EP
Sbjct:    2 NRTPAER-CTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKRQRNYVNTSNQNAPHIQEFPSSDSSDDDLPNLTGGNIQQDYESEYRPLLPYSEP 250          
BLAST of slc24a-5 vs. Ensembl Medaka
Match: ENSORLT00000000373.2 (sodium/potassium/calcium exchanger 3 [Source:NCBI gene;Acc:101174615])

HSP 1 Score: 63.929 bits (154), Expect = 3.085e-10
Identity = 37/129 (28.68%), Postives = 72/129 (55.81%), Query Frame = 3
Query: 1488 VPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            VPL   G +L  L  ++    ++   +T    + P +   F  + F++S  WI  ++  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+GLP+++
Sbjct:  362 VPLHCPGGLLNKLKWLLAWPLSLLFYLTIPNCSSPRWEKCF-MLSFVSSTLWIAGLSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWAL 489          
BLAST of slc24a-5 vs. Ensembl Medaka
Match: ENSORLT00000003048.2 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:101170984])

HSP 1 Score: 63.1586 bits (152), Expect = 7.026e-10
Identity = 29/98 (29.59%), Postives = 57/98 (58.16%), Query Frame = 3
Query: 1581 NAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            N     +  +  V F T+  WI  ++  +V ++   G  L +P  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+GLP+++
Sbjct:  486 NCGKRRWERWFMVSFFTATIWIAGLSYIMVWMVTVIGFTLGLPDVIMGITFLAAGTSVPDCMASVIVARQGMGDMAISNSIGSNVFDILVGLGLPWAL 583          
BLAST of slc24a-5 vs. Ensembl Medaka
Match: slc24a4b (solute carrier family 24 member 4 [Source:NCBI gene;Acc:101164447])

HSP 1 Score: 60.8474 bits (146), Expect = 3.278e-9
Identity = 31/97 (31.96%), Postives = 57/97 (58.76%), Query Frame = 3
Query: 1584 APPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSI 1874
            A P +   F  + F+ S  WI   +  +V ++   G  L IP  I+G+T LA   S+ D ++++++AR+    +A +  IG  +F++LVG+G+P++I
Sbjct:  434 AKPRWERFF-MLSFILSTVWIAIFSYVMVWMVTVAGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWAI 529          
BLAST of slc24a-5 vs. Planmine SMEST
Match: SMESG000022809.1 (SMESG000022809.1)

HSP 1 Score: 1168.68 bits (3022), Expect = 0.000e+0
Identity = 680/685 (99.27%), Postives = 683/685 (99.71%), Query Frame = 3
Query:   36 MESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIYXXXXXXXXXXATNVIKVTL 2090
            MESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLT +EDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKK MNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAY+ACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIK+TL
Sbjct:    1 MESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLTKKEDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKFMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYSACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKITL 685          
BLAST of slc24a-5 vs. Planmine SMEST
Match: SMESG000022809.1 (SMESG000022809.1)

HSP 1 Score: 1055.43 bits (2728), Expect = 0.000e+0
Identity = 629/634 (99.21%), Postives = 632/634 (99.68%), Query Frame = 3
Query:  189 MFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIYXXXXXXXXXXATNVIKVTL 2090
            MFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLT +EDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKK MNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAY+ACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIK+TL
Sbjct:    1 MFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKRGKLTKKEDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSPNSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKFMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYSACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKITL 634          
BLAST of slc24a-5 vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 393/727 (54.06%), Postives = 507/727 (69.74%), Query Frame = 3
Query:   36 MESCNPKNKTFN--ESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKR-----------------------------GKLTTQEDTQHKKDESGS-NIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPM-QSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNR-----KRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPA----PKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIYXXXXXXXXXXATNVIKVTL 2090
            MESCNPKN T     + C YV N  +C FDSGF+NYF+WQ+CGFD+RI+PTILM LWFLVLLL+VA TADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA++S+++PNV LALGSILGAGILVNT+TAGIIMII PF++MRRPIIKD+IFYL+ALLWC  IL+RR+IE WSS+VFL IY++YV VT +SRA+Y+K K+                              K    ++  H    +G  N  Y  EN      V   N LN   ++       +  +  +  +  S  P+  S    R+ S  +R+MGS AKIII+NE+ +EI++    +       KRS+SL    +      + RF S D         T    R+I+EF++ A     K +I   +NQ  +S++   L ++   D    +  + FPG FKHFL+ I+P++ ++W   S+F K+L+++QSPIMFILTLTI VVEE+ +LKGWCK+LNCLHC+LSPLIWITFI  +  P+G+ GFI+ +L+LIIG+ A IS AITSK+N+PP Y   FAF+GF+TSIFWIY I NEIVN+L T GVV SIPQTILGL+ILAFANS+GDLVSNI LA++ +PRIAYAACIGGPLFNLLVGIGLPFSI  A+   I + LKS+T+VL+ TI L+T MNLI LP+++FR+  +YGII++ IY++F + ++ FATN+I VT+
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSAD---------TNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDD----SSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQ-KPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 713          
BLAST of slc24a-5 vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 376/727 (51.72%), Postives = 489/727 (67.26%), Query Frame = 3
Query:   36 MESCNPKNKTFN--ESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKR-----------------------------GKLTTQEDTQHKKDESGS-NIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPM-QSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNR-----KRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPA----PKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSEXXXXXXXXXXXXXXXXXXXPVMRFRLRPVYGIIMIVIYXXXXXXXXXXATNVIKVTL 2090
            MESCNPKN T     + C YV N  +C FDSGF+NYF+WQ+CGFD+RI+PTILM LWFLVLLL+VA TADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA++S+++PNV LALGSILGAGILVNT+TAGIIMII PF++MRRPIIKD+IFYL+ALLWC  IL+RR+IE WSS+VFL IY++YV VT +SRA+Y+K K+                              K    ++  H    +G  N  Y  EN      V   N LN   ++       +  +  +  +  S  P+  S    R+ S  +R+MGS AKIII+NE+ +EI++    +       KRS+SL    +      + RF S D         T    R+I+EF++ A     K +I   +NQ  +S++   L ++   D    +  + FPG FKHFL+ I+P++ ++W   S+F K+L+++QSPIMFILTLTI VVEE+ +LKGWCK+LNCLHC+LSPLIWITFI  +  P+G+ GFI+ +L+LIIG+ A IS AITSK+N+PP Y   FAF+GF+TSIFWIY I NEIVN+L T           LGL +        DLVSNI LA++ +PRIAYAACIGGPLFNLLVGIGLPFSI  A+   I + LKS+T+VL+ TI L+T MNLI LP+++FR+  +YGII++ IY++F + ++ FATN+I VT+
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSAD---------TNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDD----SSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGT-----------LGLEVCEI-----DLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQ-KPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 697          
BLAST of slc24a-5 vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 392.119 bits (1006), Expect = 7.826e-129
Identity = 264/522 (50.57%), Postives = 339/522 (64.94%), Query Frame = 3
Query:   36 MESCNPKNKTFN--ESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFXXXXXXXXXXXDSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNXXXXXXXXXXXXXXXNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWXXXXXXXXXXXXXXXXXXXRAIYVKQKR-----------------------------GKLTTQEDTQHKKDESGS-NIQYSRENRAYINDVEPCXXXXXXXXXXXXXXXXXXXXXDSERNHLSLIPM-QSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILEAKKNMNR-----KRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPA----PKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFI 1475
            MESCNPKN T     + C YV N  +C FDSGF+NYF+WQ+CGFD+RI+PTILM LWFLVLLL+VA TADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSA++S+++PNV LALGSILGAGILVNT+TAGIIMII PF++MRRPIIKD+IFYL+ALLWC  IL+RR+IE WSS+VFL IY++YV VT +SRA+Y+K K+                              K    ++  H    +G  N  Y  EN      V   N LN   ++       +  +  +  +  S  P+  S    R+ S  +R+MGS AKIII+NE+ +EI++    +       KRS+SL    +      + RF S D         T    R+I+EF++ A     K +I   +NQ  +S++   L ++   D    T    FPG FKHFL+ I+P++ ++W   S+F K+L+++QSPIMFILTLTI VVEE+ +LKGWCK+LNCLHC+LSPLIWITFI
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSAD---------TNMAARRIEEFKNIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLT----FPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFI 509          
The following BLAST results are available for this feature:
BLAST of slc24a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC8B15.867e-4341.54solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B14.003e-4237.40solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B11.271e-4137.40solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B11.271e-4137.40solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B13.626e-2037.95solute carrier family 8 member B1 [Source:HGNC Sym... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-84.126e-5629.29Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16... [more]
ncx-72.376e-3736.95Putative sodium/calcium exchanger 7 [Source:UniPr... [more]
ncx-63.230e-3733.94Putative sodium/calcium exchanger 6 [Source:UniPr... [more]
ncx-96.234e-3330.33Mitochondrial sodium/calcium exchanger protein [S... [more]
ncx-101.115e-2627.15Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q96... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG123766.101e-3029.11gene:FBgn0033323 transcript:FBtr0088706[more]
CG123761.156e-2929.11gene:FBgn0033323 transcript:FBtr0339335[more]
CG53481.357e-2827.37gene:FBgn0034156 transcript:FBtr0305318[more]
CG147445.429e-2827.89gene:FBgn0033324 transcript:FBtr0307024[more]
CG147431.778e-2122.88gene:FBgn0033326 transcript:FBtr0307023[more]
back to top
BLAST of slc24a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b12.247e-2440.96solute carrier family 8 member B1 [Source:ZFIN;Acc... [more]
slc24a4a1.686e-927.92solute carrier family 24 member 4a [Source:ZFIN;Ac... [more]
CABZ01081780.11.931e-932.00sodium/potassium/calcium exchanger 2-like [Source:... [more]
slc24a4b2.970e-927.78solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a4b3.032e-927.78solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b12.226e-4534.77solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b17.277e-4534.77solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b13.733e-4438.55solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b18.040e-4438.55solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b12.415e-2443.03solute carrier family 8 (sodium/lithium/calcium ex... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc8b16.859e-4531.35solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b12.391e-4431.35solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b12.978e-4432.92solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b12.564e-2929.96solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc24a37.832e-1030.61solute carrier family 24 (sodium/potassium/calcium... [more]
back to top
BLAST of slc24a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AXS0|NCLX_RAT8.351e-4433.23Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q925Q3|NCLX_MOUSE2.083e-4332.92Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q6J4K2|NCLX_HUMAN6.104e-4137.40Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|P34322|NCX7_CAEEL3.022e-3636.95Putative sodium/calcium exchanger 7 OS=Caenorhabdi... [more]
sp|P34315|NCX6_CAEEL4.108e-3633.94Putative sodium/calcium exchanger 6 OS=Caenorhabdi... [more]
back to top
BLAST of slc24a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF400.000e+0100.00Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFD72.965e-9747.10Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKA12.317e-9147.24Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A293N1M17.876e-6929.19Na+/Ca2+ exchanger (Fragment) OS=Ornithodoros erra... [more]
A0A1V9XJM52.125e-6330.48Sodium/potassium/calcium exchanger 6-like (Fragmen... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b12.944e-3536.09solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc24a34.904e-1032.63solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a37.425e-1032.63solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a4b1.727e-932.99sodium/potassium/calcium exchanger 4 [Source:NCBI ... [more]
slc24a4b2.187e-932.99sodium/potassium/calcium exchanger 4 [Source:NCBI ... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC8B13.006e-3640.10solute carrier family 8 member B1 [Source:HGNC Sym... [more]
slc24a4b8.169e-1032.67solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a12.888e-932.04solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDL206W_mRNA1.525e-1032.00Putative protein of unknown function; YDL206W is n... [more]
ECM273.336e-1036.90Protein involved in calcium homeostasis and exit f... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319501.503e-3235.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414219.305e-1137.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480061.956e-936.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352126.992e-934.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320481.980e-728.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc24a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b15.088e-3333.85solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc8b15.746e-3333.85solute carrier family 8 member B1 [Source:NCBI gen... [more]
ENSORLT00000000373.23.085e-1028.68sodium/potassium/calcium exchanger 3 [Source:NCBI ... [more]
ENSORLT00000003048.27.026e-1029.59solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a4b3.278e-931.96solute carrier family 24 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc24a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022809.10.000e+099.27SMESG000022809.1[more]
SMESG000022809.10.000e+099.21SMESG000022809.1[more]
SMESG000022808.10.000e+054.06SMESG000022808.1[more]
SMESG000022808.10.000e+051.72SMESG000022808.1[more]
SMESG000022808.17.826e-12950.57SMESG000022808.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029849
GenBankAKN21565.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029849 ID=SMED30029849|Name=slc24a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=2128bp
CTCTTATTGATACCATTTCAAGTTAGAAATTGAAAATGGAGTCATGCAAT
CCAAAAAATAAGACTTTTAATGAAAGTTTTTGCAATTATGTAATTAATAG
AGGTTCATGTAGTTTTGATTCTGGGTTCATAAATTACTTTCAATGGCAAT
TCTGTGGATTTGATAATCGAATTATCCCGACTATACTAATGTTTCTCTGG
TTTCTCGTTCTTCTCTTAGCAGTGGCCGTGACGGCTGACAGTTTCTTTGC
TCCATGTCTTGTTGTCGTTACAAAGATTTTAAGAATGAGTCAAAATTTAG
CAGGTGTTACACTTTTAGCTCTGGGAAATGGGGCTGCCGACGTATTTAGT
TCACTATCTGCAGTAATATCTACTAGCAGTCCAAATGTCAGTCTGGCTCT
TGGATCCATTTTAGGTGCAGGAATTCTGGTAAATACTGTAACTGCGGGAA
TTATCATGATTATTGTCCCGTTTGATGTTATGAGGAGACCTATAATAAAG
GATTTGATATTCTACTTATTAGCTTTGCTTTGGTGTATGTTTATTTTGAT
TCGTAGACAAATTGAACTGTGGTCTTCGGTAGTGTTTCTGATAATCTATG
TCATATATGTGACAGTAACTGGTGTTTCTCGAGCTATTTATGTTAAACAA
AAAAGAGGAAAATTAACTACACAAGAAGATACCCAACATAAAAAAGATGA
ATCTGGTTCTAATATTCAATATAGCCGAGAAAATCGTGCATATATAAACG
ATGTTGAACCATGTAATTCTCTAAATTCCCTCCCATCATCGTTGCAATCG
CCAAATTCACTCACAAATTCAAATCAAGATTCGGAGAGAAATCATTTATC
GCTTATTCCAATGCAAAGTTTTAGATCCAAAAGAATTCCTTCTATAAGAA
ACCGTACAATGGGATCAATTGCAAAAATTATAATAGAAAATGAATATCAT
AAAGAAATACTGGAAGCAAAAAAAAATATGAACCGAAAACGAAGTTTATC
TTTGGATCTAGCAACTGAAAAGCCAAAATTTAATAATCGAAAAAGATTTA
TTTCACTTGATCAAGAAAATTTAAAAGAAATAAAGAAAACCGAAAAAGAA
AACCGTAAAATAAAAGAATTTCAAAGCCCAGCGCCAAAAATAAATATTAT
TAGTGAAGAAAATCAAATTGAAAAAAGTTCAGTTGACTCAACTTTACATA
CTAGTTCCGAATCAGACATTGATGTTGAAACTAAAGACGTTCAGTTTCCG
GGATTGTTTAAACATTTCCTCATGAAAATTATCCCGATTAATTTTGAGGA
ATGGAAAGAGCAGTCATTATTTTCAAAAGTTCTCTCAGTTATTCAGAGCC
CTATAATGTTCATTTTAACATTAACAATTCCTGTAGTTGAAGAAGAAGAA
TACTTGAAAGGCTGGTGCAAATTACTGAACTGTTTGCATTGTATTTTGTC
ACCACTTATTTGGATAACATTCATCAAATTCAGTGCAGTACCTCTTGGAA
GTCAAGGATTTATTCTGATACACTTGGTTCTGATAATAGGGGTATGTGCC
GCAATATCAGCTGCCATTACATCAAAAGCCAATGCCCCTCCAGAGTACTA
TTCACTTTTTGCATTTGTAGGTTTTTTAACTTCAATATTTTGGATATATG
CAATAGCAAATGAAATAGTCAATATCCTAGAAACATTTGGGGTGGTCCTA
TCTATCCCCCAAACAATACTTGGCTTGACTATTTTGGCGTTTGCTAATTC
CATTGGAGATTTGGTGTCAAATATAATGCTGGCAAGGAAAAAGTTTCCAA
GAATCGCTTATGCTGCATGTATTGGAGGTCCATTGTTTAATCTTTTGGTA
GGAATCGGTCTACCGTTCTCCATAGCTAATGCAAGATACGGTAAAATAAA
AGTAGAGTTGAAATCAGAAACAATTGTTTTAATATCTACCATATTACTGA
TTACAATAATGAATCTTATTTATTTGCCGGTAATGAGATTTCGATTGAGA
CCTGTTTATGGAATAATTATGATTGTTATTTATGTTTTATTTTTACTCTT
TGTTTTGCTTTTCGCTACAAATGTGATAAAAGTAACTTTATAAGACGAAT
AAATTTTCATTTTAATTTTTTAAAAAAA
back to top

protein sequence of SMED30029849-orf-1

>SMED30029849-orf-1 ID=SMED30029849-orf-1|Name=SMED30029849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=686bp
MESCNPKNKTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTI
LMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGA
ADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMR
RPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRA
IYVKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLP
SSLQSPNSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIII
ENEYHKEILEAKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIK
KTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETK
DVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPV
VEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLI
IGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILET
FGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPL
FNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVM
RFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKVTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000087proximal tubule
PLANA:0000208testis
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019774Aromatic-AA_hydroxylase_C
IPR004837NaCa_Exmemb
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004837Sodium/calcium exchanger membrane regionPFAMPF01699Na_Ca_excoord: 526..674
e-value: 2.5E-28
score: 99.0
coord: 53..194
e-value: 2.1E-20
score: 73.2
NoneNo IPR availableGENE3DG3DSA:1.20.1420.30coord: 487..677
e-value: 1.4E-13
score: 52.7
coord: 84..204
e-value: 3.7E-11
score: 44.7
NoneNo IPR availablePANTHERPTHR12266NA+/CA2+ K+ INDEPENDENT EXCHANGERcoord: 12..680
NoneNo IPR availableTMHMMTMhelixcoord: 463..480
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
NoneNo IPR availableTMHMMTMhelixcoord: 157..176
NoneNo IPR availableTMHMMTMhelixcoord: 125..144
NoneNo IPR availableTMHMMTMhelixcoord: 88..110
NoneNo IPR availableTMHMMTMhelixcoord: 656..678
NoneNo IPR availableTMHMMTMhelixcoord: 590..612
NoneNo IPR availableTMHMMTMhelixcoord: 521..540
NoneNo IPR availableTMHMMTMhelixcoord: 490..512
NoneNo IPR availableTMHMMTMhelixcoord: 627..649
NoneNo IPR availableTMHMMTMhelixcoord: 555..577
NoneNo IPR availableTMHMMTMhelixcoord: 181..203