IRS-type PTB domain-containing protein

Overview
NameIRS-type PTB domain-containing protein
Smed IDSMED30029829
Length (bp)1308
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IRS-type PTB domain-containing protein (SMED30029829) t-SNE clustered cells

Violin plots show distribution of expression levels for IRS-type PTB domain-containing protein (SMED30029829) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IRS-type PTB domain-containing protein (SMED30029829) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IRS-type PTB domain-containing protein (SMED30029829) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Match: DOK6 (docking protein 6 [Source:HGNC Symbol;Acc:HGNC:28301])

HSP 1 Score: 48.1358 bits (113), Expect = 3.641e-6
Identity = 17/43 (39.53%), Postives = 30/43 (69.77%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            +++  +WP+ ++R +G    +F+FESGR   TGEG FTF+ ++
Sbjct:   77 KVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTRE 119          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Match: FRS3 (fibroblast growth factor receptor substrate 3 [Source:HGNC Symbol;Acc:HGNC:16970])

HSP 1 Score: 47.7506 bits (112), Expect = 5.078e-6
Identity = 21/48 (43.75%), Postives = 26/48 (54.17%), Query Frame = 2
Query:  551 VLPRDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            VL   R     WP   +R +G+  N FSFESGR   TG+G F FK  +
Sbjct:   70 VLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSR 117          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Match: dok6 (docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410-50])

HSP 1 Score: 49.6766 bits (117), Expect = 3.419e-6
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKESL 739
            R++  +WP+ ++R +G    +F+FESGR   TGEG FTF+ ++  +      S   S+
Sbjct:  152 RVKLVMWPLNSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQRVHSATLSI 209          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Match: dok6 (docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410-50])

HSP 1 Score: 49.6766 bits (117), Expect = 3.838e-6
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKESL 739
            R++  +WP+ ++R +G    +F+FESGR   TGEG FTF+ ++  +      S   S+
Sbjct:  173 RVKLVMWPLNSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQRVHSATLSI 230          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Match: dok6 (docking protein 6 [Source:NCBI gene;Acc:103027524])

HSP 1 Score: 49.2914 bits (116), Expect = 3.771e-6
Identity = 18/43 (41.86%), Postives = 30/43 (69.77%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            R++  +WP+ ++R +G    +F+FESGR   TGEG FTF+ ++
Sbjct:  173 RVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTRE 215          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Match: dok6 (docking protein 6 [Source:NCBI gene;Acc:103027524])

HSP 1 Score: 49.2914 bits (116), Expect = 3.910e-6
Identity = 18/43 (41.86%), Postives = 30/43 (69.77%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            R++  +WP+ ++R +G    +F+FESGR   TGEG FTF+ ++
Sbjct:  173 RVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTRE 215          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Sea Lamprey
Match: dok6 (docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410-50])

HSP 1 Score: 48.1358 bits (113), Expect = 1.322e-6
Identity = 19/40 (47.50%), Postives = 26/40 (65.00%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFK 685
            RLR   WP+ ++R +G     F+FE+GR   TGEG FTF+
Sbjct:   79 RLRLLTWPLVSLRRYGRDATRFTFEAGRSCDTGEGLFTFQ 118          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Sea Lamprey
Match: dok6 (docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410-50])

HSP 1 Score: 47.7506 bits (112), Expect = 2.278e-6
Identity = 19/43 (44.19%), Postives = 28/43 (65.12%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            R+R   WP+ ++R +G     F+FESGR   TGEG FTF+ ++
Sbjct:  151 RVRLVSWPLSSLRRYGRDPTRFTFESGRMCDTGEGLFTFQTRE 193          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Sea Lamprey
Match: frs2a (fibroblast growth factor receptor substrate 2a [Source:ZFIN;Acc:ZDB-GENE-060503-462])

HSP 1 Score: 47.3654 bits (111), Expect = 4.503e-6
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 2
Query:  560 RDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            RD +R   WP   +R +G+  N FSFESGR   TG+G F FK  +
Sbjct:   51 RDAVR---WPYTCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCAR 92          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: dok6 (docking protein 6 [Source:NCBI gene;Acc:101168752])

HSP 1 Score: 50.8322 bits (120), Expect = 1.197e-6
Identity = 30/96 (31.25%), Postives = 50/96 (52.08%), Query Frame = 2
Query:  566 RLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKESLYHANAKPKVNGKYLESSEISPEYYNLTAPDSYQMSRSA 853
            RL+  +WP+ ++R +G    +F+FESGR   TGEG FTF+ ++  +      S   +L  A    ++  +  +SS+I   +   T   S  + RSA
Sbjct:  173 RLKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQRVHSA--TLAIAQQHERMMEEMEKSSQI---HSRETITKSISLPRSA 263          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: dok1b (docking protein 1 [Source:NCBI gene;Acc:101173260])

HSP 1 Score: 50.447 bits (119), Expect = 3.040e-6
Identity = 23/55 (41.82%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  542 ENDVL----PRDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            E+DVL    P+ + R  VWP + +R +G     FSFE+GR   +G G FTF  K+
Sbjct:  187 ESDVLILKEPKTKRRVLVWPYKLLRRYGRDRVMFSFEAGRRCESGPGNFTFDTKQ 241          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: dok1b (docking protein 1 [Source:NCBI gene;Acc:101173260])

HSP 1 Score: 50.0618 bits (118), Expect = 3.123e-6
Identity = 23/55 (41.82%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  542 ENDVL----PRDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKK 694
            E+DVL    P+ + R  VWP + +R +G     FSFE+GR   +G G FTF  K+
Sbjct:  187 ESDVLILKEPKTKRRVLVWPYKLLRRYGRDRVMFSFEAGRRCESGPGNFTFDTKQ 241          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: frs2b (fibroblast growth factor receptor substrate 2 [Source:NCBI gene;Acc:101158925])

HSP 1 Score: 49.2914 bits (116), Expect = 5.117e-6
Identity = 24/59 (40.68%), Postives = 31/59 (52.54%), Query Frame = 2
Query:  560 RDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKES 736
            RD +R   WP   +R +G+  N FSFESGR   TG+G F FK  +     +  Q V  S
Sbjct:   52 RDDVR---WPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNMLQEVMHS 107          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: frs2b (fibroblast growth factor receptor substrate 2 [Source:NCBI gene;Acc:101158925])

HSP 1 Score: 49.2914 bits (116), Expect = 5.929e-6
Identity = 24/59 (40.68%), Postives = 31/59 (52.54%), Query Frame = 2
Query:  560 RDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKES 736
            RD +R   WP   +R +G+  N FSFESGR   TG+G F FK  +     +  Q V  S
Sbjct:   52 RDDVR---WPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNMLQEVMHS 107          
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Match: SMESG000039406.1 (SMESG000039406.1)

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 341/341 (100.00%), Postives = 341/341 (100.00%), Query Frame = 2
Query:  128 MGVFWSQGIKCDKKLIKTLIDNETWFDATLIEYSASSIFNKIDWNFTLPRSSKKGNSKSSVLSTGYILNKSRKCFGRITVQDDCIIFQGINCNELLKAIVAHQDKSPTSADSNFSEALDNSVPYXXXXXXXXXXXXXIENDVLPRDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKESLYHANAKPKVNGKYLESSEISPEYYNLTAPDSYQMSRSALNGGLDRTKSNSQSTEYFFNSYHSASSPATERSYRNLPSSINYCKIDFSESYLNAQANPNGRRRVKSNGTLSKTGESIHYLTICENQTKAVEKVLQRIG 1150
            MGVFWSQGIKCDKKLIKTLIDNETWFDATLIEYSASSIFNKIDWNFTLPRSSKKGNSKSSVLSTGYILNKSRKCFGRITVQDDCIIFQGINCNELLKAIVAHQDKSPTSADSNFSEALDNSVPYNNSASSASTTSGGIENDVLPRDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKESLYHANAKPKVNGKYLESSEISPEYYNLTAPDSYQMSRSALNGGLDRTKSNSQSTEYFFNSYHSASSPATERSYRNLPSSINYCKIDFSESYLNAQANPNGRRRVKSNGTLSKTGESIHYLTICENQTKAVEKVLQRIG
Sbjct:    1 MGVFWSQGIKCDKKLIKTLIDNETWFDATLIEYSASSIFNKIDWNFTLPRSSKKGNSKSSVLSTGYILNKSRKCFGRITVQDDCIIFQGINCNELLKAIVAHQDKSPTSADSNFSEALDNSVPYNNSASSASTTSGGIENDVLPRDRLRTFVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSVKESLYHANAKPKVNGKYLESSEISPEYYNLTAPDSYQMSRSALNGGLDRTKSNSQSTEYFFNSYHSASSPATERSYRNLPSSINYCKIDFSESYLNAQANPNGRRRVKSNGTLSKTGESIHYLTICENQTKAVEKVLQRIG 341          
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Match: SMESG000059045.1 (SMESG000059045.1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.580e-6
Identity = 33/101 (32.67%), Postives = 49/101 (48.51%), Query Frame = 2
Query:  578 FVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQ-SVKESLYHANAKPKVNGKYL--------ESSEISPEYYNLT-APDSYQMSRS 850
            F WP+ T+R + +  N F F+ GR S TGEG F F   +  +    F+  + E+  H+N     +G +L        ++S I P    LT  P S Q +RS
Sbjct:  101 FSWPLTTLRWYAYTHNMFIFQCGRKSPTGEGTFIFSCNEYQILKETFEYLMNENQIHSNWD---DGTHLFPPSNFRRQNSAIEPRTEMLTLLPSSLQFNRS 198          
The following BLAST results are available for this feature:
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DOK63.641e-639.53docking protein 6 [Source:HGNC Symbol;Acc:HGNC:283... [more]
FRS35.078e-643.75fibroblast growth factor receptor substrate 3 [Sou... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dok63.419e-634.48docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410... [more]
dok63.838e-634.48docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dok63.771e-641.86docking protein 6 [Source:NCBI gene;Acc:103027524][more]
dok63.910e-641.86docking protein 6 [Source:NCBI gene;Acc:103027524][more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dok61.322e-647.50docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410... [more]
dok62.278e-644.19docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410... [more]
frs2a4.503e-646.67fibroblast growth factor receptor substrate 2a [So... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dok61.197e-631.25docking protein 6 [Source:NCBI gene;Acc:101168752][more]
dok1b3.040e-641.82docking protein 1 [Source:NCBI gene;Acc:101173260][more]
dok1b3.123e-641.82docking protein 1 [Source:NCBI gene;Acc:101173260][more]
frs2b5.117e-640.68fibroblast growth factor receptor substrate 2 [Sou... [more]
frs2b5.929e-640.68fibroblast growth factor receptor substrate 2 [Sou... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000039406.10.000e+0100.00SMESG000039406.1[more]
SMESG000059045.13.580e-632.67SMESG000059045.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029829 ID=SMED30029829|Name=IRS-type PTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1308bp
ATAAATCATAAGTAGTTTCAATTTCAATTTATTCAATGTCTGACAGATAA
TATCTAAAAAAATTATAATTTAATTTATGAACTGAGTTAATTATTCCAAT
TTGTAAGTGAATTTTTTTTATTTTGAAATGGGTGTTTTTTGGTCGCAAGG
TATAAAATGTGATAAGAAGCTGATAAAAACATTAATTGACAATGAAACTT
GGTTCGATGCAACATTAATAGAATACAGCGCTTCTTCCATATTTAATAAA
ATCGATTGGAATTTTACTTTACCTAGGTCTTCGAAGAAAGGAAATAGCAA
ATCGAGTGTTTTAAGCACCGGTTATATTTTAAATAAATCTCGCAAATGTT
TCGGTCGAATTACTGTTCAAGACGATTGCATCATATTCCAGGGAATCAAT
TGCAACGAGCTATTGAAAGCCATTGTAGCCCATCAAGATAAATCCCCCAC
ATCTGCCGATTCCAATTTTTCTGAAGCACTTGACAACAGCGTTCCTTACA
ATAATTCTGCGTCGTCAGCTTCAACAACCAGTGGTGGAATTGAAAACGAC
GTATTGCCCAGGGATCGGCTGCGTACATTTGTCTGGCCCATTGAAACTGT
CAGGCATTTTGGATTCAAAGAAAATTTTTTTTCTTTTGAATCAGGCAGAT
ACTCATCAACTGGTGAAGGACGGTTCACATTTAAAATCAAAAAATTAGTT
TTATTTTTATCAAATTTCCAAAGTGTGAAGGAAAGTCTCTATCATGCTAA
TGCAAAACCAAAAGTCAATGGTAAATACCTGGAATCCAGTGAAATATCTC
CTGAATATTACAATCTCACAGCTCCTGATTCATATCAAATGTCCAGAAGT
GCCTTGAATGGTGGCCTAGACAGAACGAAATCTAATTCACAATCAACCGA
ATATTTCTTTAATTCCTACCATTCGGCGTCGTCGCCAGCCACTGAGAGAA
GTTATCGCAATTTGCCCTCCTCCATCAACTACTGTAAGATCGATTTCAGC
GAATCATATTTGAATGCACAAGCCAATCCCAACGGCCGTCGACGAGTGAA
ATCAAATGGGACGCTCTCAAAAACCGGAGAATCGATTCATTATTTGACTA
TTTGTGAAAATCAAACAAAAGCGGTTGAAAAAGTGTTACAAAGGATTGGT
TAAAATCGTTTTATGTGACTCTGTCTTTCCATTTGTGATTGATTGTGAGC
ATACATATGTATATATCATATGTTTATTTATTTATTTATATGTTCGTGTG
TGTGTGTGTGTTATTTGGCCCGTGATATTTTATTCGCTATGCACAATATC
AATATTTA
back to top

protein sequence of SMED30029829-orf-1

>SMED30029829-orf-1 ID=SMED30029829-orf-1|Name=SMED30029829-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MGVFWSQGIKCDKKLIKTLIDNETWFDATLIEYSASSIFNKIDWNFTLPR
SSKKGNSKSSVLSTGYILNKSRKCFGRITVQDDCIIFQGINCNELLKAIV
AHQDKSPTSADSNFSEALDNSVPYNNSASSASTTSGGIENDVLPRDRLRT
FVWPIETVRHFGFKENFFSFESGRYSSTGEGRFTFKIKKLVLFLSNFQSV
KESLYHANAKPKVNGKYLESSEISPEYYNLTAPDSYQMSRSALNGGLDRT
KSNSQSTEYFFNSYHSASSPATERSYRNLPSSINYCKIDFSESYLNAQAN
PNGRRRVKSNGTLSKTGESIHYLTICENQTKAVEKVLQRIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR002404IRS_PTB
IPR011993PH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005158insulin receptor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01244IRS_2coord: 124..202
e-value: 0.0023
score: 15.4
NoneNo IPR availableGENE3DG3DSA:2.30.29.250coord: 91..237
e-value: 3.2E-13
score: 51.5
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 150..205
IPR002404IRS-type PTB domainPFAMPF02174IRScoord: 146..189
e-value: 1.0E-10
score: 41.3