ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30029825
Length (bp)5627
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30029825) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30029825) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30029825) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30029825) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029825

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029825h1SMcG0008236 SmedASXL_015658SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30029825h1SMcG0008237 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029825h1SMcG0008237 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029825h1SMcG0008236 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029825h1SMcG0008236 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30029825h1SMcG0008236 dd_Smed_v4_21003_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029825h1SMcG0008236 dd_Smed_v4_21003_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029825h1SMcG0008236 dd_Smed_v4_21003_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30029825h1SMcG0008236 dd_Smed_v4_21003_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029825h1SMcG0008236 dd_Smed_v6_21003_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30029825h1SMcG0008237 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029825h1SMcG0008237 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029825h1SMcG0008236 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029825h1SMcG0008236 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 328.561 bits (841), Expect = 3.433e-90
Identity = 251/810 (30.99%), Postives = 401/810 (49.51%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAM-------------MLVNLPNN------EGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE++K LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+             +L+   NN       G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHL+A  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LLG+++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +   PL  AA   HT +++ LL+N  S  +L  N
Sbjct:   34 AGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRAAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAA---TTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHAA------------AKNGYTPLHIAAKKNQMDIATTLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLGRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVN 778          

HSP 2 Score: 282.722 bits (722), Expect = 5.961e-76
Identity = 252/803 (31.38%), Postives = 388/803 (48.32%), Query Frame = 2
Query: 1352 SGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLP----NNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEH--KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEM 3736
            +G  A+H+A ++  VE +  L    A ++     G T LHIA+      ++K L +  A+VN       + L+MAA++ H ++V+ L+D      L  + +G T + V    GH +    LL          K     LH AA+         LL    N +  +K  +TPLHIA  YGN  V   L+   A V+F     D +PLHVA+   N     ++LL  GA ++   ++G + LH  +RSG+ ++++ LL   A      K+G SPLH+  +  H   VQ L+                N+P     N+  TA+H AA     +         + K+LL+   +   +      TPLH  A   N   ++E+   L+H   IQ V     ++G +P+  A+  GH  IVS L+ + A  +  +  G TALH+AA  G   V   L+   A V AK+K   TPLH++A+ G  D+V++L+ +  A+ +A T +  TPLHL+A+ G ++V   LL H    A       +G TPLH+AAK    +V  L L+ K      A   G+T  H+AA   +  V    +    S     KN   G T LH+AA+     +   LL+ GA+       G+  +HLAA+ GH  ++ +L  + +   +SNKSG+TPLH+AA   +++ V E+L +  A++            D  T+ G TPLH+    G+  +V  LL     +VN+ T  NG TPLH A+Q GHT++ ++LL    S N++T     G TAL  A   G+I +
Sbjct:   56 NGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN-DITPLHVASKRGNA-NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--------------NVPVDDVTNDYLTALHVAAHCGHYK---------VAKVLLDKKANPNAKA-LNGFTPLH-IACKKNRIKVMEL--LLKHGASIQAVT----ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG-ASPNAATTSGYTPLHLSAREGHEDVAAFLLDHG---ASLSITTKKGFTPLHVAAKYGKLEVANLLLQ-KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN---GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHV------------DAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKT-KNGYTPLHQAAQQGHTHIINVLLQNNASPNELT---VNGNTALGIARRLGYISV 794          

HSP 3 Score: 281.567 bits (719), Expect = 1.462e-75
Identity = 253/843 (30.01%), Postives = 398/843 (47.21%), Query Frame = 2
Query: 1343 KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI--GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS----FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            KK   +A+   A R   +E           IN+ N  G   LH+A+ EG+ E + + LQ   A+V+       +ALH+A+  G  ++V++L+     NV  + + G T +++ +   H E    LL  G    +  + G   L  A Q GH  VV  LL+     + + K     LHIA +  +      L+     A V  K G    +PLH+AA   N    A +LL   A V+ T +N  + LH+AS+ GN  M+K LL  GA      +DG +PLH G R  H  +V+ L+       +KTK+              G + +H A +          +  + +++LL+++  V  +   Y   T LH  A  G+  V   +++   +      N +A NG++PL  A      +++ +LLK+ A +    E G+T +H+AA  GH N+ + L+ H A  N  +  G T LH+AA++G  ++V  L+ ++ A V+A   + +TPLH++A+ G+ ++ + LL      A P AA + G TPLHL+A+  H DV    L     L I  +  G T  H+AA  G L V    ++  KS       KS G T LH+AA   + K+  +LLD GA+P     +G T LH+AAK     +   L    +      + G+  +H+AA  G +D V  +L    AN+            ++  +SGLTPLHLA+Q    N+  +L+N  G  V++ T   G TPLH     G+  + + LL + S ++  +   G T LH A+  GH  +  + +   A  N     G T L  A + GY+ V   L
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQRE-ANVDAATKKGNTALHIASLAGQAEVVKVLVTN-GANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGF---TPLHIAAHYGN-INVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKN--------------GLSPLHMATQ---------GDHLNCVQLLLQHNVPVDDVTNDYL--TALHVAAHCGHYKVAKVLLDKKANP-----NAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG---ASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSI-TTKKGFTPLHVAAKYGKLEVANLLLQ--KSASPDAAGKS-GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVS-LLLGRNANV------------NLSNKSGLTPLHLAAQEDRVNVAEVLVN-QGAHVDAQT-KMGYTPLHVGCHYGNIKIVNFLL-QHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 798          

HSP 4 Score: 274.248 bits (700), Expect = 2.368e-73
Identity = 237/796 (29.77%), Postives = 383/796 (48.12%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  K  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    + +++            + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ ++LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G T LH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDNNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACK-KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA----------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLSAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 799          

HSP 5 Score: 216.468 bits (550), Expect = 1.480e-55
Identity = 182/587 (31.01%), Postives = 280/587 (47.70%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL  +A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  ++ + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+      V  + K+  T +H+++  G  +    LL++G   +    +G   LH +A+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  +LL+ GAD + + + G + +H+  +  H  +V  L+               VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++PL  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  251 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLL-DRAAPILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNA---KALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 798          

HSP 6 Score: 98.5969 bits (244), Expect = 1.176e-19
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV++N   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V K L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   31 AARAGHLEKALDYIKN--GVDIN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 7 Score: 85.5001 bits (210), Expect = 1.172e-15
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q    +  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   31 AARAGHLEKALDYIKNGVDINIC-NQNGLNALHLASKEGHVEVVSELLQR-EANV------------DAATKKGNTALHIASLAGQAEVVKVLV-TNGANVN-AQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 268          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 328.561 bits (841), Expect = 3.597e-90
Identity = 255/827 (30.83%), Postives = 406/827 (49.09%), Query Frame = 2
Query: 1640 TRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAM-------------MLVNLPNN------EGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +R  + N      + +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+  G                                   ANVN   +NG + L++A++  +LE++K LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+             +L+   NN       G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S      N +T  G T LHL+A  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LLG+++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +   PL  AA   HT +++ LL+N  S  +L  N
Sbjct:   30 SRKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNG-----------------------------------ANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRAAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGAS-----PNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHAA------------AKNGYTPLHIAAKKNQMDIATTLLEY-GADANAVT-RQGIASVHLAAQEGHVDMVSLLLGRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVN 789          

HSP 2 Score: 282.722 bits (722), Expect = 5.861e-76
Identity = 251/799 (31.41%), Postives = 386/799 (48.31%), Query Frame = 2
Query: 1364 AIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLP----NNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEH--KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEM 3736
            A+H+A ++  VE +  L    A ++     G T LHIA+      ++K L +  A+VN       + L+MAA++ H ++V+ L+D      L  + +G T + V    GH +    LL          K     LH AA+         LL    N +  +K  +TPLHIA  YGN  V   L+   A V+F     D +PLHVA+   N     ++LL  GA ++   ++G + LH  +RSG+ ++++ LL   A      K+G SPLH+  +  H   VQ L+                N+P     N+  TA+H AA     +         + K+LL+   +   +      TPLH  A   N   ++E+   L+H   IQ V     ++G +P+  A+  GH  IVS L+ + A  +  +  G TALH+AA  G   V   L+   A V AK+K   TPLH++A+ G  D+V++L+ +  A+ +A T +  TPLHL+A+ G ++V   LL H    A       +G TPLH+AAK    +V  L L+ K      A   G+T  H+AA   +  V    +    S     KN   G T LH+AA+     +   LL+ GA+       G+  +HLAA+ GH  ++ +L  + +   +SNKSG+TPLH+AA   +++ V E+L +  A++            D  T+ G TPLH+    G+  +V  LL     +VN+ T  NG TPLH A+Q GHT++ ++LL    S N++T     G TAL  A   G+I +
Sbjct:   71 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN-DITPLHVASKRGNA-NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--------------NVPVDDVTNDYLTALHVAAHCGHYK---------VAKVLLDKKANPNAKA-LNGFTPLH-IACKKNRIKVMEL--LLKHGASIQAVT----ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG-ASPNAATTSGYTPLHLSAREGHEDVAAFLLDHG---ASLSITTKKGFTPLHVAAKYGKLEVANLLLQ-KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN---GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHV------------DAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKT-KNGYTPLHQAAQQGHTHIINVLLQNNASPNELT---VNGNTALGIARRLGYISV 805          

HSP 3 Score: 274.633 bits (701), Expect = 2.015e-73
Identity = 238/796 (29.90%), Postives = 385/796 (48.37%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  K  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    +  ++++A         + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ ++LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G T LH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   72 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDNNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACK-KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV----QDGAQVEAKA------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLSAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 810          

HSP 4 Score: 216.468 bits (550), Expect = 1.192e-55
Identity = 182/587 (31.01%), Postives = 280/587 (47.70%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL  +A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  ++ + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+      V  + K+  T +H+++  G  +    LL++G   +    +G   LH +A+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  +LL+ GAD + + + G + +H+  +  H  +V  L+               VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++PL  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  262 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLL-DRAAPILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNA---KALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 809          

HSP 5 Score: 85.1149 bits (209), Expect = 1.211e-15
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q    +  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   42 AARAGHLEKALDYIKNGVDINIC-NQNGLNALHLASKEGHVEVVSELLQR-EANV------------DAATKKGNTALHIASLAGQAEVVKVLV-TNGANVN-AQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 279          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 326.635 bits (836), Expect = 1.667e-89
Identity = 261/834 (31.29%), Postives = 410/834 (49.16%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVV-------NKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNK---SGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            + L  A  GN +  L +L++ + D+N  +    + LH+A+++GH K+V  L+ K +  + T  K+GNT +H+ +++G  E    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN N  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GA+VN T +NG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  I + L          +D    +      G + +H AA+          +  D +++LL+YD ++   T     TPLH  A  G+            H++  V+       N +A NG++PL  A    H  ++ +LLK  A +D   E G+T LH+A+  GH  +   LL   A  N  +    TPLH+AA+ G+ ++ + L+ +NKA V+A   + +TPLH AA+ G   + + LL +    A+P  A + G TPLH+AA+  H + V L L  K       +  G T  H+AA  G + V +  +  +       KN   G T LH+A    +  +VK+LL  G +P     +G T LH+AAK      +EV +  + +   +N     G+TPLH+AA  G  + V  +L+              +   ++  +SGLTPLHL +Q GH  +  +L+   GV V+ AT   G TPLH AS  G+  +   LL   ++ +  +   G + LH A+  GH ++  L +  GA  N   + G TPL  A + GY+ V  +L
Sbjct:   48 SFLRAARSGNLDKALDHLRNGV-DINTCNQNGLNGLHLASKEGHVKMVVELLHK-EIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEIL----------LDHGAPIQAKTKNGLSPIHMAAQ---------GDHLDCVRLLLQYDAEIDDIT-LDHLTPLHVAAHCGH------------HRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENN---ANPNLATTAGHTPLHIAAREGHVETV-LALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN---GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ---VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK-------------QANGNLGNKSGLTPLHLVAQEGHVPVADVLIK-HGVMVD-ATTRMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 819          

HSP 2 Score: 323.553 bits (828), Expect = 1.551e-88
Identity = 254/790 (32.15%), Postives = 399/790 (50.51%), Query Frame = 2
Query: 1613 IDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI--GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEE-TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            +D   CN     + G   +H+ S  GH +  + LL + + L    K G+  LH AA +G   VV+ L++ GANVNA+++  +TPL++A +  +  VV+ L+  G    V  + G    +PL VA    +    A ++     N     K    ALHIA+R+ +      LLQ   +P ++ K G +PLHI   Y +  + Q L+   N+  S       VN     G T +H A+              ++I + L  D   +I+TK  +E TPLH CA       + EI   L+H     +  + KNG SP+  A+   H + V +LL+ +A +D      +T LH+AA  GH  VA VLL   A  N+++  G TPLH+A +  +  ++E L+ +  A++DA+T +  TPLH+A+  G   + ++LL      A P  ++ + +TPLH+AA+  H++V +  L+ K +  +NA + D  T  H AA  G   ++K  +  N +      N +T  G T LH+AA  GH + V  LL+  A+ A     G T LH+AAKYG   + E+L  + +    + K+G+TPLHVA H+  +D V  +L           P+ G         +G TPLH+A++     + R LL   G    +A +  G TPLH A+Q GH  + ++LL K +N     +  G T LH  +  GH+ +A + I  G  ++A+  MG+TPLH A+  G +K+ K L++  A   A+T     PL  AA   HT++++ LL+N  S
Sbjct:   69 VDINTCN-----QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGF---TPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLL---NRGAS-------VNFTPQNGITPLHIASR-----------RGNVIMVRLLLDRGAQIETKTKDELTPLH-CAARNGHVRISEI--LLDHGAP--IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL-KTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG---ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK--VNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-----PNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL-----------PRGGSPHSPAW--NGYTPLHIAAKQNQVEVARSLLQYGGSA--NAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 792          

HSP 3 Score: 312.768 bits (800), Expect = 3.742e-85
Identity = 262/807 (32.47%), Postives = 411/807 (50.93%), Query Frame = 2
Query: 1238 DKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRF--KPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            ++ G   L  A + G +  + ELL  E   +T  KK   G+ A+HIA      E +R L +  A +N ++  G T L++AA+ N   ++K+L    A+ NV  +   + L +A ++GH  +V  LI     N  T+ K     +H+ + +    T   LL+      + +KTG   LH AA   ++NV + LL++GA+VN   ++  TPLHIA + GN  +V  L+  GAQ+  K    DE +PLH AA  +NG  + +E+LL  GA +    KNG S +H+A++  +L+ ++ LLQ  A+   I  D  +PLH+     H+ + + L+    K  SR      +N     G T +H A     K+ H       ++++LL+    +   T+ +  TPLH  +  G+  +   + N L+      V+       +PL  A+  GH E+   LL+N A+V+   +   T LH AA  GH N+  +LL + A  N  +  G TPLH+AA+ G+ + V  L+ E +A+   +T    TPLH+AA+YG+  V   LL      A P AA   G TPLH+A  +++ D+V+L L     P    + + +G T  HIAA    + V +  +++  S          G T LHLAA+ GH ++V +LL   AN    N  G+T LHL A+ GH  + +VL         + + G TPLHVA+HYG I  V + L    A++ ++            T+ G +PLH A+Q GH ++V LLL  +G   N  + ++GTTPL  A + G+ +VT +L
Sbjct:   75 NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKK---GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETK--TKDELTPLHCAA--RNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-----LN-----GFTPLHIAC----KKNH-----VRVMELLLKTGASIDAVTE-SGLTPLHVASFMGHLPI---VKNLLQRGASPNVSNVKVE--TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL-EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERD---AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH---SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSAN---AESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLV-KFLLQHQADVNAK------------TKLGYSPLHQAAQQGHTDIVTLLLK-NGASPNEVS-SDGTTPLAIAKRLGYISVTDVL 819          

HSP 4 Score: 274.633 bits (701), Expect = 1.956e-73
Identity = 232/806 (28.78%), Postives = 400/806 (49.63%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCL-PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHD-GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK---PKISFRVVSNKSGMT 3352
            L LA K+  +  V  LL   +      K G TALH AA    ++VV+ L+   A  N+   S K   P+++A          V+  L    + +    ++G   L  A++ G  + +  L+    + +  +        A+HIA R  D     +L   +   ++ +  G T LHIAA   +  + + L +  A VN       + LH+A+ +G+  +V LL+D+    + T+ K+  T +H  + +GH   +  LL  G P+    K G   +H AAQ  H++ V+ LL   A ++  T D  TPLH+A   G+  V + L+  GA+ N +  +   +PLH+A   KN  +  E+LLK+GA+++   ++G + LH+AS  G+L ++K+LLQ GA P++      +PLH+  R  H  + + L+   NK K        VN    + +T +H AA +           T+++K+LLE + +  + T     TPLH  A  G+ + +L +   LE +         K G++PL  A+  G   +  +LL+ +A  +   ++G+T LH+A    + ++  +LL      ++ +  G TPLH+AA+    ++   L+ +   + +A ++   TPLHLAAQ G  E+   LL  +   A+    +  G TPLHL A+  H  V  + ++    ++++A+   G T  H+A+  G++ ++K  ++    V    K    G + LH AA+ GH  +V +LL  GA+P E ++DG T L +A + G+  + +VLK    + SF +VS+K  M+
Sbjct:   82 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGA--NVNAQSQKGFTPLYMAAQENHLE---VVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRL-------PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACK-KNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ--NKAK--------VNAKAKDDQTPLHCAARIGH---------TNMVKLLLENNANPNLATT-AGHTPLHIAAREGHVETVLAL---LEKEASQAC--MTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLL-QYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQ---ANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHG--VMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTK---LGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMS 838          

HSP 5 Score: 247.284 bits (630), Expect = 4.705e-65
Identity = 229/718 (31.89%), Postives = 345/718 (48.05%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFG--GSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLR--FKPELLINASHDGMTCGHIAAANGSLAV 3085
            TPL +A ++N L  V  LLE G N N   +DG T L  A +   E+VV  L+        +G  G  +   +H+A     T +  V  LL+   +  + + K G   L  A    +++  + LL        N   + +G   +HIA R+ +V  +RLL D  AQI  K     T LH AA      I + L    A +        S +HMAA+  H   V LL+ ++   +     +  T +HV +  GH      LL +G   +     G   LH A +  HV V++ LL  GA+++A T+   TPLH+A   G+  +V+ L+  GA  N    +  E+PLH+AA   + E  A+ LL++ A VN   K+ ++ LH A+R G+  M+K LL+  A+P++    G++PLHI  R  H   V+ +++   K  S+  A M       +G T +H AA+  + R         + ++LLE D       K    TPLH      N    L+IV  L  +     +  A NG++PL  A+     E+   LL+     +     G+T LHLAA++GH  +  +LL  +A  N  +K GLTPLHL AQ G+  + + LI ++   VDA T    TPLH+A+ YG  ++ + LL H+   AD  A    G +PLH AA+  H+D+V L L+    P      S DG T   IA   G ++V
Sbjct:  146 TPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAV--LLQNDPNPDV-LSKTGFTPLHIAAHYENLNVAQLLLNRGA--SVNFTPQ-NGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL-QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVS-NVKVETPLHMAARAGHTE-VAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGH---VETVLALLEKEASQ--ACM-----TKKGFTPLHVAAKYGKVR---------VAELLLERDAHPNAAGK-NGLTPLHVAVHHNN----LDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-KHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ---ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN---EVSSDGTTPLAIAKRLGYISV 815          

HSP 6 Score: 197.978 bits (502), Expect = 6.013e-50
Identity = 154/476 (32.35%), Postives = 247/476 (51.89%), Query Frame = 2
Query: 2540 LLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFV-NAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRF--NKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
             L A+ +G+ +     L+N   ++  +++G+  LHLA+++GH  +  V LLHK  +    +K G T LH+AA  G  ++V +L+N   A V+A +    TPL++AAQ    EV + LL +    A+   A   G TPL +A +  H +VV   + +  +  +      +   HIAA N         ++   N  V+       TG T LH+AA   +  + ++LL+ GA+      +G+T LH+A++ G+  ++ +L  + +      K  +TPLH AA  G +  + E+L D  A I+++            T++GL+P+H+A+Q  H + VRLLL  D  E++  T ++  TPLH A+  GH  V  +LL K + +   R   G T LH A    H+ +  L +  GA I+A    G TPLH A+  G+L + K L++RGAS        + PL +AA   HTEV  +LL+NK
Sbjct:   49 FLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMV-VELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYG-ANVNAQSQKGFTPLYMAAQENHLEVVKFLLENG---ANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVR-----LPALHIAARNDDTRTAAVLLQNDPNPDVL-----SKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVR-ISEILLDHGAPIQAK------------TKNGLSPIHMAAQGDHLDCVRLLLQYDA-EIDDITLDH-LTPLHVAAHCGHHRVAKVLLDKGA-KPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNK 493          

HSP 7 Score: 143.28 bits (360), Expect = 2.709e-33
Identity = 121/416 (29.09%), Postives = 199/416 (47.84%), Query Frame = 2
Query: 2912 DPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAP 4072
            D    +  G   LHLA+K  H  +V + L  K  +L   +  G T  HIAA  G   V++E + +  +V         G T L++AA+  H ++VK LL+ GAN      DG T L +A + GH +++  L     K K+                            V +K+G TPLH+AAHY  ++ V ++L +  A++            +   ++G+TPLH+AS+ G+  +VRLLL+  G ++ + T +   TPLH A++NGH  ++ ILL   +  I  +   G + +H A+   H++   L +   A+I+       TPLH AA  G+ +V K+L+++GA   +   +   PL +A   NH  VM  LL+   S   + E+   L  L + S + +   V+  +    +P
Sbjct:   70 DINTCNQNGLNGLHLASKEGHVKMV-VELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVN---AQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLN-VAQLLLNRGASV------------NFTPQNGITPLHIASRRGNVIMVRLLLD-RGAQIETKTKDE-LTPLHCAARNGHVRISEILLDHGA-PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESG--LTPLHVASFMGHLPIVKNLLQRGASP 463          

HSP 8 Score: 141.739 bits (356), Expect = 7.977e-33
Identity = 122/387 (31.52%), Postives = 183/387 (47.29%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSG 2092
            E+  TPL +A     L  V  LL+ G +PN       T LH AA+    +V K LL  KA  N      +  P+H A +R G ++  ++ LL    +        G   L  A   G + T+  LL+ E  Q    KK ++    +H+A +   V    LL + +A  N     G T LH+A   N+  I+K L       +       + LH+AA++   ++   L+ ++  +      +G T +H+ +  GH E    LL +    ++ NK+G   LH  AQ GHV V   L+  G  V+A T+  YTPLH+A  YGN  +V+ L+ + A VN K   L  SPLH AA   + +    +LLK+GA+ NE   +G + L IA R G
Sbjct:  435 ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQT-PLHCA-ARIGHTN--MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFT---PLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLL-QYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTK-LGYSPLHQAAQQGHTD-IVTLLLKNGASPNEVSSDGTTPLAIAKRLG 811          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 327.405 bits (838), Expect = 2.892e-89
Identity = 254/811 (31.32%), Postives = 401/811 (49.45%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAM-------------MLVNLPNN------EGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEE-TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE++K LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+             +L+   NN       G T +H AA          L+ +    DF                + +++K+LL  D   KI  K  +  TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHL+A  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LLG+++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +   PL  AA   HT +++ LL+N  S  +L  N
Sbjct:   51 AGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLL--DRGAKIDAKTRDGLTPLHCGARSGHE----QVVEMLLDRAAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAAT---TSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHA------------AAKNGYTPLHIAAKKNQMDIATTLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLGRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVN 795          

HSP 2 Score: 281.952 bits (720), Expect = 2.104e-75
Identity = 251/801 (31.34%), Postives = 388/801 (48.44%), Query Frame = 2
Query: 1364 AIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV--PLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLP----NNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEH--KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEM 3736
            A+H+A ++  VE +  L    A ++     G T LHIA+      ++K L +  A+VN       + L+MAA++ H ++V+ L+D      L  + +G T + V    GH +    LL       + +P       LH AA+         LL    N +  +K  +TPLHIA  YGN  V   L+   A V+F     D +PLHVA+   N     ++LL  GA ++   ++G + LH  +RSG+ ++++ LL   A      K+G SPLH+  +  H   VQ L+                N+P     N+  TA+H AA     +         + K+LL+   +   +      TPLH  A   N   ++E+   L+H   IQ V     ++G +P+  A+  GH  IVS L+ + A  +  +  G TALH+AA  G   V   L+   A V AK+K   TPLH++A+ G  D+V++L+ +  A+ +A T +  TPLHL+A+ G ++V   LL H    A       +G TPLH+AAK    +V  L L+ K      A   G+T  H+AA   +  V    +    S     KN   G T LH+AA+     +   LL+ GA+       G+  +HLAA+ GH  ++ +L  + +   +SNKSG+TPLH+AA   +++ V E+L +  A++            D  T+ G TPLH+    G+  +V  LL     +VN+ T  NG TPLH A+Q GHT++ ++LL    S N++T     G TAL  A   G+I +
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN-DITPLHVASKRGNA-NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--------------NVPVDDVTNDYLTALHVAAHCGHYK---------VAKVLLDKKANPNAKA-LNGFTPLH-IACKKNRIKVMEL--LLKHGASIQAVT----ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG-ASPNAATTSGYTPLHLSAREGHEDVAAFLLDHG---ASLSITTKKGFTPLHVAAKYGKLEVANLLLQ-KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN---GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHV------------DAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKT-KNGYTPLHQAAQQGHTHIINVLLQNNASPNELT---VNGNTALGIARRLGYISV 811          

HSP 3 Score: 272.707 bits (696), Expect = 1.439e-72
Identity = 238/796 (29.90%), Postives = 385/796 (48.37%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  K  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    +  ++++A         + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ ++LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G T LH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDNNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACK-KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV----QDGAQVEAKA------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAAT-TSGYTPLHLSAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 4 Score: 212.616 bits (540), Expect = 3.526e-54
Identity = 182/587 (31.01%), Postives = 281/587 (47.87%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  ++ + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+ +    V  + K+  T +H+++  G  +    LL++G   +    +G   LH +A+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  +LL+ GAD + + + G + +H+  +  H  +V  L+               VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++PL  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  268 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNA---KALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 5 Score: 202.986 bits (515), Expect = 2.608e-51
Identity = 196/702 (27.92%), Postives = 313/702 (44.59%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADV-----------------------------NV-LDDMDR---SALHMAAEKGHTKIVELLIDK----------------FKC----------------NVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHY----LIVQELVSFY--------------NKTKSRIDAMML-----VNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKL 2785
            TPL +A ++N L  V  LL+ G + +   +DG T L  A +   + VV LLL      N   G  +   +H+A  +  T +  +  LL+   +A ++  K G   L  A   G+I+    LL          +   +    +H+A ++ +   ++LL D  A+I+ K   G T LH  A    E +++ L    A +                             NV +DD+     +ALH+AA  GH K+ ++L+DK                  C                ++    + G T +HV +  GH      L+  G   +  N  G   LH AA+SG   VV+ L+  GA V A+ KD  TPLHI+ + G   +V+ L+  GA  N        +PLH++A  +  E  A  LL  GA+++ T K G + LH+A++ G LE+   LLQ+ A P    K G +PLH+   Y +     L++ +  S +               K +  I   +L      N    +G  +VH AA+      H      D++ +LL  + +V +  K +  TPLH  A     +V   +VN   H     V+ Q K G++PL    H G+ +IV+ LL+++A+V+   ++G T LH AA++GH ++ NVLL + A  N  +  G T L +A + GY  +V+ L
Sbjct:  142 TPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAAL--LLQNDNNADVE-SKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDIT---PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPN-AATTSGYTPLHLSAR-EGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQ----EGH-----VDMVSLLLGRNANVNLSNK-SGLTPLHLAAQEDRVNVAEVLVNQGAH-----VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 6 Score: 199.904 bits (507), Expect = 2.622e-50
Identity = 161/502 (32.07%), Postives = 248/502 (49.40%), Query Frame = 2
Query: 2543 LFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFK-------PELLINASHD---------------------GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLT-DVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            L A+  GH E     +KN   +++ +++G+ ALHLA+++GH  V + LL  +A V+A +K G T LH+A+  G  ++V+ L+  N A V+A + N  TPL++AAQ    EV + LL +    A    A   G TPL +A +  H  VV L L          P L I A  D                     G T  HIAA  G++ V    +    +V    +N     T LH+A++ G+  +VK+LLD GA    +  DG+T LH  A+ GH  ++E+L  + +  +   K+G++PLH+A     ++ V  +L  +VP               D +T   LT LH+A+  GH  + ++LL  D     +A   NG TPLH A +     V  +LL  G S   +T     G T +H A+  GH+ + +  +  GA  N ++  G T LH AA+SG  +V + LV+ GA  EA+  D Q PL ++A     +++  LL+ 
Sbjct:   46 LRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVT-NGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNG---ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN---DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV--------------DDVTNDYLTALHVAAHCGHYKVAKVLL--DKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTE---SGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ 521          

HSP 7 Score: 85.5001 bits (210), Expect = 1.178e-15
Identity = 74/257 (28.79%), Postives = 122/257 (47.47%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQ-ITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNN 4030
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q +   D  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N
Sbjct:   48 AARAGHLEKALDYIKNGVDINIC-NQNGLNALHLASKEGHVEVVSELLQRE-ANV------------DAATKKGNTALHIASLAGQAEVVKVLV-TNGANVN-AQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATED--GFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGN 280          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 325.479 bits (833), Expect = 3.334e-89
Identity = 261/834 (31.29%), Postives = 410/834 (49.16%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVV-------NKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNK---SGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            + L  A  GN +  L +L++ + D+N  +    + LH+A+++GH K+V  L+ K +  + T  K+GNT +H+ +++G  E    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN N  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GA+VN T +NG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  I + L          +D    +      G + +H AA+          +  D +++LL+YD ++   T     TPLH  A  G+            H++  V+       N +A NG++PL  A    H  ++ +LLK  A +D   E G+T LH+A+  GH  +   LL   A  N  +    TPLH+AA+ G+ ++ + L+ +NKA V+A   + +TPLH AA+ G   + + LL +    A+P  A + G TPLH+AA+  H + V L L  K       +  G T  H+AA  G + V +  +  +       KN   G T LH+A    +  +VK+LL  G +P     +G T LH+AAK      +EV +  + +   +N     G+TPLH+AA  G  + V  +L+              +   ++  +SGLTPLHL +Q GH  +  +L+   GV V+ AT   G TPLH AS  G+  +   LL   ++ +  +   G + LH A+  GH ++  L +  GA  N   + G TPL  A + GY+ V  +L
Sbjct:   15 SFLRAARSGNLDKALDHLRNGV-DINTCNQNGLNGLHLASKEGHVKMVVELLHK-EIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEIL----------LDHGAPIQAKTKNGLSPIHMAAQ---------GDHLDCVRLLLQYDAEIDDIT-LDHLTPLHVAAHCGH------------HRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENN---ANPNLATTAGHTPLHIAAREGHVETV-LALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN---GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ---VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK-------------QANGNLGNKSGLTPLHLVAQEGHVPVADVLIK-HGVMVD-ATTRMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 2 Score: 321.242 bits (822), Expect = 6.969e-88
Identity = 259/809 (32.01%), Postives = 402/809 (49.69%), Query Frame = 2
Query: 1643 RDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGES-----------------------------ALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEE-TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            R+ +  T     + SG+ +  +  LR GV ++  N+ G   LH A++ GHV +V  LL K   +   TK   T LHIA   G   VV  L+ YGA VN +   G    +PL++AA  +N  +  + LL++GAN N   ++G +                             ALHIA+R+ +      LLQ   +P ++ K G +PLHI   Y +  + Q L+   N+  S       VN     G T +H A+              ++I + L  D   +I+TK  +E TPLH CA       + EI   L+H     +  + KNG SP+  A+   H + V +LL+ +A +D      +T LH+AA  GH  VA VLL   A  N+++  G TPLH+A +  +  ++E L+ +  A++DA+T +  TPLH+A+  G   + ++LL      A P  ++ + +TPLH+AA+  H++V +  L+ K +  +NA + D  T  H AA  G   ++K  +  N +      N +T  G T LH+AA  GH + V  LL+  A+ A     G T LH+AAKYG   + E+L  + +    + K+G+TPLHVA H+  +D V  +L           P+ G         +G TPLH+A++     + R LL   G    +A +  G TPLH A+Q GH  + ++LL K +N     +  G T LH  +  GH+ +A + I  G  ++A+  MG+TPLH A+  G +K+ K L++  A   A+T     PL  AA   HT++++ LL+N  S
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGF---TPLYMAA-QENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLL---NRGAS-------VNFTPQNGITPLHIAS-----------RRGNVIMVRLLLDRGAQIETKTKDELTPLH-CAARNGHVRISEI--LLDHGAP--IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL-KTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG---ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK--VNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-----PNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL-----------PRGGSPHSPAW--NGYTPLHIAAKQNQVEVARSLLQYGGSA--NAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 759          

HSP 3 Score: 311.997 bits (798), Expect = 5.895e-85
Identity = 262/807 (32.47%), Postives = 411/807 (50.93%), Query Frame = 2
Query: 1238 DKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRF--KPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            ++ G   L  A + G +  + ELL  E   +T  KK   G+ A+HIA      E +R L +  A +N ++  G T L++AA+ N   ++K+L    A+ NV  +   + L +A ++GH  +V  LI     N  T+ K     +H+ + +    T   LL+      + +KTG   LH AA   ++NV + LL++GA+VN   ++  TPLHIA + GN  +V  L+  GAQ+  K    DE +PLH AA  +NG  + +E+LL  GA +    KNG S +H+A++  +L+ ++ LLQ  A+   I  D  +PLH+     H+ + + L+    K  SR      +N     G T +H A     K+ H       ++++LL+    +   T+ +  TPLH  +  G+  +   + N L+      V+       +PL  A+  GH E+   LL+N A+V+   +   T LH AA  GH N+  +LL + A  N  +  G TPLH+AA+ G+ + V  L+ E +A+   +T    TPLH+AA+YG+  V   LL      A P AA   G TPLH+A  +++ D+V+L L     P    + + +G T  HIAA    + V +  +++  S          G T LHLAA+ GH ++V +LL   AN    N  G+T LHL A+ GH  + +VL         + + G TPLHVA+HYG I  V + L    A++ ++            T+ G +PLH A+Q GH ++V LLL  +G   N  + ++GTTPL  A + G+ +VT +L
Sbjct:   42 NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKK---GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETK--TKDELTPLHCAA--RNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-----LN-----GFTPLHIAC----KKNH-----VRVMELLLKTGASIDAVTE-SGLTPLHVASFMGHLPI---VKNLLQRGASPNVSNVKVE--TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL-EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERD---AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH---SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSAN---AESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLV-KFLLQHQADVNAK------------TKLGYSPLHQAAQQGHTDIVTLLLK-NGASPNEVS-SDGTTPLAIAKRLGYISVTDVL 786          

HSP 4 Score: 273.863 bits (699), Expect = 3.521e-73
Identity = 232/806 (28.78%), Postives = 400/806 (49.63%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCL-PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHD-GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK---PKISFRVVSNKSGMT 3352
            L LA K+  +  V  LL   +      K G TALH AA    ++VV+ L+   A  N+   S K   P+++A          V+  L    + +    ++G   L  A++ G  + +  L+    + +  +        A+HIA R  D     +L   +   ++ +  G T LHIAA   +  + + L +  A VN       + LH+A+ +G+  +V LL+D+    + T+ K+  T +H  + +GH   +  LL  G P+    K G   +H AAQ  H++ V+ LL   A ++  T D  TPLH+A   G+  V + L+  GA+ N +  +   +PLH+A   KN  +  E+LLK+GA+++   ++G + LH+AS  G+L ++K+LLQ GA P++      +PLH+  R  H  + + L+   NK K        VN    + +T +H AA +           T+++K+LLE + +  + T     TPLH  A  G+ + +L +   LE +         K G++PL  A+  G   +  +LL+ +A  +   ++G+T LH+A    + ++  +LL      ++ +  G TPLH+AA+    ++   L+ +   + +A ++   TPLHLAAQ G  E+   LL  +   A+    +  G TPLHL A+  H  V  + ++    ++++A+   G T  H+A+  G++ ++K  ++    V    K    G + LH AA+ GH  +V +LL  GA+P E ++DG T L +A + G+  + +VLK    + SF +VS+K  M+
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGA--NVNAQSQKGFTPLYMAAQENHLE---VVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRL-------PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACK-KNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ--NKAK--------VNAKAKDDQTPLHCAARIGH---------TNMVKLLLENNANPNLATT-AGHTPLHIAAREGHVETVLAL---LEKEASQAC--MTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLL-QYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQ---ANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHG--VMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTK---LGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMS 805          

HSP 5 Score: 246.514 bits (628), Expect = 7.797e-65
Identity = 229/718 (31.89%), Postives = 345/718 (48.05%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFG--GSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLR--FKPELLINASHDGMTCGHIAAANGSLAV 3085
            TPL +A ++N L  V  LLE G N N   +DG T L  A +   E+VV  L+        +G  G  +   +H+A     T +  V  LL+   +  + + K G   L  A    +++  + LL        N   + +G   +HIA R+ +V  +RLL D  AQI  K     T LH AA      I + L    A +        S +HMAA+  H   V LL+ ++   +     +  T +HV +  GH      LL +G   +     G   LH A +  HV V++ LL  GA+++A T+   TPLH+A   G+  +V+ L+  GA  N    +  E+PLH+AA   + E  A+ LL++ A VN   K+ ++ LH A+R G+  M+K LL+  A+P++    G++PLHI  R  H   V+ +++   K  S+  A M       +G T +H AA+  + R         + ++LLE D       K    TPLH      N    L+IV  L  +     +  A NG++PL  A+     E+   LL+     +     G+T LHLAA++GH  +  +LL  +A  N  +K GLTPLHL AQ G+  + + LI ++   VDA T    TPLH+A+ YG  ++ + LL H+   AD  A    G +PLH AA+  H+D+V L L+    P      S DG T   IA   G ++V
Sbjct:  113 TPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAV--LLQNDPNPDV-LSKTGFTPLHIAAHYENLNVAQLLLNRGA--SVNFTPQ-NGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL-QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVS-NVKVETPLHMAARAGHTE-VAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGH---VETVLALLEKEASQ--ACM-----TKKGFTPLHVAAKYGKVR---------VAELLLERDAHPNAAGK-NGLTPLHVAVHHNN----LDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-KHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ---ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN---EVSSDGTTPLAIAKRLGYISV 782          

HSP 6 Score: 152.525 bits (384), Expect = 4.450e-36
Identity = 144/490 (29.39%), Postives = 226/490 (46.12%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKT-------KSRID----AMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEY 2380
            TPL +ACK N +  ++ LL+ G + + V + G T LH A+      +VK LL + A PN+     +  P+H+A     T     +   KA  +A+ + D+     L  A   G  + +K LL  E     N+    +G   +HIA R+  VE +  L +  A        G T LH+AA+     + + L    A  N       + LH+A    +  IV+LL+ +   +  +    G T +H+ +     E   SLL+ G   +  +  G   LH AAQ GH  +V  LL K AN N   K   TPLH+  + G+  V + LI +G  V+     +  +PLHVA+   N  K  + LL+  A+VN   K G S LH A++ G+ +++  LL+ GA P+ +  DG +PL I  R  +  +   L    ++T       K R+        ++++  +EGE  + F AE        D  D D  K LL++
Sbjct:  373 TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQ---TPLHCAARIGHTNMVKLLL--ENNANPNLATT-AGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTR-MGYTPLHVASHYGN-IKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAE------RRDSRDVDEEKELLDF 846          

HSP 7 Score: 142.895 bits (359), Expect = 3.301e-33
Identity = 121/416 (29.09%), Postives = 199/416 (47.84%), Query Frame = 2
Query: 2912 DPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAP 4072
            D    +  G   LHLA+K  H  +V + L  K  +L   +  G T  HIAA  G   V++E + +  +V         G T L++AA+  H ++VK LL+ GAN      DG T L +A + GH +++  L     K K+                            V +K+G TPLH+AAHY  ++ V ++L +  A++            +   ++G+TPLH+AS+ G+  +VRLLL+  G ++ + T +   TPLH A++NGH  ++ ILL   +  I  +   G + +H A+   H++   L +   A+I+       TPLH AA  G+ +V K+L+++GA   +   +   PL +A   NH  VM  LL+   S   + E+   L  L + S + +   V+  +    +P
Sbjct:   37 DINTCNQNGLNGLHLASKEGHVKMV-VELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVN---AQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLN-VAQLLLNRGASV------------NFTPQNGITPLHIASRRGNVIMVRLLLD-RGAQIETKTKDE-LTPLHCAARNGHVRISEILLDHGA-PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESG--LTPLHVASFMGHLPIVKNLLQRGASP 430          

HSP 8 Score: 132.109 bits (331), Expect = 7.191e-30
Identity = 104/332 (31.33%), Postives = 168/332 (50.60%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN 1936
            ETPL +A +         LL+     N  AKD +T LH AA+    ++VKLLL   A+PNL   +    P+H+A +R G    TV++LL+  ++++  M K+G   L  A + G +   + LL+ +       K   +G   +H+A    +++ ++LL       +     G T LHIAA+ N   + + L       N       + LH+AA++GH ++V LL+ K + N    +K G T +H+ +  GH      L++ GV +    + G   LH A+  G++ +VK LL   A+VNA+TK  Y+PLH A + G+  +V  L+  GA  N
Sbjct:  438 ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL-ATTAGHTPLHIA-AREGHVE-TVLALLE-KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGK---NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK-QANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN 761          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 1117.06 bits (2888), Expect = 0.000e+0
Identity = 643/1594 (40.34%), Postives = 961/1594 (60.29%), Query Frame = 2
Query:  827 RAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDE----TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFG-GSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANA-QINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEK--CAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFL-EHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFK---PELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQM-KDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXX-PLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKS-IASLKYGILFFGFFAVMVQTLSFMPMPILIPEL------------IYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPIL------SGDYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPL---------YKEN---------DRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRY 5455
            + K +    + EW NVE+ + +        K  D    +    T  +LA K  +   VD+++  G   +   KDGR A H AA ++  + ++L+L + ++    G G  K L IH+AC R    +  ++  +      R+  D +G++ +  A + G+++ ++ LL    ++QT  K   +GD  +H+A R  ++EA+R    A     N++N +G+T LH  AE  D+ +LK +    AD N+ D  D++ +H+AAE+G T +VE LIDKF  ++  R ++G+TL+H+ + SGH  T ++ L+RGVPL MPNK G++ LH+AA +G  +VVK L+ +G NV+ RT+D YT LH+AV+ G   VVETL+G GA ++ KGG L ++ LH+AA+    E   CA MLLKSG   +    +GE+ LHIA+RSGN ++++ LL E AD  I  K G +PL +  + C++     ++   ++  ++      VN   N+G TA+H+AAE+ Q++ H   ED  ++ +L++Y G V++ +    ET +H  A +GN  VLL +VN +    +Q+V NKQ+KNGWSPLL A   GH  + +ILLK++AR+DVFDE G TALHLAA  GH ++ ++LL HKAFVN+KSK G  PLHLAAQ+G+  +V  L+ ++ A ++A+TL+ +T LH AA++G+  V ++LL      A+P A D +GQTPLHLAA+ND  DVV+LFL+ +     +L    H+G TC HIAA  GSLAV++E M  +K ++   K K+  +T LH+AA GGH  +VK+LL+ GAN  +EN+ GMT LHL AK G   +LE    KI ++  S K+G+  LH+AA YG  DFV EML  V A ++SE P     + K+  TE G TPLHLA+QSGH++LVR+LLN  GV+V++ +      PLH A+Q GH  V  +LL +S+ Q   +D++GRT LH A+ +GH EM +L I QG++IN  D  G+T LH+A ++G+L V KL ++  A   AET + ++PL  AA  NH E + FLL+ KH T +L+E+ KF+FDLM+C K N+ + ++EFIL SPAP E A KLS  + ++S+KEKER+KDL+ V+   ++M  +L  + A E  A  LLK+ D  G   LD+LIE EQKEV+S+  VQRYL++VW   ++W   K   F L ++  P +WF   LP+  +I  AP++KF+ +++SHVY T LL  V L   +  Y  T+ V      LL+      +   ++ +   S +  +K  IL     A+ V  L+F+   + +  L            +Y++NQL ++A     +  LDFL++HHLFGPW IIIRDLM DL +F+VIL +F+  F   + + FQP        S +   +      +  L+F+LFG   P  +P   L P +A  + + +FGI +M+T+IVLINLLIAMM++TY+ IQA+SD EWK+GRA LIR M K S  PSP N+LT+LII   ++ +R R R +         ++EN          + R+    E   G      + +  +E V++W  IV  Y
Sbjct:  319 QTKILYFAKRDEWANVESEIETI-------KRSDFSMADNHGFTAFLLAVKAGKDQIVDKMIRKGARVDYSTKDGRNATHIAAMYSGVETLELILKRYSELLRKGAGPKKQLAIHVACERKSKKAFPIVKRILEDTDQRMAEDGDGSLPIHLAFKFGNVNIVELLLSGPSDEQTR-KADGNGDTLLHLAARSGNIEAVRTAIAAGCDNANVQNRVGRTPLHEVAEVGDQNMLKIMFKLRADANIHDKEDKTPVHVAAERGDTSMVESLIDKFGGSIRARTRDGSTLLHIAACSGHTSTALAFLKRGVPLFMPNKKGALGLHSAAAAGFNDVVKMLIARGTNVDVRTRDNYTALHVAVQSGKASVVETLLGSGADIHVKGGELGQTALHIAASLNGAESRDCAMMLLKSGGQPDVAQMDGETCLHIAARSGNKDIMRLLLDENADSKISSKIGETPLQVAAKSCNFEAASMILKHLSEVLTQEQLKEHVNHRTNDGFTALHYAAEIEQRQLHFPGEDAKLVNLLIDYGGMVEMPSLNANETAMHMAARSGNQAVLLAMVNKIGAGAVQIVQNKQSKNGWSPLLEACARGHSGVANILLKHHARIDVFDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITLDNQTALHFAAKFGQLAVSQTLL---ALGANPNARDDKGQTPLHLAAENDFPDVVKLFLKMRNNNRSVLTAIDHNGFTCAHIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLENGANAEDENSHGMTALHLGAKNGFISILEAFD-KILWKRCSRKTGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLN-QGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQKHDTHQLMEDRKFIFDLMVCGKTNDNEPLQEFILQSPAPIETAVKLSALYRDMSEKEKERAKDLLNVAVFSENMAVELLGITATEYNAALLLKAKDNRGRPLLDVLIENEQKEVVSYASVQRYLTEVWTARVDWSFGKFVAFSLFVLICPPAWFYFSLPLDSRIGRAPIIKFVCHIVSHVYFTILLTIVVLNITHKMYEVTSVVPNPVEWLLLLWLSGNLVSELSTVGGGSGLGIVKVLILVLSAMAIAVHVLAFLLPAVFLTHLDNDEKLHFARTMLYLKNQLFAFALLFAFVEYLDFLTVHHLFGPWAIIIRDLMYDLARFLVILMLFVAGFTLHVTSIFQPAYQPVDEDSAELMRLASPSQTLEMLFFSLFGLVEPDSMPPLHLVPDFAKIILKLLFGIYMMVTLIVLINLLIAMMSDTYQRIQAQSDKEWKFGRAILIRQMNKKSATPSPINMLTKLIIV-LRVAWRNRLRCMTRKAQDDLRFEENIDAFSMGGGQQGRQSPTNEGREGQQELGNSADWNIETVIDWRKIVSMY 1898          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 288.886 bits (738), Expect = 2.502e-78
Identity = 236/795 (29.69%), Postives = 392/795 (49.31%), Query Frame = 2
Query: 1595 KIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQ--VNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQ-LVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGS--TALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            K++ELL  +   ++ T +  G   +H+ S  GH E    L++R   +    + G+  LH A+ +G   +V  L++ GANVN ++ + +TPL++A +  +  VV+ L+ +GA   ++ + G    +PL V A  +  ++   +LL++ +     +     ALHIA++  +      LLQ   +P +  K G +PLHI   Y H  + Q L          ++    VN       + +H A         + +  T++  +LL     +  +TK    TPLH  A +G+  V+  +V      +Q   ++ + KNG +PL  A+   H +    LL + A VD      +T LH+AA  GH  VA +LL   A  N+++  G TPLH+A +     +VE L+ + +A ++A T +  TPLH+AA  G   +   LL      A+P     RG+TPLHLAA+ + +DVVR+ +R   ++   A  +  T  HIA+  G+  ++   ++   +      N +T    + LH+AA+ G  ++  +LLD  A+       G T LHLA+KYG+  ++ +L  + +   +  K+ +TPLHVAAHY   D V  +L +  A+ K+              ++G TPLH+A++     +   LL        +A +  G TPLH ++Q GH  ++ +L+   S+ +  +   G TA+H  +   H+ +A +    GA+IN+  N G+TPLH A   G L + K LVE GA    +T     PL  AA   H   + +LL N  S
Sbjct:   48 KVLELL--RAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF---TPLAV-ALQQGHDRVVAVLLENDSKGKVRL----PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL----------LEKGANVNYQARHNISPLHVA---------TKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV------VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQG---ANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQA-RELQTPLHIASRLGNTDIVILLLQAGAN-----SNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN-DKVAMLLLENGASAKA------------AAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 273.478 bits (698), Expect = 1.679e-73
Identity = 240/789 (30.42%), Postives = 392/789 (49.68%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNL--FGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+     V  L++     +   + G TALH A+      +V +L+   A+ N+    G T   P+++A          V  LLK   +  L  + +G   L  A++ G    +  LL+ + + +  +        A+HIA +K D  A  LL       ++ +  G T LHIAA    E + + L    A+VN     + S LH+A + G T +  LL+ +    + +R K+  T +H  + SGH +    L+ +G P+    K G   LH AAQ  HV+  +TLL   A V+  T D  TPLH+A   G+  V + L+   A  N +  +   +PLH+A   KN  K  E+LLK  A +  T ++G + LH+A+  G + ++  LLQ+GA+P +    G +PLH+  R     +V+ L+    +  +++DA         E +T +H A+ L          +TDI+ +LL+   +    T+    +PLH  A  G  +V   +++    K  L      K G++PL  AS  G+ E+V +LL+    VD+  ++ +T LH+AA   +  VA +LL + A   A +K G TPLH+AA+    ++   L+ + KA  +A +    TPLHL+AQ G KE+   L+ +    +D  A  + G T +HL A+ DH  V ++      E  IN+ ++ G T  H+A   G L ++K F+  N + + G K +++  T LH AA+ GH+  V+ LL+ GA+P E+   G T L +A + G+  ++E L+
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEE--VVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDSKGKVRL-------PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI-IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACK-KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI----RNGAKVDAQA------RELQTPLHIASRL---------GNTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLT-----KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENG---SDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE--INSKTNAGYTPLHVACHFGQLNMVK-FLVENGADV-GEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 3 Score: 262.307 bits (669), Expect = 4.052e-70
Identity = 233/804 (28.98%), Postives = 372/804 (46.27%), Query Frame = 2
Query: 1244 EGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLR-------RGVPLHMP----------------------NKTGSVCLHAAAQSGHVNVVKTLLDKGANVN---------------------------------ARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDA----------MMLVNL----------PNNE---GETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFV 3394
            EG+ S + A  AG +  + ELL+A  +  T+     +G  ++H+A ++   E +R L    AQ++     G T LHIA+      I+  L    A+VNV      + L+MAA++ H ++V+ L+ K   N     ++G T + V    GH      LL        R   LH+                       +K+G   LH AA  GH NV + LL+KGANVN                                 +RTKDL TPLH A + G+  VV+ L+  GA ++   K G+   +PLH+AA   + +  A  LL   A V++   +  + LH+A+  G++ + K LL   ADP+    +G +PLHI  +     +V+ L+ +    ++  ++          M  +N+          P+ E   GET +H AA   Q         TD++++L+     V  Q +   +TPLH  +  GN+D+++ ++    +      N   ++ +SPL  A+  G  E+  ILL +NA   +  + G T LHLA++ G+  V  +LL     V+ + K  +TPLH+AA     D V  L+ EN A+  A   N  TPLH+AA+  + E+  +LL  K   ADP A    G TPLHL+A+  H ++  L +    ++   A+ +G+T  H+ A    + V  + +  N + I+   N   G T LH+A   G   +VK L++ GA+  E+     T LH AA+ GH + +  L    +       +G TPL +A   G +  V
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTS---NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL-KHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL---APLHMAAQGDHVD-AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ---------TDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANS-----NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN-NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK---ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTN--AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVV 804          

HSP 4 Score: 251.906 bits (642), Expect = 6.206e-67
Identity = 205/665 (30.83%), Postives = 344/665 (51.73%), Query Frame = 2
Query: 2057 GESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQ---TPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFK 4036
            G ++   A+R+G+LE +  LL+ G D +    +G + LH+  +  H  +V+EL+    K ++++DA         +G TA+H A+   Q         + I+ +L+E   +V +Q+     TPL+  A   + +V   +   L+H     ++ +  +G++PL  A   GH  +V++LL+N+++  V     + ALH+AA+K     A +LL ++   +  SK G TPLH+AA  G+++ V +L+ E  A V+    +  +PLH+A ++GR  +   LL            DSR +   TPLH AA++ H  VV L +  +   +   + +G+   H+AA    +   +  + ++++ +  +       T LH+AA  GH ++ K+LLD  A+P     +G T LH+A K     ++E+L    +    + +SG+TPLHVAA  G I+ V  +L       +   P       DV T  G TPLHLA+++   ++VR+L+  +G +V+ A      TPLH AS+ G+T++  +LL  G +SN  TR ++   + LH A+  G  E+A + +   AD       GFTPLH A+K G L+V +LL+ERG   + E  +   PL +AAH+N+ +V   LL N  S     +N      L I +K N  +
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI----KRQAQVDAA------TRKGNTALHIASLAGQ---------SLIVTILVENGANVNVQS-VNGFTPLYMAAQENHEEV---VKYLLKHGANQALSTE--DGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHEN-VGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI------IDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ------QGANP-------DVETVRGETPLHLAARANQTDVVRVLIR-NGAKVD-AQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY---SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNG--YTPLHIAAKKNQME 637          

HSP 5 Score: 157.147 bits (396), Expect = 6.313e-38
Identity = 151/552 (27.36%), Postives = 246/552 (44.57%), Query Frame = 2
Query:  947 PLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAE-GNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK--GGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSIL 2587
            PL +A + + + A   LL      +DV  D  T LH AA      V KLLL + ADPN     G T   P+H+AC +       V+ LL   ++A     + G   L  A   G+I+ +  LL+          +   G+  +H+A R    + +R+L    A+++ +    QT LHIA+  GN + ++  LQ+  A+ N     + S LH+AA++G  ++  +L+D      L   K+G T +H+ S  G+ E    LL RG P+ +  K     LH AA   +  V   LL+ GA+  A  K+ YTPLHIA K     +  TL+ + A  N K   G    +PLH++A   + E  + +L+++G++V     NG +A+H+ ++  ++ + + L   GA+ +     G +PLH+    CH                                                 F   +++K L+E   DV  +T+ +  TPLH  A  G+++    +   LE+      N+Q   G +PL  A   G+  +V  L
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT---PLHIACKKNRIK---VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLL-TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF---TPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA---CH-------------------------------------------------FGQLNMVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNC---VRYLLENGAS--PNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 142.895 bits (359), Expect = 1.342e-33
Identity = 115/395 (29.11%), Postives = 193/395 (48.86%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSL 2116
            E+  TPL +A     +  V  LL+ G NP+     G T LH AA+    DVV++L+   A  +      +  P+H+A SR G +   VI LL+A  ++     ++    L  A + G       LL    ++    KK ++    +H+A +  ++E +RLL +    ++++     T LH+AA  N++ +   L    A          + LH+AA+K   +I   L+ +FK +   + + G T +H+++  GH E +  L+  G  +      G   +H  AQ  HV V + L + GA +N++T   YTPLH+A  +G   +V+ L+  GA V  K      +PLH AA  +    C   LL++GA+ NE    G++ L IA R G + ++++L
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQT-PLHIA-SRLGNTD-IVILLLQAGANSNA-TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT---PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRA-SYTPLHQAA-QQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 113.62 bits (283), Expect = 1.139e-24
Identity = 86/299 (28.76%), Postives = 135/299 (45.15%), Query Frame = 2
Query: 3137 KSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR----------------------------RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLL 3949
            ++ GS +   AA  G  + V  LL AG +    N +G+  LHLA+K GH  ++  L  + +    + + G T LH+A+  GQ   +  +L +  AN+            +V + +G TPL++A+Q  HE +V+ LL     +  + +  +G TPL  A Q GH  V ++LL   S    R                                G T LH A+ +GH  +  L + +GA++N       +PLH A K G   +  LL+ RGA  ++ T D   PL  AA   H +V+  L+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQ-SLIVTILVENGANV------------NVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQ--ALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 8 Score: 64.6994 bits (156), Expect = 9.248e-10
Identity = 68/262 (25.95%), Postives = 105/262 (40.08%), Query Frame = 2
Query:  836 FMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNI-KKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID 1618
            F  L    ++GN+E +      E+  P   + +   TPL +A   N       LLE G +    AK+G T LH AAK    ++   LL  KADPN         P+HL+                          +EG                KE+     E  +++  K  +G  A+H+  ++  V   ++L +  A+IN K   G T LH+A       ++K+L    ADV        + LH AA++GH   V  L++
Sbjct:  558 FTPLHLASKYGNLEVV--RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-KSRAGFTPLHLSA-------------------------QEGH---------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 288.886 bits (738), Expect = 2.502e-78
Identity = 236/795 (29.69%), Postives = 392/795 (49.31%), Query Frame = 2
Query: 1595 KIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQ--VNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQ-LVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGS--TALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            K++ELL  +   ++ T +  G   +H+ S  GH E    L++R   +    + G+  LH A+ +G   +V  L++ GANVN ++ + +TPL++A +  +  VV+ L+ +GA   ++ + G    +PL V A  +  ++   +LL++ +     +     ALHIA++  +      LLQ   +P +  K G +PLHI   Y H  + Q L          ++    VN       + +H A         + +  T++  +LL     +  +TK    TPLH  A +G+  V+  +V      +Q   ++ + KNG +PL  A+   H +    LL + A VD      +T LH+AA  GH  VA +LL   A  N+++  G TPLH+A +     +VE L+ + +A ++A T +  TPLH+AA  G   +   LL      A+P     RG+TPLHLAA+ + +DVVR+ +R   ++   A  +  T  HIA+  G+  ++   ++   +      N +T    + LH+AA+ G  ++  +LLD  A+       G T LHLA+KYG+  ++ +L  + +   +  K+ +TPLHVAAHY   D V  +L +  A+ K+              ++G TPLH+A++     +   LL        +A +  G TPLH ++Q GH  ++ +L+   S+ +  +   G TA+H  +   H+ +A +    GA+IN+  N G+TPLH A   G L + K LVE GA    +T     PL  AA   H   + +LL N  S
Sbjct:   48 KVLELL--RAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF---TPLAV-ALQQGHDRVVAVLLENDSKGKVRL----PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL----------LEKGANVNYQARHNISPLHVA---------TKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV------VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQG---ANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQA-RELQTPLHIASRLGNTDIVILLLQAGAN-----SNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN-DKVAMLLLENGASAKA------------AAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 273.478 bits (698), Expect = 1.679e-73
Identity = 240/789 (30.42%), Postives = 392/789 (49.68%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNL--FGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+     V  L++     +   + G TALH A+      +V +L+   A+ N+    G T   P+++A          V  LLK   +  L  + +G   L  A++ G    +  LL+ + + +  +        A+HIA +K D  A  LL       ++ +  G T LHIAA    E + + L    A+VN     + S LH+A + G T +  LL+ +    + +R K+  T +H  + SGH +    L+ +G P+    K G   LH AAQ  HV+  +TLL   A V+  T D  TPLH+A   G+  V + L+   A  N +  +   +PLH+A   KN  K  E+LLK  A +  T ++G + LH+A+  G + ++  LLQ+GA+P +    G +PLH+  R     +V+ L+    +  +++DA         E +T +H A+ L          +TDI+ +LL+   +    T+    +PLH  A  G  +V   +++    K  L      K G++PL  AS  G+ E+V +LL+    VD+  ++ +T LH+AA   +  VA +LL + A   A +K G TPLH+AA+    ++   L+ + KA  +A +    TPLHL+AQ G KE+   L+ +    +D  A  + G T +HL A+ DH  V ++      E  IN+ ++ G T  H+A   G L ++K F+  N + + G K +++  T LH AA+ GH+  V+ LL+ GA+P E+   G T L +A + G+  ++E L+
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEE--VVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDSKGKVRL-------PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI-IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACK-KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI----RNGAKVDAQA------RELQTPLHIASRL---------GNTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLT-----KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENG---SDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE--INSKTNAGYTPLHVACHFGQLNMVK-FLVENGADV-GEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 3 Score: 262.307 bits (669), Expect = 4.052e-70
Identity = 233/804 (28.98%), Postives = 372/804 (46.27%), Query Frame = 2
Query: 1244 EGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLR-------RGVPLHMP----------------------NKTGSVCLHAAAQSGHVNVVKTLLDKGANVN---------------------------------ARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDA----------MMLVNL----------PNNE---GETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFV 3394
            EG+ S + A  AG +  + ELL+A  +  T+     +G  ++H+A ++   E +R L    AQ++     G T LHIA+      I+  L    A+VNV      + L+MAA++ H ++V+ L+ K   N     ++G T + V    GH      LL        R   LH+                       +K+G   LH AA  GH NV + LL+KGANVN                                 +RTKDL TPLH A + G+  VV+ L+  GA ++   K G+   +PLH+AA   + +  A  LL   A V++   +  + LH+A+  G++ + K LL   ADP+    +G +PLHI  +     +V+ L+ +    ++  ++          M  +N+          P+ E   GET +H AA   Q         TD++++L+     V  Q +   +TPLH  +  GN+D+++ ++    +      N   ++ +SPL  A+  G  E+  ILL +NA   +  + G T LHLA++ G+  V  +LL     V+ + K  +TPLH+AA     D V  L+ EN A+  A   N  TPLH+AA+  + E+  +LL  K   ADP A    G TPLHL+A+  H ++  L +    ++   A+ +G+T  H+ A    + V  + +  N + I+   N   G T LH+A   G   +VK L++ GA+  E+     T LH AA+ GH + +  L    +       +G TPL +A   G +  V
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTS---NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL-KHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL---APLHMAAQGDHVD-AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ---------TDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANS-----NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN-NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK---ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTN--AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVV 804          

HSP 4 Score: 251.906 bits (642), Expect = 6.206e-67
Identity = 205/665 (30.83%), Postives = 344/665 (51.73%), Query Frame = 2
Query: 2057 GESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQ---TPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFK 4036
            G ++   A+R+G+LE +  LL+ G D +    +G + LH+  +  H  +V+EL+    K ++++DA         +G TA+H A+   Q         + I+ +L+E   +V +Q+     TPL+  A   + +V   +   L+H     ++ +  +G++PL  A   GH  +V++LL+N+++  V     + ALH+AA+K     A +LL ++   +  SK G TPLH+AA  G+++ V +L+ E  A V+    +  +PLH+A ++GR  +   LL            DSR +   TPLH AA++ H  VV L +  +   +   + +G+   H+AA    +   +  + ++++ +  +       T LH+AA  GH ++ K+LLD  A+P     +G T LH+A K     ++E+L    +    + +SG+TPLHVAA  G I+ V  +L       +   P       DV T  G TPLHLA+++   ++VR+L+  +G +V+ A      TPLH AS+ G+T++  +LL  G +SN  TR ++   + LH A+  G  E+A + +   AD       GFTPLH A+K G L+V +LL+ERG   + E  +   PL +AAH+N+ +V   LL N  S     +N      L I +K N  +
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI----KRQAQVDAA------TRKGNTALHIASLAGQ---------SLIVTILVENGANVNVQS-VNGFTPLYMAAQENHEEV---VKYLLKHGANQALSTE--DGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHEN-VGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI------IDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ------QGANP-------DVETVRGETPLHLAARANQTDVVRVLIR-NGAKVD-AQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY---SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNG--YTPLHIAAKKNQME 637          

HSP 5 Score: 157.147 bits (396), Expect = 6.313e-38
Identity = 151/552 (27.36%), Postives = 246/552 (44.57%), Query Frame = 2
Query:  947 PLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAE-GNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK--GGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSIL 2587
            PL +A + + + A   LL      +DV  D  T LH AA      V KLLL + ADPN     G T   P+H+AC +       V+ LL   ++A     + G   L  A   G+I+ +  LL+          +   G+  +H+A R    + +R+L    A+++ +    QT LHIA+  GN + ++  LQ+  A+ N     + S LH+AA++G  ++  +L+D      L   K+G T +H+ S  G+ E    LL RG P+ +  K     LH AA   +  V   LL+ GA+  A  K+ YTPLHIA K     +  TL+ + A  N K   G    +PLH++A   + E  + +L+++G++V     NG +A+H+ ++  ++ + + L   GA+ +     G +PLH+    CH                                                 F   +++K L+E   DV  +T+ +  TPLH  A  G+++    +   LE+      N+Q   G +PL  A   G+  +V  L
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT---PLHIACKKNRIK---VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLL-TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF---TPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA---CH-------------------------------------------------FGQLNMVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNC---VRYLLENGAS--PNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 142.895 bits (359), Expect = 1.342e-33
Identity = 115/395 (29.11%), Postives = 193/395 (48.86%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSL 2116
            E+  TPL +A     +  V  LL+ G NP+     G T LH AA+    DVV++L+   A  +      +  P+H+A SR G +   VI LL+A  ++     ++    L  A + G       LL    ++    KK ++    +H+A +  ++E +RLL +    ++++     T LH+AA  N++ +   L    A          + LH+AA+K   +I   L+ +FK +   + + G T +H+++  GH E +  L+  G  +      G   +H  AQ  HV V + L + GA +N++T   YTPLH+A  +G   +V+ L+  GA V  K      +PLH AA  +    C   LL++GA+ NE    G++ L IA R G + ++++L
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQT-PLHIA-SRLGNTD-IVILLLQAGANSNA-TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT---PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRA-SYTPLHQAA-QQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 113.62 bits (283), Expect = 1.139e-24
Identity = 86/299 (28.76%), Postives = 135/299 (45.15%), Query Frame = 2
Query: 3137 KSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR----------------------------RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLL 3949
            ++ GS +   AA  G  + V  LL AG +    N +G+  LHLA+K GH  ++  L  + +    + + G T LH+A+  GQ   +  +L +  AN+            +V + +G TPL++A+Q  HE +V+ LL     +  + +  +G TPL  A Q GH  V ++LL   S    R                                G T LH A+ +GH  +  L + +GA++N       +PLH A K G   +  LL+ RGA  ++ T D   PL  AA   H +V+  L+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQ-SLIVTILVENGANV------------NVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQ--ALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 8 Score: 64.6994 bits (156), Expect = 9.248e-10
Identity = 68/262 (25.95%), Postives = 105/262 (40.08%), Query Frame = 2
Query:  836 FMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNI-KKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID 1618
            F  L    ++GN+E +      E+  P   + +   TPL +A   N       LLE G +    AK+G T LH AAK    ++   LL  KADPN         P+HL+                          +EG                KE+     E  +++  K  +G  A+H+  ++  V   ++L +  A+IN K   G T LH+A       ++K+L    ADV        + LH AA++GH   V  L++
Sbjct:  558 FTPLHLASKYGNLEVV--RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-KSRAGFTPLHLSA-------------------------QEGH---------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 288.886 bits (738), Expect = 2.529e-78
Identity = 236/795 (29.69%), Postives = 392/795 (49.31%), Query Frame = 2
Query: 1595 KIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQ--VNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQ-LVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGS--TALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            K++ELL  +   ++ T +  G   +H+ S  GH E    L++R   +    + G+  LH A+ +G   +V  L++ GANVN ++ + +TPL++A +  +  VV+ L+ +GA   ++ + G    +PL V A  +  ++   +LL++ +     +     ALHIA++  +      LLQ   +P +  K G +PLHI   Y H  + Q L          ++    VN       + +H A         + +  T++  +LL     +  +TK    TPLH  A +G+  V+  +V      +Q   ++ + KNG +PL  A+   H +    LL + A VD      +T LH+AA  GH  VA +LL   A  N+++  G TPLH+A +     +VE L+ + +A ++A T +  TPLH+AA  G   +   LL      A+P     RG+TPLHLAA+ + +DVVR+ +R   ++   A  +  T  HIA+  G+  ++   ++   +      N +T    + LH+AA+ G  ++  +LLD  A+       G T LHLA+KYG+  ++ +L  + +   +  K+ +TPLHVAAHY   D V  +L +  A+ K+              ++G TPLH+A++     +   LL        +A +  G TPLH ++Q GH  ++ +L+   S+ +  +   G TA+H  +   H+ +A +    GA+IN+  N G+TPLH A   G L + K LVE GA    +T     PL  AA   H   + +LL N  S
Sbjct:   48 KVLELL--RAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF---TPLAV-ALQQGHDRVVAVLLENDSKGKVRL----PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL----------LEKGANVNYQARHNISPLHVA---------TKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV------VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQG---ANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQA-RELQTPLHIASRLGNTDIVILLLQAGAN-----SNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN-DKVAMLLLENGASAKA------------AAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 273.092 bits (697), Expect = 1.869e-73
Identity = 240/789 (30.42%), Postives = 392/789 (49.68%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNL--FGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+     V  L++     +   + G TALH A+      +V +L+   A+ N+    G T   P+++A          V  LLK   +  L  + +G   L  A++ G    +  LL+ + + +  +        A+HIA +K D  A  LL       ++ +  G T LHIAA    E + + L    A+VN     + S LH+A + G T +  LL+ +    + +R K+  T +H  + SGH +    L+ +G P+    K G   LH AAQ  HV+  +TLL   A V+  T D  TPLH+A   G+  V + L+   A  N +  +   +PLH+A   KN  K  E+LLK  A +  T ++G + LH+A+  G + ++  LLQ+GA+P +    G +PLH+  R     +V+ L+    +  +++DA         E +T +H A+ L          +TDI+ +LL+   +    T+    +PLH  A  G  +V   +++    K  L      K G++PL  AS  G+ E+V +LL+    VD+  ++ +T LH+AA   +  VA +LL + A   A +K G TPLH+AA+    ++   L+ + KA  +A +    TPLHL+AQ G KE+   L+ +    +D  A  + G T +HL A+ DH  V ++      E  IN+ ++ G T  H+A   G L ++K F+  N + + G K +++  T LH AA+ GH+  V+ LL+ GA+P E+   G T L +A + G+  ++E L+
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEE--VVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP-------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI-IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACK-KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI----RNGAKVDAQA------RELQTPLHIASRL---------GNTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLT-----KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENG---SDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE--INSKTNAGYTPLHVACHFGQLNMVK-FLVENGADV-GEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 3 Score: 262.307 bits (669), Expect = 4.691e-70
Identity = 233/804 (28.98%), Postives = 372/804 (46.27%), Query Frame = 2
Query: 1244 EGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLR-------RGVPLHMP----------------------NKTGSVCLHAAAQSGHVNVVKTLLDKGANVN---------------------------------ARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDA----------MMLVNL----------PNNE---GETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFV 3394
            EG+ S + A  AG +  + ELL+A  +  T+     +G  ++H+A ++   E +R L    AQ++     G T LHIA+      I+  L    A+VNV      + L+MAA++ H ++V+ L+ K   N     ++G T + V    GH      LL        R   LH+                       +K+G   LH AA  GH NV + LL+KGANVN                                 +RTKDL TPLH A + G+  VV+ L+  GA ++   K G+   +PLH+AA   + +  A  LL   A V++   +  + LH+A+  G++ + K LL   ADP+    +G +PLHI  +     +V+ L+ +    ++  ++          M  +N+          P+ E   GET +H AA   Q         TD++++L+     V  Q +   +TPLH  +  GN+D+++ ++    +      N   ++ +SPL  A+  G  E+  ILL +NA   +  + G T LHLA++ G+  V  +LL     V+ + K  +TPLH+AA     D V  L+ EN A+  A   N  TPLH+AA+  + E+  +LL  K   ADP A    G TPLHL+A+  H ++  L +    ++   A+ +G+T  H+ A    + V  + +  N + I+   N   G T LH+A   G   +VK L++ GA+  E+     T LH AA+ GH + +  L    +       +G TPL +A   G +  V
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTS---NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL-KHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL---APLHMAAQGDHVD-AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ---------TDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANS-----NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN-NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK---ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTN--AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVV 804          

HSP 4 Score: 251.906 bits (642), Expect = 5.991e-67
Identity = 205/665 (30.83%), Postives = 344/665 (51.73%), Query Frame = 2
Query: 2057 GESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQ---TPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFK 4036
            G ++   A+R+G+LE +  LL+ G D +    +G + LH+  +  H  +V+EL+    K ++++DA         +G TA+H A+   Q         + I+ +L+E   +V +Q+     TPL+  A   + +V   +   L+H     ++ +  +G++PL  A   GH  +V++LL+N+++  V     + ALH+AA+K     A +LL ++   +  SK G TPLH+AA  G+++ V +L+ E  A V+    +  +PLH+A ++GR  +   LL            DSR +   TPLH AA++ H  VV L +  +   +   + +G+   H+AA    +   +  + ++++ +  +       T LH+AA  GH ++ K+LLD  A+P     +G T LH+A K     ++E+L    +    + +SG+TPLHVAA  G I+ V  +L       +   P       DV T  G TPLHLA+++   ++VR+L+  +G +V+ A      TPLH AS+ G+T++  +LL  G +SN  TR ++   + LH A+  G  E+A + +   AD       GFTPLH A+K G L+V +LL+ERG   + E  +   PL +AAH+N+ +V   LL N  S     +N      L I +K N  +
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI----KRQAQVDAA------TRKGNTALHIASLAGQ---------SLIVTILVENGANVNVQS-VNGFTPLYMAAQENHEEV---VKYLLKHGANQALSTE--DGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHEN-VGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI------IDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ------QGANP-------DVETVRGETPLHLAARANQTDVVRVLIR-NGAKVD-AQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY---SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNG--YTPLHIAAKKNQME 637          

HSP 5 Score: 156.762 bits (395), Expect = 8.419e-38
Identity = 151/552 (27.36%), Postives = 246/552 (44.57%), Query Frame = 2
Query:  947 PLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAE-GNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK--GGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSIL 2587
            PL +A + + + A   LL      +DV  D  T LH AA      V KLLL + ADPN     G T   P+H+AC +       V+ LL   ++A     + G   L  A   G+I+ +  LL+          +   G+  +H+A R    + +R+L    A+++ +    QT LHIA+  GN + ++  LQ+  A+ N     + S LH+AA++G  ++  +L+D      L   K+G T +H+ S  G+ E    LL RG P+ +  K     LH AA   +  V   LL+ GA+  A  K+ YTPLHIA K     +  TL+ + A  N K   G    +PLH++A   + E  + +L+++G++V     NG +A+H+ ++  ++ + + L   GA+ +     G +PLH+    CH                                                 F   +++K L+E   DV  +T+ +  TPLH  A  G+++    +   LE+      N+Q   G +PL  A   G+  +V  L
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT---PLHIACKKNRIK---VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLL-TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF---TPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA---CH-------------------------------------------------FGQLNMVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNC---VRYLLENGAS--PNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 142.51 bits (358), Expect = 1.684e-33
Identity = 115/395 (29.11%), Postives = 193/395 (48.86%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSL 2116
            E+  TPL +A     +  V  LL+ G NP+     G T LH AA+    DVV++L+   A  +      +  P+H+A SR G +   VI LL+A  ++     ++    L  A + G       LL    ++    KK ++    +H+A +  ++E +RLL +    ++++     T LH+AA  N++ +   L    A          + LH+AA+K   +I   L+ +FK +   + + G T +H+++  GH E +  L+  G  +      G   +H  AQ  HV V + L + GA +N++T   YTPLH+A  +G   +V+ L+  GA V  K      +PLH AA  +    C   LL++GA+ NE    G++ L IA R G + ++++L
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQT-PLHIA-SRLGNTD-IVILLLQAGANSNA-TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT---PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRA-SYTPLHQAA-QQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 113.62 bits (283), Expect = 1.155e-24
Identity = 86/299 (28.76%), Postives = 135/299 (45.15%), Query Frame = 2
Query: 3137 KSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR----------------------------RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLL 3949
            ++ GS +   AA  G  + V  LL AG +    N +G+  LHLA+K GH  ++  L  + +    + + G T LH+A+  GQ   +  +L +  AN+            +V + +G TPL++A+Q  HE +V+ LL     +  + +  +G TPL  A Q GH  V ++LL   S    R                                G T LH A+ +GH  +  L + +GA++N       +PLH A K G   +  LL+ RGA  ++ T D   PL  AA   H +V+  L+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQ-SLIVTILVENGANV------------NVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQ--ALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 8 Score: 64.3142 bits (155), Expect = 1.097e-9
Identity = 68/262 (25.95%), Postives = 105/262 (40.08%), Query Frame = 2
Query:  836 FMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKY-SGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID 1618
            F  L    ++GN+E +      E+  P   + +   TPL +A   N       LLE G +    AK+G T LH AAK    ++   LL  KADPN         P+HL+                          +EG                KE+     E  +++  K  +G  A+H+  ++  V   ++L +  A+IN K   G T LH+A       ++K+L    ADV        + LH AA++GH   V  L++
Sbjct:  558 FTPLHLASKYGNLEVV--RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-KSRAGFTPLHLSA-------------------------QEGH---------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 288.886 bits (738), Expect = 2.529e-78
Identity = 236/795 (29.69%), Postives = 392/795 (49.31%), Query Frame = 2
Query: 1595 KIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQ--VNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQ-LVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGS--TALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            K++ELL  +   ++ T +  G   +H+ S  GH E    L++R   +    + G+  LH A+ +G   +V  L++ GANVN ++ + +TPL++A +  +  VV+ L+ +GA   ++ + G    +PL V A  +  ++   +LL++ +     +     ALHIA++  +      LLQ   +P +  K G +PLHI   Y H  + Q L          ++    VN       + +H A         + +  T++  +LL     +  +TK    TPLH  A +G+  V+  +V      +Q   ++ + KNG +PL  A+   H +    LL + A VD      +T LH+AA  GH  VA +LL   A  N+++  G TPLH+A +     +VE L+ + +A ++A T +  TPLH+AA  G   +   LL      A+P     RG+TPLHLAA+ + +DVVR+ +R   ++   A  +  T  HIA+  G+  ++   ++   +      N +T    + LH+AA+ G  ++  +LLD  A+       G T LHLA+KYG+  ++ +L  + +   +  K+ +TPLHVAAHY   D V  +L +  A+ K+              ++G TPLH+A++     +   LL        +A +  G TPLH ++Q GH  ++ +L+   S+ +  +   G TA+H  +   H+ +A +    GA+IN+  N G+TPLH A   G L + K LVE GA    +T     PL  AA   H   + +LL N  S
Sbjct:   48 KVLELL--RAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF---TPLAV-ALQQGHDRVVAVLLENDSKGKVRL----PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL----------LEKGANVNYQARHNISPLHVA---------TKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV------VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQG---ANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQA-RELQTPLHIASRLGNTDIVILLLQAGAN-----SNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN-DKVAMLLLENGASAKA------------AAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 273.092 bits (697), Expect = 1.869e-73
Identity = 240/789 (30.42%), Postives = 392/789 (49.68%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNL--FGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+     V  L++     +   + G TALH A+      +V +L+   A+ N+    G T   P+++A          V  LLK   +  L  + +G   L  A++ G    +  LL+ + + +  +        A+HIA +K D  A  LL       ++ +  G T LHIAA    E + + L    A+VN     + S LH+A + G T +  LL+ +    + +R K+  T +H  + SGH +    L+ +G P+    K G   LH AAQ  HV+  +TLL   A V+  T D  TPLH+A   G+  V + L+   A  N +  +   +PLH+A   KN  K  E+LLK  A +  T ++G + LH+A+  G + ++  LLQ+GA+P +    G +PLH+  R     +V+ L+    +  +++DA         E +T +H A+ L          +TDI+ +LL+   +    T+    +PLH  A  G  +V   +++    K  L      K G++PL  AS  G+ E+V +LL+    VD+  ++ +T LH+AA   +  VA +LL + A   A +K G TPLH+AA+    ++   L+ + KA  +A +    TPLHL+AQ G KE+   L+ +    +D  A  + G T +HL A+ DH  V ++      E  IN+ ++ G T  H+A   G L ++K F+  N + + G K +++  T LH AA+ GH+  V+ LL+ GA+P E+   G T L +A + G+  ++E L+
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEE--VVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP-------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI-IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACK-KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI----RNGAKVDAQA------RELQTPLHIASRL---------GNTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLT-----KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENG---SDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE--INSKTNAGYTPLHVACHFGQLNMVK-FLVENGADV-GEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 3 Score: 262.307 bits (669), Expect = 4.691e-70
Identity = 233/804 (28.98%), Postives = 372/804 (46.27%), Query Frame = 2
Query: 1244 EGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLR-------RGVPLHMP----------------------NKTGSVCLHAAAQSGHVNVVKTLLDKGANVN---------------------------------ARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDA----------MMLVNL----------PNNE---GETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFV 3394
            EG+ S + A  AG +  + ELL+A  +  T+     +G  ++H+A ++   E +R L    AQ++     G T LHIA+      I+  L    A+VNV      + L+MAA++ H ++V+ L+ K   N     ++G T + V    GH      LL        R   LH+                       +K+G   LH AA  GH NV + LL+KGANVN                                 +RTKDL TPLH A + G+  VV+ L+  GA ++   K G+   +PLH+AA   + +  A  LL   A V++   +  + LH+A+  G++ + K LL   ADP+    +G +PLHI  +     +V+ L+ +    ++  ++          M  +N+          P+ E   GET +H AA   Q         TD++++L+     V  Q +   +TPLH  +  GN+D+++ ++    +      N   ++ +SPL  A+  G  E+  ILL +NA   +  + G T LHLA++ G+  V  +LL     V+ + K  +TPLH+AA     D V  L+ EN A+  A   N  TPLH+AA+  + E+  +LL  K   ADP A    G TPLHL+A+  H ++  L +    ++   A+ +G+T  H+ A    + V  + +  N + I+   N   G T LH+A   G   +VK L++ GA+  E+     T LH AA+ GH + +  L    +       +G TPL +A   G +  V
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTS---NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL-KHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL---APLHMAAQGDHVD-AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ---------TDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANS-----NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN-NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK---ADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTN--AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVV 804          

HSP 4 Score: 251.906 bits (642), Expect = 5.991e-67
Identity = 205/665 (30.83%), Postives = 344/665 (51.73%), Query Frame = 2
Query: 2057 GESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQ---TPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFK 4036
            G ++   A+R+G+LE +  LL+ G D +    +G + LH+  +  H  +V+EL+    K ++++DA         +G TA+H A+   Q         + I+ +L+E   +V +Q+     TPL+  A   + +V   +   L+H     ++ +  +G++PL  A   GH  +V++LL+N+++  V     + ALH+AA+K     A +LL ++   +  SK G TPLH+AA  G+++ V +L+ E  A V+    +  +PLH+A ++GR  +   LL            DSR +   TPLH AA++ H  VV L +  +   +   + +G+   H+AA    +   +  + ++++ +  +       T LH+AA  GH ++ K+LLD  A+P     +G T LH+A K     ++E+L    +    + +SG+TPLHVAA  G I+ V  +L       +   P       DV T  G TPLHLA+++   ++VR+L+  +G +V+ A      TPLH AS+ G+T++  +LL  G +SN  TR ++   + LH A+  G  E+A + +   AD       GFTPLH A+K G L+V +LL+ERG   + E  +   PL +AAH+N+ +V   LL N  S     +N      L I +K N  +
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI----KRQAQVDAA------TRKGNTALHIASLAGQ---------SLIVTILVENGANVNVQS-VNGFTPLYMAAQENHEEV---VKYLLKHGANQALSTE--DGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHEN-VGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI------IDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLL-YHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ------QGANP-------DVETVRGETPLHLAARANQTDVVRVLIR-NGAKVD-AQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY---SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNG--YTPLHIAAKKNQME 637          

HSP 5 Score: 156.762 bits (395), Expect = 8.419e-38
Identity = 151/552 (27.36%), Postives = 246/552 (44.57%), Query Frame = 2
Query:  947 PLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAE-GNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK--GGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSIL 2587
            PL +A + + + A   LL      +DV  D  T LH AA      V KLLL + ADPN     G T   P+H+AC +       V+ LL   ++A     + G   L  A   G+I+ +  LL+          +   G+  +H+A R    + +R+L    A+++ +    QT LHIA+  GN + ++  LQ+  A+ N     + S LH+AA++G  ++  +L+D      L   K+G T +H+ S  G+ E    LL RG P+ +  K     LH AA   +  V   LL+ GA+  A  K+ YTPLHIA K     +  TL+ + A  N K   G    +PLH++A   + E  + +L+++G++V     NG +A+H+ ++  ++ + + L   GA+ +     G +PLH+    CH                                                 F   +++K L+E   DV  +T+ +  TPLH  A  G+++    +   LE+      N+Q   G +PL  A   G+  +V  L
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT---PLHIACKKNRIK---VVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG-ANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLL-TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF---TPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA---CH-------------------------------------------------FGQLNMVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNC---VRYLLENGAS--PNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 142.51 bits (358), Expect = 1.684e-33
Identity = 115/395 (29.11%), Postives = 193/395 (48.86%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSL 2116
            E+  TPL +A     +  V  LL+ G NP+     G T LH AA+    DVV++L+   A  +      +  P+H+A SR G +   VI LL+A  ++     ++    L  A + G       LL    ++    KK ++    +H+A +  ++E +RLL +    ++++     T LH+AA  N++ +   L    A          + LH+AA+K   +I   L+ +FK +   + + G T +H+++  GH E +  L+  G  +      G   +H  AQ  HV V + L + GA +N++T   YTPLH+A  +G   +V+ L+  GA V  K      +PLH AA  +    C   LL++GA+ NE    G++ L IA R G + ++++L
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQT-PLHIA-SRLGNTD-IVILLLQAGANSNA-TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT---PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRA-SYTPLHQAA-QQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 113.62 bits (283), Expect = 1.155e-24
Identity = 86/299 (28.76%), Postives = 135/299 (45.15%), Query Frame = 2
Query: 3137 KSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR----------------------------RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLL 3949
            ++ GS +   AA  G  + V  LL AG +    N +G+  LHLA+K GH  ++  L  + +    + + G T LH+A+  GQ   +  +L +  AN+            +V + +G TPL++A+Q  HE +V+ LL     +  + +  +G TPL  A Q GH  V ++LL   S    R                                G T LH A+ +GH  +  L + +GA++N       +PLH A K G   +  LL+ RGA  ++ T D   PL  AA   H +V+  L+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQ-SLIVTILVENGANV------------NVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQ--ALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 8 Score: 64.3142 bits (155), Expect = 1.097e-9
Identity = 68/262 (25.95%), Postives = 105/262 (40.08%), Query Frame = 2
Query:  836 FMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKY-SGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID 1618
            F  L    ++GN+E +      E+  P   + +   TPL +A   N       LLE G +    AK+G T LH AAK    ++   LL  KADPN         P+HL+                          +EG                KE+     E  +++  K  +G  A+H+  ++  V   ++L +  A+IN K   G T LH+A       ++K+L    ADV        + LH AA++GH   V  L++
Sbjct:  558 FTPLHLASKYGNLEVV--RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-KSRAGFTPLHLSA-------------------------QEGH---------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0300012)

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 711/1620 (43.89%), Postives = 1002/1620 (61.85%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSK----------EKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKA-DPNLFGGSTKCLPIHLACSR-TGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLE-HKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXX-XXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPI-LIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILS----------------GDYSNVPGVLSKVVF--LYFALFGQATPVDL-PDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLT---QLIIYSTKIYYRIRKRP------------------------LYKENDRKRKFHIFENLLGDIAALKN-EEDKLENVVNWNVIVRRYLSIRNVEGNSDLTVDD 5503
            K + L  K EW  +EA L+   K            PL    D  T  TPLM A KDN+   +DR++E+G +      D    LH AA ++ EDVVKLLL K+  DP   GGS     +HL  SR TGT++  + +LL A  K  RL+ D  G I L+ A+E+G+ S  +ELL A+  +Q       +GD A+H+A R++DV+ +R+L D    ++ +NG GQT LHIAA   DE +LKY     A  ++ D+ DR+ +H+AAE GH  ++E+L DKFK ++  R K+G+TLMH+ S++GH E    L ++GV LHMPNK G+  +H AA  GH  ++ TLL KG  V+  T D YT LHIAV+   P VVETL+G+GA V+ +GG L E+PLH+AA  K+G++CA MLLKSGA+ N T  +  + +H+A+R GNL  L  LL++  DP      G +PLH+  R CH  IV+ L+    +      A   +N  N +G TA+H+  ++ ++       D  I++MLLE   DV +QTK   ET  HYCA AGN+DVL+E+++ +    IQ  +N+Q+  GW+PLL A H GH E+V+ LL N+ARVDVFD  G +ALHLAAE+G+ +V + LL +KAF+N+KS+ G T LHLAA NG+  LV+ LI ++ A +D LTL ++TPLHLAA  G+ EVC+ LL      A+  A D  GQ P+H+AA+N++S+V +LFL+  P L+   S DG TC HIAA  GS+ VI+E M+F++S +   +NK T +T L LAAEGGH  +VK L+ AGA+  EEN  G T +HLAA+ GH  +L+VLK   S R+ S K G+TPLHVAA+YGQ D V E+LT VPA +KSE P       D+ TESG+TPLHLA+ SG+EN+VRLLLN  GV+V++AT  NG  PLH A   GH +V  +LL +S+  +  +D  GRT LH A+ HGHI+M  + +GQGA+INA+D  G+TPLH AAK+G+L+V KLL E GAS ++ETN     +  AA   H EV+ +L+  +H T  L+E+ +F+++LM+ SK +N K ++EF+L+SPAP + AAKLSN +  LS KEKER+KDL+   + C+ M T+L ALAA  + A K+L++ D   V+FLD+LIE EQKEVI+H +VQRYL ++W+G L W +WK+ +  +  ++ P  W     P+G K    P++KFM YL SH+YL   L  V +   YP  R +      E  LLI LSGLL+ EL NP D+  + S+K  +L  G   V V   +F+ +     P L+Y RNQ  + A  +  +  LDFLS HHLFGPW III DL+ DL +F+ +LAIF+  F+  +VA  Q   +                G +S+ P +   + F  L+FA+FGQ T +D+ P   L P +   L + VFGI L+++++VLINLLIAMM++TY+ IQA+SD EWK+G +KLIRNM +T+  PSP NL+T     I+   K   + +KRP                        + K++    + H+  + LG  A+     ++++ENV +W  I ++Y ++   E    L   D
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQLKATTA-NGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGHAECATMLFKKGVYLHMPNKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLE---LGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPVWIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDGP-MTPFLAFERLFFAVFGQTTTLDINPMRHLRPEWTEVLFKFVFGIYLLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHL--SPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEGGSLKDSD 1694          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0304843)

HSP 1 Score: 1249.57 bits (3232), Expect = 0.000e+0
Identity = 711/1627 (43.70%), Postives = 1001/1627 (61.52%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSK----------EKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKA-DPNLFGGSTKCLPIHLACSR-TGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLE-HKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXX-XXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPI-LIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILS----------------GDYSNV---PGVLSKVVFLYFALFGQATP----VDLPDPGLTPG---YAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLT---QLIIYSTKIYYRIRKRP------------------------LYKENDRKRKFHIFENLLGDIAALKN-EEDKLENVVNWNVIVRRYLSIRNVEGNSDLTVDD 5503
            K + L  K EW  +EA L+   K            PL    D  T  TPLM A KDN+   +DR++E+G +      D    LH AA ++ EDVVKLLL K+  DP   GGS     +HL  SR TGT++  + +LL A  K  RL+ D  G I L+ A+E+G+ S  +ELL A+  +Q       +GD A+H+A R++DV+ +R+L D    ++ +NG GQT LHIAA   DE +LKY     A  ++ D+ DR+ +H+AAE GH  ++E+L DKFK ++  R K+G+TLMH+ S++GH E    L ++GV LHMPNK G+  +H AA  GH  ++ TLL KG  V+  T D YT LHIAV+   P VVETL+G+GA V+ +GG L E+PLH+AA  K+G++CA MLLKSGA+ N T  +  + +H+A+R GNL  L  LL++  DP      G +PLH+  R CH  IV+ L+    +      A   +N  N +G TA+H+  ++ ++       D  I++MLLE   DV +QTK   ET  HYCA AGN+DVL+E+++ +    IQ  +N+Q+  GW+PLL A H GH E+V+ LL N+ARVDVFD  G +ALHLAAE+G+ +V + LL +KAF+N+KS+ G T LHLAA NG+  LV+ LI ++ A +D LTL ++TPLHLAA  G+ EVC+ LL      A+  A D  GQ P+H+AA+N++S+V +LFL+  P L+   S DG TC HIAA  GS+ VI+E M+F++S +   +NK T +T L LAAEGGH  +VK L+ AGA+  EEN  G T +HLAA+ GH  +L+VLK   S R+ S K G+TPLHVAA+YGQ D V E+LT VPA +KSE P       D+ TESG+TPLHLA+ SG+EN+VRLLLN  GV+V++AT  NG  PLH A   GH +V  +LL +S+  +  +D  GRT LH A+ HGHI+M  + +GQGA+INA+D  G+TPLH AAK+G+L+V KLL E GAS ++ETN     +  AA   H EV+ +L+  +H T  L+E+ +F+++LM+ SK +N K ++EF+L+SPAP + AAKLSN +  LS KEKER+KDL+   + C+ M T+L ALAA  + A K+L++ D   V+FLD+LIE EQKEVI+H +VQRYL ++W+G L W +WK+ +  +  ++ P  W     P+G K    P++KFM YL SH+YL   L  V +   YP  R +      E  LLI LSGLL+ EL NP D+  + S+K  +L  G   V V   +F+ +     P L+Y RNQ  + A  +  +  LDFLS HHLFGPW III DL+ DL +F+ +LAIF+  F+  +VA  Q   +                G +S+V   P  ++    L+FA+FGQ T     VD      TP    +  YL + VFGI ++++++VLINLLIAMM++TY+ IQA+SD EWK+G +KLIRNM +T+  PSP NL+T     I+   K   + +KRP                        + K++    + H+  + LG  A+     ++++ENV +W  I ++Y ++   E    L   D
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQLKATTA-NGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGHAECATMLFKKGVYLHMPNKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLE---LGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPVWIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDVRMHP--INSFELLFFAVFGQTTTEQTQVDKIKNVATPTQPYWVEYLFKIVFGIYMLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHL--SPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEGGSLKDSD 1700          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0343224)

HSP 1 Score: 1248.8 bits (3230), Expect = 0.000e+0
Identity = 709/1632 (43.44%), Postives = 998/1632 (61.15%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSK----------EKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKA-DPNLFGGSTKCLPIHLACSR-TGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLE-HKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXX-XXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPI-LIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILS----------------GDYSNV---PGVLSKVVFLYFALFGQATP----VDLPDPGLTPG---YAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIY--------------------------------STKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAALKN-EEDKLENVVNWNVIVRRYLSIRNVEGNSDLTVDD 5503
            K + L  K EW  +EA L+   K            PL    D  T  TPLM A KDN+   +DR++E+G +      D    LH AA ++ EDVVKLLL K+  DP   GGS     +HL  SR TGT++  + +LL A  K  RL+ D  G I L+ A+E+G+ S  +ELL A+  +Q       +GD A+H+A R++DV+ +R+L D    ++ +NG GQT LHIAA   DE +LKY     A  ++ D+ DR+ +H+AAE GH  ++E+L DKFK ++  R K+G+TLMH+ S++GH E    L ++GV LHMPNK G+  +H AA  GH  ++ TLL KG  V+  T D YT LHIAV+   P VVETL+G+GA V+ +GG L E+PLH+AA  K+G++CA MLLKSGA+ N T  +  + +H+A+R GNL  L  LL++  DP      G +PLH+  R CH  IV+ L+    +      A   +N  N +G TA+H+  ++ ++       D  I++MLLE   DV +QTK   ET  HYCA AGN+DVL+E+++ +    IQ  +N+Q+  GW+PLL A H GH E+V+ LL N+ARVDVFD  G +ALHLAAE+G+ +V + LL +KAF+N+KS+ G T LHLAA NG+  LV+ LI ++ A +D LTL ++TPLHLAA  G+ EVC+ LL      A+  A D  GQ P+H+AA+N++S+V +LFL+  P L+   S DG TC HIAA  GS+ VI+E M+F++S +   +NK T +T L LAAEGGH  +VK L+ AGA+  EEN  G T +HLAA+ GH  +L+VLK   S R+ S K G+TPLHVAA+YGQ D V E+LT VPA +KSE P       D+ TESG+TPLHLA+ SG+EN+VRLLLN  GV+V++AT  NG  PLH A   GH +V  +LL +S+  +  +D  GRT LH A+ HGHI+M  + +GQGA+INA+D  G+TPLH AAK+G+L+V KLL E GAS ++ETN     +  AA   H EV+ +L+  +H T  L+E+ +F+++LM+ SK +N K ++EF+L+SPAP + AAKLSN +  LS KEKER+KDL+   + C+ M T+L ALAA  + A K+L++ D   V+FLD+LIE EQKEVI+H +VQRYL ++W+G L W +WK+ +  +  ++ P  W     P+G K    P++KFM YL SH+YL   L  V +   YP  R +      E  LLI LSGLL+ EL NP D+  + S+K  +L  G   V V   +F+ +     P L+Y RNQ  + A  +  +  LDFLS HHLFGPW III DL+ DL +F+ +LAIF+  F+  +VA  Q   +                G +S+V   P  ++    L+FA+FGQ T     VD      TP    +  YL + VFGI ++++++VLINLLIAMM++TY+ IQA+SD EWK+G +KLIRNM +T+  PSP NL+T   ++                                  K   +I+K   Y  +    + H+  + LG  A+     ++++ENV +W  I ++Y ++   E    L   D
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQLKATTA-NGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGHAECATMLFKKGVYLHMPNKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLE---LGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPVWIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDVRMHP--INSFELLFFAVFGQTTTEQTQVDKIKNVATPTQPYWVEYLFKIVFGIYMLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKGETY--SVALSQVHL--SPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEGGSLKDSD 1703          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347408)

HSP 1 Score: 1239.94 bits (3207), Expect = 0.000e+0
Identity = 713/1648 (43.26%), Postives = 1002/1648 (60.80%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSK----------EKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKA-DPNLFGGSTKCLPIHLACSR-TGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLE-HKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXX-XXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPI-LIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILS----------------GDYSN-------VPGVLSKV------------------VFLYF-----ALFGQATPVDL-PDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLT---QLIIYSTKIYYRIRKRP------------------------LYKENDRKRKFHIFENLLGDIAALKN-EEDKLENVVNWNVIVRRYLSIRNVEGNSDLTVDD 5503
            K + L  K EW  +EA L+   K            PL    D  T  TPLM A KDN+   +DR++E+G +      D    LH AA ++ EDVVKLLL K+  DP   GGS     +HL  SR TGT++  + +LL A  K  RL+ D  G I L+ A+E+G+ S  +ELL A+  +Q       +GD A+H+A R++DV+ +R+L D    ++ +NG GQT LHIAA   DE +LKY     A  ++ D+ DR+ +H+AAE GH  ++E+L DKFK ++  R K+G+TLMH+ S++GH E    L ++GV LHMPNK G+  +H AA  GH  ++ TLL KG  V+  T D YT LHIAV+   P VVETL+G+GA V+ +GG L E+PLH+AA  K+G++CA MLLKSGA+ N T  +  + +H+A+R GNL  L  LL++  DP      G +PLH+  R CH  IV+ L+    +      A   +N  N +G TA+H+  ++ ++       D  I++MLLE   DV +QTK   ET  HYCA AGN+DVL+E+++ +    IQ  +N+Q+  GW+PLL A H GH E+V+ LL N+ARVDVFD  G +ALHLAAE+G+ +V + LL +KAF+N+KS+ G T LHLAA NG+  LV+ LI ++ A +D LTL ++TPLHLAA  G+ EVC+ LL      A+  A D  GQ P+H+AA+N++S+V +LFL+  P L+   S DG TC HIAA  GS+ VI+E M+F++S +   +NK T +T L LAAEGGH  +VK L+ AGA+  EEN  G T +HLAA+ GH  +L+VLK   S R+ S K G+TPLHVAA+YGQ D V E+LT VPA +KSE P       D+ TESG+TPLHLA+ SG+EN+VRLLLN  GV+V++AT  NG  PLH A   GH +V  +LL +S+  +  +D  GRT LH A+ HGHI+M  + +GQGA+INA+D  G+TPLH AAK+G+L+V KLL E GAS ++ETN     +  AA   H EV+ +L+  +H T  L+E+ +F+++LM+ SK +N K ++EF+L+SPAP + AAKLSN +  LS KEKER+KDL+   + C+ M T+L ALAA  + A K+L++ D   V+FLD+LIE EQKEVI+H +VQRYL ++W+G L W +WK+ +  +  ++ P  W     P+G K    P++KFM YL SH+YL   L  V +   YP  R +      E  LLI LSGLL+ EL NP D+  + S+K  +L  G   V V   +F+ +     P L+Y RNQ  + A  +  +  LDFLS HHLFGPW III DL+ DL +F+ +LAIF+  F+  +VA  Q   +                G +S+        P V + V                   FL F     A+FGQ T +D+ P   L P +   L + VFGI L+++++VLINLLIAMM++TY+ IQA+SD EWK+G +KLIRNM +T+  PSP NL+T     I+   K   + +KRP                        + K++    + H+  + LG  A+     ++++ENV +W  I ++Y ++   E    L   D
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQLKATTA-NGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGHAECATMLFKKGVYLHMPNKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLE---LGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPVWIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDDDMPTPRPPPVENYVDSRFSEFRRKHKDDRPMTPFLAFERLFFAVFGQTTTLDINPMRHLRPEWTEVLFKFVFGIYLLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHL--SPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEGGSLKDSD 1723          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347409)

HSP 1 Score: 1237.63 bits (3201), Expect = 0.000e+0
Identity = 711/1654 (42.99%), Postives = 1001/1654 (60.52%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSK----------EKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKA-DPNLFGGSTKCLPIHLACSR-TGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLE-HKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXX-XXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPI-LIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILS----------------GDYSN-------VPGV-----------------------LSKVVFLYFALFGQATP----VDLPDPGLTPG---YAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLT---QLIIYSTKIYYRIRKRP------------------------LYKENDRKRKFHIFENLLGDIAALKN-EEDKLENVVNWNVIVRRYLSIRNVEGNSDLTVDD 5503
            K + L  K EW  +EA L+   K            PL    D  T  TPLM A KDN+   +DR++E+G +      D    LH AA ++ EDVVKLLL K+  DP   GGS     +HL  SR TGT++  + +LL A  K  RL+ D  G I L+ A+E+G+ S  +ELL A+  +Q       +GD A+H+A R++DV+ +R+L D    ++ +NG GQT LHIAA   DE +LKY     A  ++ D+ DR+ +H+AAE GH  ++E+L DKFK ++  R K+G+TLMH+ S++GH E    L ++GV LHMPNK G+  +H AA  GH  ++ TLL KG  V+  T D YT LHIAV+   P VVETL+G+GA V+ +GG L E+PLH+AA  K+G++CA MLLKSGA+ N T  +  + +H+A+R GNL  L  LL++  DP      G +PLH+  R CH  IV+ L+    +      A   +N  N +G TA+H+  ++ ++       D  I++MLLE   DV +QTK   ET  HYCA AGN+DVL+E+++ +    IQ  +N+Q+  GW+PLL A H GH E+V+ LL N+ARVDVFD  G +ALHLAAE+G+ +V + LL +KAF+N+KS+ G T LHLAA NG+  LV+ LI ++ A +D LTL ++TPLHLAA  G+ EVC+ LL      A+  A D  GQ P+H+AA+N++S+V +LFL+  P L+   S DG TC HIAA  GS+ VI+E M+F++S +   +NK T +T L LAAEGGH  +VK L+ AGA+  EEN  G T +HLAA+ GH  +L+VLK   S R+ S K G+TPLHVAA+YGQ D V E+LT VPA +KSE P       D+ TESG+TPLHLA+ SG+EN+VRLLLN  GV+V++AT  NG  PLH A   GH +V  +LL +S+  +  +D  GRT LH A+ HGHI+M  + +GQGA+INA+D  G+TPLH AAK+G+L+V KLL E GAS ++ETN     +  AA   H EV+ +L+  +H T  L+E+ +F+++LM+ SK +N K ++EF+L+SPAP + AAKLSN +  LS KEKER+KDL+   + C+ M T+L ALAA  + A K+L++ D   V+FLD+LIE EQKEVI+H +VQRYL ++W+G L W +WK+ +  +  ++ P  W     P+G K    P++KFM YL SH+YL   L  V +   YP  R +      E  LLI LSGLL+ EL NP D+  + S+K  +L  G   V V   +F+ +     P L+Y RNQ  + A  +  +  LDFLS HHLFGPW III DL+ DL +F+ +LAIF+  F+  +VA  Q   +                G +S+        P V                       ++    L+FA+FGQ T     VD      TP    +  YL + VFGI ++++++VLINLLIAMM++TY+ IQA+SD EWK+G +KLIRNM +T+  PSP NL+T     I+   K   + +KRP                        + K++    + H+  + LG  A+     ++++ENV +W  I ++Y ++   E    L   D
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQLKATTA-NGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGHAECATMLFKKGVYLHMPNKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLE---LGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPVWIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDDDMPTPRPPPVENYVDSRFSEFRRKHKDDLRMHPINSFELLFFAVFGQTTTEQTQVDKIKNVATPTQPYWVEYLFKIVFGIYMLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHL--SPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEGGSLKDSD 1729          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01073736.1 (pep chromosome:GRCz11:19:1465004:1479740:1 gene:ENSDARG00000099438.2 transcript:ENSDART00000159157.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01073736.1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 385/912 (42.21%), Postives = 555/912 (60.86%), Query Frame = 2
Query: 2933 RGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPK-TGE---QMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADK----LLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXXPLSWFIILLPVGKKIF-TAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXIN----PIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIP----ELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSN------VPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYR-------IRKRPLYKEND------RKRKFHIFENLLGDIAALKNEED-------------------KLENVVNWNVIVRRYLSIRNVEGNSDLTVDD 5503
            RGQTPLHLAA++DHS+VV+LFLR +PEL   A+ DG TC HIAAA GS++VI+E + FN+  +  L +K+ G   LHLAA GGH ++VKVLL+AGA+  EE+ +GMT +HLAAK+GH H+LEVL+  +  ++ S+K+G T LHVAA +GQ++FV E+LT VPA I+SE P  TG+   + +  L ESG TPLHLASQSGHE++VRLLLNC GV+ ++ TN  G++PLH A+Q+GHT V  +LL +SS+ + + D +GR+ALH A++HGH++M  + +GQGA+IN +D  G+T LHYAA++G L+V   LVE GAS  AE +  + PL  AA  NH   + FLLR + +T++L+++ KF+F+LM+C ++N+  S+EE +L + AP + A +LS      + +EKERS DL   + HC+ M +DL +L+A   G       +L+++D+ G+  LD LIE  QK V+S P VQ YL++VW G L W +WK+ + +  L+     +++L       F T P+VKFM +L+SH++L  L     L   YP     +    M       L   L   L++    P +R  +A ++  +L  GF A  +            P      ++ RN LL+ A  +  I  L+FL+ HHLFGPW IIIRDL+ DL +F VIL +F  +F   L A  QP+   +  N      VPG L+  V L+FALFG   P  +PD   +P     LA+ VFG+ L++T IVLINLLIAMM++TY+ IQA+SDTEWK+GRA LIR+M + S IPSPFNL T L  YS K+  +          R +  E++        R   +       ++ ++  +                    ++ENV +W  +V+++LS R     S    D+
Sbjct:    2 RGQTPLHLAAESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKAHGLCPLHLAAAGGHAEVVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVLRGSVPLKIQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTITGKDDIKRQQPLAESGFTPLHLASQSGHESVVRLLLNCPGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLLHQTDRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLVESGASACAECHGGRTPLQYAAQQNHESAVIFLLRREKNTLRLLDDKKFIFNLMVCGRMNDNLSLEELVLHTSAPLDTAVRLSRALTLCALREKERSVDLQAAAHHCELMASDLLSLSASAGGQGAGAGPILRALDHRGLSVLDCLIEGRQKGVVSQPAVQTYLTEVWCGGLQWDSWKILLLFCCLLLCPPLWLLLALPLTHSFNTIPIVKFMSHLVSHIFLLTLFI---LTIVYPPVSPLSQARLMPSWSECLLLIWLCGMLVSELTFPGERTGLAWIR--LLLLGFSAAALLCHLLAVFTQWWPPTHLHCLFARNVLLAVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILMLFHTAFTLSLTALCQPLYPQEQHNTTTEVTVPGPLNMSVLLFFALFGLTEPDKIPDVDRSPPATAVLAKMVFGVYLVVTFIVLINLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGIPSPFNLFTNL-FYSVKVVCKRAGKMCSSESRDVMNEDEDAEGLSESRSLDLLSQ--ASVSGIRGNKRTQILPEGGQISLAHSGGHVRVENVADWPSVVQQFLSQRRQRDRSTAERDE 905          

HSP 2 Score: 127.102 bits (318), Expect = 7.432e-29
Identity = 119/378 (31.48%), Postives = 180/378 (47.62%), Query Frame = 2
Query: 2621 EHGMTALHLAAEKGHRNVANVLL-LHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKT----PLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFM-------RFNKSVIHG---LKNKS----TGSTALHLAAEGGHHKLVKVLLDAGA--NPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRV-VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFK 3688
            + G T LHLAAE  H  V  + L L        ++ G T  H+AA  G   ++ +L+  N+  V   TLN K     PLHLAA  G  EV + LL      A     D+ G T +HLAAK+ H+ ++ + LR    L I +S  G T  H+AA+ G +  ++E +       R     I G   +K +     +G T LHLA++ GH  +V++LL+       AE N  G + LHLAA+ GH  ++ +L  + S  +  +++ G + LH+AA +G +D V  +L              G ++      SG T LH A+++G   L  LL   +      A  + G TPL +A+Q  H +    LL +  N +   D K
Sbjct:    1 QRGQTPLHLAAESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVG--TLNHKAHGLCPLHLAAAGGHAEVVKVLLEAG---ASVTEEDAEGMTAVHLAAKHGHTHILEV-LRGSVPLKIQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTITGKDDIKRQQPLAESGFTPLHLASQSGHESVVRLLLNCPGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLLHQTDRRGRSALHLAAAHGHVDMVRVLLGQ------------GAEINHT-DMSGWTALHYAAEAG--CLEVLLFLVESGASACAECHGGRTPLQYAAQQNHESAVIFLLRREKNTLRLLDDK 357          

HSP 3 Score: 112.464 bits (280), Expect = 2.567e-24
Identity = 105/384 (27.34%), Postives = 160/384 (41.67%), Query Frame = 2
Query: 2279 NEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDA----------------LTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKA---------------------------------ADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGH 3283
              G+T +H AAE       SD   ++++K+ L    ++         T  H  A  G+  V+ E++ F +  +  + +K   +G  PL  A+  GH E+V +LL+  A V   D  GMTA+HLAA+ GH ++  VL          SK G T LH+AA  G  + V +++ +  AT+ +                L  +  TPLHLA+Q G + V R LL      AD +                                   D RG++ LHLAA + H D+VR+ L    E+    +H  M                                 +G TALH AAE G  +++  L+++GA+   E + G T L  AA+  H
Sbjct:    1 QRGQTPLHLAAE-------SD--HSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHK--AHGLCPLHLAAAGGHAEVVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVLRGSVPLKIQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTITGKDDIKRQQPLAESGFTPLHLASQSGHESVVRLLLNCPGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLLHQTDRRGRSALHLAAAHGHVDMVRVLLGQGAEI----NHTDM---------------------------------SGWTALHYAAEAGCLEVLLFLVESGASACAECHGGRTPLQYAAQQNH 336          

HSP 4 Score: 107.457 bits (267), Expect = 8.604e-23
Identity = 111/399 (27.82%), Postives = 177/399 (44.36%), Query Frame = 2
Query: 1649 KEGNTLMHVTSISGHPETTMSLLRRGVPLH-MPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSII--CKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQK-----RKHSDFEDTDIIKMLLEYDG-DVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDAL 2818
            + G T +H+ + S H E     LR    L  + N+ GS C H AA  G V+V++ LL                        N G V TL       N K   L   PLH+AA   + E   ++LL++GA+V E    G +A+H+A++ G+  +L+ L   G+ P  I   K G + LH+   +     V+E+++       ++ A +    P   G+  +     L +         S      ++++LL   G     +T     +PLH  A +G++ V    V  L  +   ++++  + G S L  A+ +GH ++V +LL   A ++  D  G TALH AAE G   V   L+   A   A+  GG TPL  AAQ  ++  V  L+   K T+  L
Sbjct:    1 QRGQTPLHLAAESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELL----------------------MFNQGGVGTL-------NHKAHGL--CPLHLAAAGGHAE-VVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVL--RGSVPLKIQSSKTGFTALHVAASFGQMNFVREILT-------KVPATIRSEFPTITGKDDIKRQQPLAESGFTPLHLASQSGHESVVRLLLNCPGVQADAETNIQGSSPLHLAAQSGHTAV----VGLLLSRSSSLLHQTDRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLVESGASACAECHGGRTPLQYAAQQNHESAVIFLLRREKNTLRLL 354          

HSP 5 Score: 106.301 bits (264), Expect = 1.837e-22
Identity = 99/337 (29.38%), Postives = 146/337 (43.32%), Query Frame = 2
Query: 2522 KNGWSPLLFASHNGHHEIVSILLK---------------------NNARVDVFDE----------------HGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLL------YHKIYPADPKAADSRGQ--------TPLHLAAKNDHSDVVRLFLRFKPELLINASHD--GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAH 3373
            + G +PL  A+ + H E+V + L+                         V V  E                HG+  LHLAA  GH  V  VLL   A V  +   G+T +HLAA++G+  ++E L       + + +    T LH+AA +G+    R +L          +P      D + Q        TPLHLA+++ H  VVRL L   P +  +A  +  G +  H+AA +G  AV+   +  + S++H  +    G +ALHLAA  GH  +V+VLL  GA     +  G T LH AA+ G   +L  L    +        G TPL  AA 
Sbjct:    1 QRGQTPLHLAAESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKAHGLCPLHLAAAGGHAEVVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVLRGSVPLKIQS-SKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTITGKDDIKRQQPLAESGFTPLHLASQSGHESVVRLLLNC-PGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLLH--QTDRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLVESGASACAECHGGRTPLQYAAQ 333          

HSP 6 Score: 87.8113 bits (216), Expect = 1.072e-16
Identity = 93/359 (25.91%), Postives = 151/359 (42.06%), Query Frame = 2
Query: 1031 KDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILK--------YLQSTIADVNVLDDMDR---------SALHMAAEKGHTKIVELLIDKFKCNVLTRDKE----GNTLMHVTSISGHPETT-MSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQ--VNFKGGILDESPLHVAATTKNGEKCAEMLLKSGAN 2035
            + G+T LH AA+    +VVKL L  + + +           H+A ++   S    + +        L     G   L  A   G    +K LL+A     +  ++   G  A+H+A +      L +L  +       +  G T LH+AA       ++         ++S    +   DD+ R         + LH+A++ GH  +V LL++   C  +  D E    G++ +H+ + SGH     + L R    LH  ++ G   LH AA  GHV++V+ LL +GA +N      +T LH A + G   V+  L+  GA       GG    +PL  AA  +N E     LL+   N
Sbjct:    1 QRGQTPLHLAAESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKAHGLCPLHLAAAGGHAEVVKVLLEAGA---SVTEEDAEGMTAVHLAAKHGHTHILEVLRGSVPLKIQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTITGKDDIKRQQPLAESGFTPLHLASQSGHESVVRLLLN---CPGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLLHQTDRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLVESGASACAECHGG---RTPLQYAA-QQNHESAVIFLLRREKN 349          

HSP 7 Score: 78.5666 bits (192), Expect = 6.035e-14
Identity = 89/349 (25.50%), Postives = 160/349 (45.85%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVA-KDGRTALHYAAKFATEDVVK--LLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALR-LLCDANAQI-----------NMKNGM-----GQTVLHIAAEGNDETILKYLQSTI-----ADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVV 1903
            +  +TPL LA + +    V   L +    + +A +DG T  H AA   +  V++  L+  +     L   +    P+HLA +  G  +  V  LL+A  S   + D EG  ++  A + G  + I E+L+     +  I+   +G  A+H+A     +  +R +L    A I           ++K        G T LH+A++   E++++ L +       A+ N+      S LH+AA+ GHT +V LL+ +    +   D+ G + +H+ +  GH +    LL +G  ++  + +G   LH AA++G + V+  L++ GA+  A      TPL  A +  +   V
Sbjct:    1 QRGQTPLHLAAESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKAHGLCPLHLAAA--GGHAEVVKVLLEAGASVT-EEDAEGMTAVHLAAKHGH-THILEVLRGSVPLK--IQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTITGKDDIKRQQPLAESGFTPLHLASQSGHESVVRLLLNCPGVQADAETNI---QGSSPLHLAAQSGHTAVVGLLLSRSSSLLHQTDRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLVESGASACAECHGGRTPLQYAAQQNHESAV 340          

HSP 8 Score: 68.9366 bits (167), Expect = 5.854e-11
Identity = 43/131 (32.82%), Postives = 70/131 (53.44%), Query Frame = 2
Query: 3476 ESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFK--GRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGA 3862
            + G TPLHLA++S H  +V+L L     E+++  N +G+T  H A+  G  +V   LL  +   +   + K  G   LH A++ GH E+  + +  GA +   D  G T +H AAK G+  + ++L  RG+
Sbjct:    1 QRGQTPLHLAAESDHSEVVKLFLRLRP-ELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKAHGLCPLHLAAAGGHAEVVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVL--RGS 128          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 358.992 bits (920), Expect = 3.669e-100
Identity = 274/873 (31.39%), Postives = 429/873 (49.14%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIV-ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDK 3991
            + L  A  GN E  L ++++ I D+N+ +    + LH+A+++GH K+V ELL +       T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN +  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GANVN T KNG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  +V+ L          +D    +      G + +H AA+          +  D ++ LL+Y+ ++   T     TPLH  A  G+      +V  L  K     N +A NG++PL  A    H   + +LLK++A ++   E G+T LH+AA  GH N+   LL   A  NA +    TPLH+AA+ G+ ++ + L+ +N A VDA   + +TPLH AA+ G KE+ + L+ HK   A+P +A + G TPLH+AA+  H+   R+ L        NA    MT                                 G T LH+A + G   +V++LL+ GANP     +G+T LH+A  + +  ++++L  K      + ++G T LH+AA   Q++    +L    AN  SE            +  G+TPLHLASQ G  ++V LL++     VN   N NG TPLH  +Q GH  +  +L+ K    +      G T LH A  +G+I+M    + Q A +N+   +G+TPLH AA+ G+  +  LL++ GA     T +   PL +A    +  V+  L      ++ +I  +K
Sbjct:   18 SFLRAARSGNLEKALDHIKNGI-DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTT--KKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL----------LDQGAPLQAKTKNGLSPIHMAAQ---------GDHMDCVRQLLQYNAEIDDIT-LDHLTPLHVAAHCGHH----RMVKVLLDK-GAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLL-QNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK---ANPDSATTAGHTPLHIAAREGHAQTTRILLDE------NAQQTKMT-------------------------------KKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL-QYGANANSE------------SLQGITPLHLASQEGQPDMVALLIS-KQANVNLG-NKNGLTPLHLVAQEGHVGIADMLV-KQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEK 804          

HSP 2 Score: 295.819 bits (756), Expect = 2.428e-80
Identity = 255/802 (31.80%), Postives = 396/802 (49.38%), Query Frame = 2
Query: 1352 SGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV-------PLHM-----------------PN-----KTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKN--GWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRF----NKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            +G   +H+A ++  V+ +  L      +      G T LHIAA    E ++  L +  A+VN       S L+MAA++ H ++V+ L++      L  + +G T + V    GH      L+  G         LH+                 PN     KTG   LH AA   +++V + LL++GANVN   K+  TPLHIA + GN  +V  L+  GAQ++ K    DE +PLH AA  +NG  +  E+LL  GA +    KNG S +H+A++  +++ ++ LLQ  A+   I  D  +PLH+     H+ +V+ L+    K  +R      +N     G T +H A     K+ H    D     +LL++   ++  T+ +  TPLH  A  G+       +N ++  +Q   +  A N    +PL  A+  GH E+   LL+NNA+VD   +   T LH AA  GH+ +  +L+ HKA  ++ +  G TPLH+AA+ G+      L++EN A    +T    TPLH+A +YG+ +V   LL      A+P AA   G TPLH+A  +++ DVV+L +  K     + + +G T  HIAA    L V    +++    N   + G+       T LHLA++ G   +V +L+   AN    N +G+T LHL A+ GH  + ++L  + +    +++ G TPLHVA HYG I  V + L    A++ S+            T  G TPLH A+Q GH ++V LLL   G   N  T  NGT+PL  A + G+ +V  +L
Sbjct:   47 NGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAK--TKDELTPLHCAA--RNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARA-----LN-----GFTPLHIAC----KKNHMRSMD-----LLLKHSASLEAVTE-SGLTPLHVAAFMGH-------LNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN-AQQTKMTKKGFTPLHVACKYGKVDVVELLLERG---ANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGI-------TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMV-KFLLQQQAHVNSK------------TRLGYTPLHQAAQQGHTDIVTLLLK-HGALPNEIT-TNGTSPLGIAKRLGYISVIDVL 789          

HSP 3 Score: 231.106 bits (588), Expect = 2.590e-60
Identity = 225/792 (28.41%), Postives = 355/792 (44.82%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEE--TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            +PL +A ++N L  V  LLE G N +   +DG T L  A +   E+VV LL+          G  +   +H+A     T +  V+          LQ D    +                                +G   +HIA   +++   +LL +  A +N     G T LHIA+   +  +++ L    A ++     + + LH AA  GH ++VE+L+D+    +  + K G + +H+ +   H +    LL+    +          LH AA  GH  +VK LLDKGA  NAR  + +TPLHIA K  +   ++ L+ + A +    + G+   +PLHVAA   +     + LL+ GA+ N +    E+ LH+A+R+G+ E+ + LLQ  A      KD  +PLH   R  H    +ELV    + K+  D+          G T +H AA    +  H+        ++LL+ +     QTK T++  TPLH     G  DV +E+   LE       N   KNG +PL  A H+ + ++V +L+           +G TALH+AA++    VA+ LL + A  N++S  G+TPLHLA+Q G  D+V  LI++ +A V+    N  TPLHL AQ G   +   L+      A   AA   G TPLH+A    +  +V+  L+ +                        A +    R   + +H              AA+ GH  +V +LL  GA P E   +G + L +A + G+  +++VLK
Sbjct:  116 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVL----------LQNDPNPDV-----------------------------LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ-GAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGL---TPLHVAAFMGH-LNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGH----KELVKLLMEHKANPDSA------TTAGHTPLHIAA----REGHA-----QTTRILLDENAQ---QTKMTKKGFTPLHVACKYGKVDV-VEL--LLERGAN--PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK-QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQG---ASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQ------------------------AHVNSKTRLGYTPLHQ-------------AAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 790          

HSP 4 Score: 191.045 bits (484), Expect = 4.187e-48
Identity = 184/622 (29.58%), Postives = 282/622 (45.34%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTK--CLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMY-AIEAGSISTIKELLK-------------------AECEQQTNIK-----------KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            +T  TPL +A     L     LL  G N N   K+G T LH A++     +V+LLL + A        TK    P+H A +R G     V+ +L   + A LQ   +  +S ++ A +   +  +++LL+                   A C     +K           +  +G   +HIAC+K  + ++ LL   +A +      G T LH+AA      I+K L    A  N  +    + LHMAA  GH ++ + L+      V  + K+  T +H  +  GH E    L+            G   LH AA+ GH    + LLD+ A     TK  +TPLH+A KYG   VVE L+  GA  N  G  G+   +PLHVA    N +   ++L+  G + + T +NG +ALHIA++   LE+  SLLQ GA+ +     G +PLH+  +     +V  L+S              VNL N  G T +H    LV +  H    D     ML++    V   ++    TPLH     GN    +++V FL  + Q  VN + + G++PL  A+  GH +IV++LLK+ A  +    +G + L +A   G+ +V +VL L
Sbjct:  207 KTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQ---IDAKTKDELTPLHCA-ARNGHVR--VVEIL-LDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQN-NAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL---TPLHVAVHHNNLD-VVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQAN----------VNLGNKNGLTPLH----LVAQEGHVGIAD-----MLVKQGASVYAASRMG-YTPLHVACHYGN----IKMVKFLLQQ-QAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKL 791          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 340.887 bits (873), Expect = 1.005e-95
Identity = 274/908 (30.18%), Postives = 429/908 (47.25%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIV-ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASD-----------------------------------NMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDK 3991
            + L  A  GN E  L ++++ I D+N+ +    + LH+A+++GH K+V ELL +       T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN +  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GANVN T KNG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  +V+ L          +D    +      G + +H AA+          +  D ++ LL+Y+ ++   T     TPLH  A  G+      +V  L  K     N +A NG++PL  A    H   + +LLK++A ++   E G+T LH+AA  GH N+   LL   A  NA +    TPLH+AA+ G+ ++ + L+ +N A VDA   + +TPLH AA+ G KE+ + L+ HK   A+P +A + G TPLH+AA+  H+   R+ L        NA    MT                                 G T LH+A + G   +V++LL+ GANP     +G+T LH+A  + +  ++++L  K      + ++G T LH+AA   Q++    +L    AN  SE            +  G+TPLHLASQ G  ++V LL++     VN   N NG TPLH  +Q GH  +  +L+ K    +      G T LH A  +G+I+M    + Q A +N+                                      +G+TPLH AA+ G+  +  LL++ GA     T +   PL +A    +  V+  L      ++ +I  +K
Sbjct:   48 SFLRAARSGNLEKALDHIKNGI-DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTT--KKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL----------LDQGAPLQAKTKNGLSPIHMAAQ---------GDHMDCVRQLLQYNAEIDDIT-LDHLTPLHVAAHCGHH----RMVKVLLDK-GAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLL-QNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK---ANPDSATTAGHTPLHIAAREGHAQTTRILLDE------NAQQTKMT-------------------------------KKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL-QYGANANSE------------SLQGITPLHLASQEGQPDMVALLISKQA-NVNLG-NKNGLTPLHLVAQEGHVGIADMLV-KQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEK 869          

HSP 2 Score: 315.079 bits (806), Expect = 3.152e-87
Identity = 258/830 (31.08%), Postives = 398/830 (47.95%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKS----------VIHG-------------LKNKST-------GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLL--------RNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILL 4060
            SG+ E  +  ++ G+ +++ N+ G   LH A++ GHV +V  LL  G ++   TK   T LHIA   G   VV  LI YG                                   ANVN   + G S L++A++  +LE++K LL+ GA+ S+  +DG +PL + ++  H  +V  L+++  K K R+ A+              H AA           +DT    +LL+ D +  + +K T  TPLH  A   N  V   ++N   +     VN   KNG +PL  AS  G+  +V +LL   A++D   +  +T LH AA  GH  V  +LL   A + AK+K GL+P+H+AAQ  + D V +L+  N A +D +TL+  TPLH+AA  G   + + LL  K   A+ +A +  G TPLH+A K +H   + L L+    L    +  G+T  H+AA  G L ++K  ++   S           +H              L+N +          T LH AA  GH +LVK+L++  ANP      G T LH+AA+ GH     +L  + + +    K G TPLHVA  YG++D V E+L +  AN             +   ++GLTPLH+A    + ++V+LL++  G     +T  NG T LH A++     V S LL   +N       +G T LH AS  G  +M AL I + A++N  +  G TPLH  A+ G++ +  +LV++GAS  A +     PL +A H+ + +++ FLL        + + S + L  +   LF + +C+ L  F      I L
Sbjct:   55 SGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYG-----------------------------------ANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPAL--------------HIAAR---------NDDTRTAAVLLQNDPNPDVLSK-TGFTPLHIAAHYENLSVAQLLLNRGAN-----VNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN-AEIDDITLDHLTPLHVAAHCGHHRMVKVLL-DKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVV-ELLLERGAN------------PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP--HSTARNGYTALHIAAKQNQLEVASSLLQYGANA-NSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCT-LRTFAFSFSLIFL 798          

HSP 3 Score: 287.73 bits (735), Expect = 1.724e-78
Identity = 257/821 (31.30%), Postives = 398/821 (48.48%), Query Frame = 2
Query: 1352 SGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV-------PLHM-----------------PN-----KTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKN--GWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKS---------ERPKTGEQMKDVLT--------------ESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            +G   +H+A ++  V+ +  L      +      G T LHIAA    E ++  L +  A+VN       S L+MAA++ H ++V+ L++      L  + +G T + V    GH      L+  G         LH+                 PN     KTG   LH AA   +++V + LL++GANVN   K+  TPLHIA + GN  +V  L+  GAQ++ K    DE +PLH AA  +NG  +  E+LL  GA +    KNG S +H+A++  +++ ++ LLQ  A+   I  D  +PLH+     H+ +V+ L+    K  +R  A+         G T +H A     K+ H    D     +LL++   ++  T+ +  TPLH  A  G+       +N ++  +Q   +  A N    +PL  A+  GH E+   LL+NNA+VD   +   T LH AA  GH+ +  +L+ HKA  ++ +  G TPLH+AA+ G+      L++EN A    +T    TPLH+A +YG+ +V   LL      A+P AA   G TPLH+A  +++ DVV+L +  K     + + +G T  HIAA    L V    +++  +          G T LHLA++ G   +V +L+   AN    N +G+T LHL A+ GH  + ++L  + +    +++ G TPLHVA HYG I  V + L    A++ S         +   TG     V T              + G TPLH A+Q GH ++V LLL   G   N  T  NGT+PL  A + G+ +V  +L
Sbjct:   77 NGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAK--TKDELTPLHCAA--RNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANAR--AL--------NGFTPLHIAC----KKNHMRSMD-----LLLKHSASLEAVTE-SGLTPLHVAAFMGH-------LNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN-AQQTKMTKKGFTPLHVACKYGKVDVVELLLERG---ANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANAN---SESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMV-KFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLK-HGALPNEIT-TNGTSPLGIAKRLGYISVIDVL 854          

HSP 4 Score: 248.825 bits (634), Expect = 3.187e-66
Identity = 236/801 (29.46%), Postives = 374/801 (46.69%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEE--TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPE---------LLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            +PL +A ++N L  V  LLE G N +   +DG T L  A +   E+VV LL+          G  +   +H+A     T +  V+          LQ D    +                                +G   +HIA   +++   +LL +  A +N     G T LHIA+   +  +++ L    A ++     + + LH AA  GH ++VE+L+D+    +  + K G + +H+ +   H +    LL+    +          LH AA  GH  +VK LLDKGA  NAR  + +TPLHIA K  +   ++ L+ + A +    + G+   +PLHVAA   +     + LL+ GA+ N +    E+ LH+A+R+G+ E+ + LLQ  A      KD  +PLH   R  H    +ELV    + K+  D+          G T +H AA    +  H+        ++LL+ +     QTK T++  TPLH     G  DV +E+   LE       N   KNG +PL  A H+ + ++V +L+           +G TALH+AA++    VA+ LL + A  N++S  G+TPLHLA+Q G  D+V  LI++ +A V+    N  TPLHL AQ G   +   L+      A   AA   G TPLH+A    +  +V+  L+ +           LL++AS+ G+        + S+  ++ F  F+ S+I   +    G T LH AA+ GH  +V +LL  GA P E   +G + L +A + G+  +++VLK
Sbjct:  146 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVL----------LQNDPNPDV-----------------------------LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ-GAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGL---TPLHVAAFMGH-LNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGH----KELVKLLMEHKANPDSA------TTAGHTPLHIAA----REGHA-----QTTRILLDENAQ---QTKMTKKGFTPLHVACKYGKVDV-VEL--LLERGAN--PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK-QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQG---ASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLF-------SVSVCTLRTFA-FSFSLIFLFQ---LGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 855          

HSP 5 Score: 192.586 bits (488), Expect = 9.293e-49
Identity = 188/635 (29.61%), Postives = 285/635 (44.88%), Query Frame = 2
Query:  929 PETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLF-ASHNGHHEIVSILLKNNA---RVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVE--KLINENKATV 2809
            P+   TPL +A +   ++ V  LL+ G   +   KD  T LH AA+     VV++LL + A P          PIH+A    G     V  LL+        +  +    L  A   G    +K LL    +      +  +G   +HIAC+K  + ++ LL   +A +      G T LH+AA      I+K L    A  N  +    + LHMAA  GH ++ + L+      V  + K+  T +H  +  GH E    L+            G   LH AA+ GH    + LLD+ A     TK  +TPLH+A KYG   VVE L+  GA  N  G  G+   +PLHVA    N +   ++L+  G + + T +NG +ALHIA++   LE+  SLLQ GA+ +     G +PLH+  +     +V  L+S              VNL N  G T +H    LV +  H    D     ML++    V   ++    TPLH     GN    +++V FL   +Q   +  +K   S LL  AS+ G   +    L+  A    +    + G T LH AA++GH ++  +LL H A  N  +  G +PL +A + GY  +++  KL+ E   ++
Sbjct:  269 PKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGA-PLQAKTKNGLSPIHMAAQ--GDHMDCVRQLLQYNAEID-DITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA---RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQN-NAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL---TPLHVAVHHNNLD-VVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQAN----------VNLGNKNGLTPLH----LVAQEGHVGIAD-----MLVKQGASVYAASRMGY-TPLHVACHYGN----IKMVKFL---LQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSM 864          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 337.421 bits (864), Expect = 3.261e-95
Identity = 258/826 (31.23%), Postives = 401/826 (48.55%), Query Frame = 2
Query: 1598 IVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDK 3991
            ++ELL +       T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN +  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GANVN T KNG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  +V+ L          +D    +      G + +H AA+          +  D ++ LL+Y+ ++   T     TPLH  A  G+      +V  L  K     N +A NG++PL  A    H   + +LLK++A ++   E G+T LH+AA  GH N+   LL   A  NA +    TPLH+AA+ G+ ++ + L+ +N A VDA   + +TPLH AA+ G KE+ + L+ HK   A+P +A + G TPLH+AA+  H+   R+ L        NA    MT                                 G T LH+A + G   +V++LL+ GANP     +G+T LH+A  + +  ++++L  K      + ++G T LH+AA   Q++    +L    AN  SE            +  G+TPLHLASQ G  ++V LL++     VN   N NG TPLH  +Q GH  +  +L+ K    +      G T LH A  +G+I+M    + Q A +N+   +G+TPLH AA+ G+  +  LL++ GA     T +   PL +A    +  V+  L      ++ +I  +K
Sbjct:    2 VLELLHNGIDLETTT--KKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL----------LDQGAPLQAKTKNGLSPIHMAAQ---------GDHMDCVRQLLQYNAEIDDIT-LDHLTPLHVAAHCGHH----RMVKVLLDK-GAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLL-QNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK---ANPDSATTAGHTPLHIAAREGHAQTTRILLDE------NAQQTKMT-------------------------------KKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL-QYGANANSE------------SLQGITPLHLASQEGQPDMVALLISKQA-NVNLG-NKNGLTPLHLVAQEGHVGIADMLV-KQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEK 742          

HSP 2 Score: 306.22 bits (783), Expect = 4.879e-85
Identity = 255/788 (32.36%), Postives = 404/788 (51.27%), Query Frame = 2
Query: 1295 IKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKN--GWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            + ELL    + +T  KK   G+ A+HIA      + +  L +  A +N ++  G + L++AA+ N   ++KYL    A+ ++  +   + L +A ++GH  +V LLI     N  T+ K     +H+ + +    T   LL+      + +KTG   LH AA   +++V + LL++GANVN   K+  TPLHIA + GN  +V  L+  GAQ++ K    DE +PLH AA  +NG  +  E+LL  GA +    KNG S +H+A++  +++ ++ LLQ  A+   I  D  +PLH+     H+ +V+ L+    K  +R  A+         G T +H A     K+ H    D     +LL++   ++  T+ +  TPLH  A  G+       +N ++  +Q   +  A N    +PL  A+  GH E+   LL+NNA+VD   +   T LH AA  GH+ +  +L+ HKA  ++ +  G TPLH+AA+ G+      L++EN A    +T    TPLH+A +YG+ +V   LL      A+P AA   G TPLH+A  +++ DVV+L +  K     + + +G T  HIAA    L V    +++  +          G T LHLA++ G   +V +L+   AN    N +G+T LHL A+ GH  + ++L  + +    +++ G TPLHVA HYG I  V + L    A++ S+            T  G TPLH A+Q GH ++V LLL   G   N  T  NGT+PL  A + G+ +V  +L
Sbjct:    2 VLELLHNGIDLETTTKK---GNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAK--TKDELTPLHCAA--RNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANAR--AL--------NGFTPLHIAC----KKNHMRSMD-----LLLKHSASLEAVTE-SGLTPLHVAAFMGH-------LNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN-AQQTKMTKKGFTPLHVACKYGKVDVVELLLERG---ANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANAN---SESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMV-KFLLQQQAHVNSK------------TRLGYTPLHQAAQQGHTDIVTLLLK-HGALPNEIT-TNGTSPLGIAKRLGYISVIDVL 727          

HSP 3 Score: 247.669 bits (631), Expect = 4.287e-66
Identity = 210/694 (30.26%), Postives = 325/694 (46.83%), Query Frame = 2
Query: 2102 MLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSF----YNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAELVQKRKH----------------------SDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKS----------VIHG-------------LKNKST-------GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            M+  LL  G D     K GN+ LHI        +V EL+++      +++     + +                    +LP  +G T    A  L Q  ++                      +  +DT    +LL+ D +  + +K T  TPLH  A   N  V   ++N   +     VN   KNG +PL  AS  G+  +V +LL   A++D   +  +T LH AA  GH  V  +LL   A + AK+K GL+P+H+AAQ  + D V +L+  N A +D +TL+  TPLH+AA  G   + + LL  K   A+ +A +  G TPLH+A K +H   + L L+    L    +  G+T  H+AA  G L ++K  ++   S           +H              L+N +          T LH AA  GH +LVK+L++  ANP      G T LH+AA+ GH     +L  + + +    K G TPLHVA  YG++D V E+L +  AN             +   ++GLTPLH+A    + ++V+LL++  G     +T  NG T LH A++     V S LL   +N       +G T LH AS  G  +M AL I + A++N  +  G TPLH  A+ G++ +  +LV++GAS  A +     PL +A H+ + +++ FLL+ +
Sbjct:    1 MVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTP--LAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSK-TGFTPLHIAAHYENLSVAQLLLNRGAN-----VNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN-AEIDDITLDHLTPLHVAAHCGHHRMVKVLL-DKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVV-ELLLERGAN------------PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP--HSTARNGYTALHIAAKQNQLEVASSLLQYGANA-NSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQ 665          

HSP 4 Score: 234.958 bits (598), Expect = 4.208e-62
Identity = 238/850 (28.00%), Postives = 391/850 (46.00%), Query Frame = 2
Query:  995 LLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCL-PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFL-EHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVG--EMLTDVPAN-IKSER-----PKTGEQMKDVLTESGLTPLHLASQ 3511
            LL  G++     K G TALH AA    E VV  L+   A  N+   S K   P+++A          V  LL+   +  L  + +G   L  A++ G  + +  L+    + +  +        A+HIA R  D     +L   +   ++ +  G T LHIAA   + ++ + L +  A+VN       + LH+A+ +G+  +V L                                  LL RG  +    K     LH AA++GHV VV+ LLD+GA + A+TK+  +P+H+A +  +   V  L+ Y A+++     LD  +PLHVAA   +  +  ++LL  GA  N    NG + LHIA +  ++  +  LL+  A    + + G +PLH+     H  IV+ L+                N  N + ET +H AA    +  H      ++ + LL+ +  V  + K  ++TPLH  A  G+     E+V  L EHK     +     G +PL  A+  GH +   ILL  NA+     + G T LH+A + G  +V  +LL   A  NA  K GLTPLH+A  +   D+V+ L+++   +  +   N  T LH+AA+  + EV  SLL    Y A+  +   +G TPLHLA++    D+V L +  +  + +  + +G+T  H+ A  G + +    ++   SV    +    G T LH+A   G+ K+VK LL   A+   +   G T LH AA+ GH  ++ +L    +       +G +PL +A   G I  +   +++T+   + I +E+     P+T +++ DV  + G+  L L  +
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGA--NVNAQSQKGFSPLYMAAQENHLE--VVKYLLEHGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTKGKVRLP-------ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRL----------------------------------LLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDI--TLDHLTPLHVAAHCGH-HRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP----------NASNVKVETPLHMAA----RAGHC-----EVAQFLLQNNAQVDAKAK-DDQTPLHCAARMGHK----ELVKLLMEHKAN--PDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKG-GSPHSTARNGYTALHIAAKQNQLEVASSLLQ---YGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNL-GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASR---MGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSFPETVDEILDVSEDEGVAQLTLGDE 771          

HSP 5 Score: 231.491 bits (589), Expect = 5.750e-61
Identity = 201/715 (28.11%), Postives = 336/715 (46.99%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKL-----------------------------LLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMD-KEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLF 2995
            +PL +A ++N L  V  LLE G N +   +DG T L  A +   E+VV L                             LL    +P++    T   P+H+A      S    ++ L   + A +    K G   L  A   G++  ++ LL    +     K + +    +H A R   V  + +L D  A +  K   G + +H+AA+G+    ++ L    A+++ +     + LH+AA  GH ++V++L+DK  K N   R   G T +H+     H  +   LL+    L    ++G   LH AA  GH+N+VK+LL +GA+ NA    + TPLH+A + G+  V + L+   AQV+ K    D++PLH AA   + E   ++L++  AN +     G + LHIA+R G+ +  + LL E A  + + K G +PLH+  +Y    +V+ L+                N     G T +H A        H++    D++K+L+   G     T     T LH  A     +V   ++ +  +      N ++  G +PL  AS  G  ++V++L+   A V++ +++G+T LHL A++GH  +A++L+   A V A S+ G TPLH+A   G   +V+ L+ + +A V++ T    TPLH AAQ G  ++   LL H    A P    + G +PL +A +  +  V+ + 
Sbjct:   54 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL-SKTGFTPLHIAAHYENLS----VAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELT---PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA--RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-DQTPLHCAARMGHKE-LVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANP----------NAAGKNGLTPLHVAVH------HNNL---DVVKLLVSKGGSPH-STARNGYTALHIAAKQNQLEVASSLLQYGAN-----ANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLL-QQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHG---ALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 6 Score: 191.815 bits (486), Expect = 1.275e-48
Identity = 184/622 (29.58%), Postives = 282/622 (45.34%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTK--CLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMY-AIEAGSISTIKELLK-------------------AECEQQTNIK-----------KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            +T  TPL +A     L     LL  G N N   K+G T LH A++     +V+LLL + A        TK    P+H A +R G     V+ +L   + A LQ   +  +S ++ A +   +  +++LL+                   A C     +K           +  +G   +HIAC+K  + ++ LL   +A +      G T LH+AA      I+K L    A  N  +    + LHMAA  GH ++ + L+      V  + K+  T +H  +  GH E    L+            G   LH AA+ GH    + LLD+ A     TK  +TPLH+A KYG   VVE L+  GA  N  G  G+   +PLHVA    N +   ++L+  G + + T +NG +ALHIA++   LE+  SLLQ GA+ +     G +PLH+  +     +V  L+S              VNL N  G T +H    LV +  H    D     ML++    V   ++    TPLH     GN    +++V FL  + Q  VN + + G++PL  A+  GH +IV++LLK+ A  +    +G + L +A   G+ +V +VL L
Sbjct:  145 KTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQ---IDAKTKDELTPLHCA-ARNGHVR--VVEIL-LDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQN-NAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL---TPLHVAVHHNNLD-VVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQAN----------VNLGNKNGLTPLH----LVAQEGHVGIAD-----MLVKQGASVYAASRMG-YTPLHVACHYGN----IKMVKFLLQQ-QAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKL 729          

HSP 7 Score: 158.688 bits (400), Expect = 2.037e-38
Identity = 135/443 (30.47%), Postives = 209/443 (47.18%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYS-GDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHY-------LIVQELVSFYNKTKSRI 2248
            TPL +ACK N + ++D LL+   +   V + G T LH AA     ++VK LL + A PN      +  P+H+A +R G     V   L    +      K+    L  A   G     KEL+K   E + N     + G   +HIA R+   +  R+L D NAQ       G T LH+A +     +++ L    A+ N       + LH+A    +  +V+LL+ K      T  + G T +H+ +     E   SLL+ G   +  +  G   LH A+Q G  ++V  L+ K ANVN   K+  TPLH+  + G+ G+ + L+  GA V +    +  +PLHVA    N  K  + LL+  A+VN   + G + LH A++ G+ +++  LL+ GA P+ I  +G SPL I  R  +        L+ +E VS     K R+
Sbjct:  314 TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET-PLHMA-ARAGHCE--VAQFLLQNNAQVDAKAKDDQTPLHCAARMGH----KELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTA-RNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV-YAASRMGYTPLHVACHYGN-IKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRM 745          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 342.813 bits (878), Expect = 5.759e-95
Identity = 263/828 (31.76%), Postives = 408/828 (49.28%), Query Frame = 2
Query: 1559 SALHMAAEKGHTKIV-ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNA---KSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFL 3946
            + LH+A+++GH K+V ELL +    ++ T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN +  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GANVN T KNG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  +V+ L          +D    +      G + +H AA+          +  D ++ LL+Y+ ++   T     TPLH  A  G+      +V  L  K     N +A NG++PL  A    H   + +LLK++A ++   E G+T LH+AA  GH N+   LL   A  N+    S    TPLH+AA+ G+ ++ + L+ +N A VDA   + +TPLH AA+ G KE+ + L+ HK   A+P +A + G TPLH+AA+  H+   R+ L        NA    MT                                 G T LH+A + G   +V++LL+ GANP     +G+T LH+A  + +  ++++L  K      + ++G T LH+AA   Q++    +L    AN  SE            +  G+TPLHLASQ G  ++V LL++     VN   N NG TPLH  +Q GH  +  +L+ K    +      G T LH A  +G+I+M    + Q A +N+   +G+TPLH AA+ G+  +  LL++ GA     T +   PL +A    +  V+  L
Sbjct:   77 NGLHLASKEGHVKMVLELLHNGI--DLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL----------LDQGAPLQAKTKNGLSPIHMAAQ---------GDHMDCVRQLLQYNAEIDDIT-LDHLTPLHVAAHCGHH----RMVKVLLDK-GAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLL-QNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK---ANPDSATTAGHTPLHIAAREGHAQTTRILLDE------NAQQTKMT-------------------------------KKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL-QYGANANSE------------SLQGITPLHLASQEGQPDMVALLIS-KQANVNLG-NKNGLTPLHLVAQEGHVGIADMLV-KQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 2 Score: 303.908 bits (777), Expect = 9.053e-83
Identity = 243/794 (30.60%), Postives = 375/794 (47.23%), Query Frame = 2
Query: 1766 LHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMR---------FNKSVIHG-----------------LKNKST-------GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNN-------------------------------NGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            LH A++ GHV +V  LL  G ++   TK   T LHIA   G   VV  LI Y                                   GANVN   + G S L++A++  +LE++K LL+ GA+ S+  +DG +PL + ++  H  +V  L+++  K K R+ A+              H AA           +DT    +LL+ D +  + +K T  TPLH  A   N  V   ++N   +     VN   KNG +PL  AS  G+  +V +LL   A++D   +  +T LH AA  GH  V  +LL   A + AK+K GL+P+H+AAQ  + D V +L+  N A +D +TL+  TPLH+AA  G   + + LL  K   A+ +A +  G TPLH+A K +H   + L L+    L    +  G+T  H+AA  G L ++K  ++         F+   +                   L+N +          T LH AA  GH +LVK+L++  ANP      G T LH+AA+ GH     +L  + + +    K G TPLHVA  YG++D V E+L +  AN             +   ++GLTPLH+A    + ++V+LL++  G   ++A N                                 G TPLH ASQ G  ++ ++L+ K +N +   +  G T LH  +  GH+ +A + + QGA + A+  MG+TPLH A   G +K+ K L+++ A   ++T     PL  AA   HT++++ LL++
Sbjct:   79 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINY-----------------------------------GANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPAL--------------HIAAR---------NDDTRTAAVLLQNDPNPDVLSK-TGFTPLHIAAHYENLSVAQLLLNRGAN-----VNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN-AEIDDITLDHLTPLHVAAHCGHHRMVKVLL-DKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVV-ELLLERGAN------------PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQAN-VNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKH 789          

HSP 3 Score: 293.893 bits (751), Expect = 1.273e-79
Identity = 268/858 (31.24%), Postives = 416/858 (48.48%), Query Frame = 2
Query: 1193 VISLLKATKSAR---LQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV-------PLHM-----------------PN-----KTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGW--SPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRF----NKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            VI   K+ +S+R    + +++  I L   +  G   T  E L A C          +G   +H+A ++  V+ +  L      +      G T LHIAA    E ++  L +  A+VN       S L+MAA++ H ++V+ L++      L  + +G T + V    GH      L+  G         LH+                 PN     KTG   LH AA   +++V + LL++GANVN   K+  TPLHIA + GN  +V  L+  GAQ++ K    DE +PLH AA  +NG  +  E+LL  GA +    KNG S +H+A++  +++ ++ LLQ  A+   I  D  +PLH+     H+ +V+ L+    K  +R      +N     G T +H A     K+ H    D     +LL++   ++  T+ +  TPLH  A  G+    L IV  L  +     +    + +  +PL  A+  GH E+   LL+NNA+VD   +   T LH AA  GH+ +  +L+ HKA  ++ +  G TPLH+AA+ G+      L++EN A    +T    TPLH+A +YG+ +V   LL      A+P AA   G TPLH+A  +++ DVV+L +  K     + + +G T  HIAA    L V    +++    N   + G+       T LHLA++ G   +V +L+   AN    N +G+T LHL A+ GH  + ++L  + +    +++ G TPLHVA HYG I  V + L    A++ S+            T  G TPLH A+Q GH ++V LLL   G   N  T  NGT+PL  A + G+ +V  +L
Sbjct:   25 VIKQQKSVQSSRKIHRERERDKEIDL-RCVRVGFFHT--EFLSASC----FFLYSQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAK--TKDELTPLHCAA--RNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARA-----LN-----GFTPLHIAC----KKNHMRSMD-----LLLKHSASLEAVTE-SGLTPLHVAAFMGH----LNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN-AQQTKMTKKGFTPLHVACKYGKVDVVELLLERG---ANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGI-------TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMV-KFLLQQQAHVNSK------------TRLGYTPLHQAAQQGHTDIVTLLLK-HGALPNEIT-TNGTSPLGIAKRLGYISVIDVL 819          

HSP 4 Score: 264.233 bits (674), Expect = 1.835e-70
Identity = 215/712 (30.20%), Postives = 338/712 (47.47%), Query Frame = 2
Query: 2051 KNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSF----YNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAE--------------------LVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMR---------FNKSVIHG-----------------LKNKST-------GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            +NG + LH+AS+ G+++M+  LL  G D     K GN+ LHI        +V EL+++      +++     + +                    +LP  +G T +  A +                    L      +  +DT    +LL+ D +  + +K T  TPLH  A   N  V   ++N   +     VN   KNG +PL  AS  G+  +V +LL   A++D   +  +T LH AA  GH  V  +LL   A + AK+K GL+P+H+AAQ  + D V +L+  N A +D +TL+  TPLH+AA  G   + + LL  K   A+ +A +  G TPLH+A K +H   + L L+    L    +  G+T  H+AA  G L ++K  ++         F+   +                   L+N +          T LH AA  GH +LVK+L++  ANP      G T LH+AA+ GH     +L  + + +    K G TPLHVA  YG++D V E+L +  AN             +   ++GLTPLH+A    + ++V+LL++  G     +T  NG T LH A++     V S LL   +N       +G T LH AS  G  +M AL I + A++N  +  G TPLH  A+ G++ +  +LV++GAS  A +     PL +A H+ + +++ FLL+ +
Sbjct:   73 QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSK-TGFTPLHIAAHYENLSVAQLLLNRGAN-----VNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN-AEIDDITLDHLTPLHVAAHCGHHRMVKVLL-DKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVV-ELLLERGAN------------PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP--HSTARNGYTALHIAAKQNQLEVASSLLQYGAN-ANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQ 757          

HSP 5 Score: 224.557 bits (571), Expect = 2.217e-58
Identity = 226/796 (28.39%), Postives = 356/796 (44.72%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNG---ESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEE--TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            +PL +A ++N L  V  LLE G N +   +DG T L  A +   E+VV LL+          G  +   +H+A     T +  V+          LQ D    +                                +G   +HIA   +++   +LL +  A +N     G T LHIA+   +  +++ L    A ++     + + LH AA  GH ++VE+L+D+    +  + K G + +H+ +   H +    LL+    +          LH AA  GH  +VK LLDKGA  NAR  + +TPLHIA K  +   ++ L+ + A +    + G+   +PLHVAA   +     + LL+ GA+ N  + +    E+ LH+A+R+G+ E+ + LLQ  A      KD  +PLH   R  H    +ELV    + K+  D+          G T +H AA    +  H+        ++LL+ +     QTK T++  TPLH     G  DV +E+   LE       N   KNG +PL  A H+ + ++V +L+           +G TALH+AA++    VA+ LL + A  N++S  G+TPLHLA+Q G  D+V  LI++ +A V+    N  TPLHL AQ G   +   L+      A   AA   G TPLH+A    +  +V+  L+ +    +N+ +  G T  H AA  G                                    H  +V +LL  GA P E   +G + L +A + G+  +++VLK
Sbjct:  143 SPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVL----------LQNDPNPDV-----------------------------LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ-GAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGL---TPLHVAAFMGH-LNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGH----KELVKLLMEHKANPDSA------TTAGHTPLHIAA----REGHA-----QTTRILLDENAQ---QTKMTKKGFTPLHVACKYGKVDV-VEL--LLERGAN--PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK-QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQG---ASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAH--VNSKTRLGYTPLHQAAQQG------------------------------------HTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 820          

HSP 6 Score: 202.986 bits (515), Expect = 9.875e-52
Identity = 157/484 (32.44%), Postives = 253/484 (52.27%), Query Frame = 2
Query: 2519 AKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTP-LHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINA---SDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            ++NG + L  AS  GH ++V  LL N   ++   + G TALH+AA  G   V   L+ + A VNA+S+ G +PL++AAQ  + ++V+ L+ E+ A     T +  TPL +A Q G + V   L+ +            + + P LH+AA+ND +    + L+  P   +  S  G T  HIAA   +L+V +  +    +V    KN   G T LH+A+  G+  +V++LLD GA    +  D +T LH AA+ GH  ++E+L  + +      K+G++P+H+AA    +D V ++L            +   ++ D+ T   LTPLH+A+  GH  +V++LL+  G + N A   NG TPLH A +  H     +LL K S  +      G T LH A+  GH+ +    + +GA  N+   S +   TPLH AA++G+ +V + L++  A  +A+  D Q PL  AA   H E++  L+ +K
Sbjct:   72 SQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLL-EHGANQSLPTEDGFTPLAVALQQGHENVVALLINY--------GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDV-LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKN---GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL------------QYNAEIDDI-TLDHLTPLHVAAHCGHHRMVKVLLD-KGAKAN-ARALNGFTPLHIACKKNHMRSMDLLL-KHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK 526          

HSP 7 Score: 190.274 bits (482), Expect = 6.922e-48
Identity = 180/593 (30.35%), Postives = 270/593 (45.53%), Query Frame = 2
Query:  929 PETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVN---VLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            P+   TPL +A +   ++ V  LL+ G   +   KD  T LH AA+     VV++LL + A P          PIH+A    G     V  LL+        +  +    L  A   G    +K LL    +      +  +G   +HIAC+K  + ++ LL   +A +      G T LH+AA      I+K L    A  N      D   + LHMAA  GH ++ + L+      V  + K+  T +H  +  GH E    L+            G   LH AA+ GH    + LLD+ A     TK  +TPLH+A KYG   VVE L+  GA  N  G  G+   +PLHVA    N +   ++L+  G + + T +NG +ALHIA++   LE+  SLLQ GA+ +     G +PLH+  +     +V  L+S              VNL N  G T +H    LV +  H    D     ML++    V   ++    TPLH     GN    +++V FL  + Q  VN + + G++PL  A+  GH +IV++LLK+ A  +    +G + L +A   G+ +V +VL L
Sbjct:  266 PKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGA-PLQAKTKNGLSPIHMAAQ--GDHMDCVRQLLQYNAEID-DITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA---RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQN-NAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL---TPLHVAVHHNNLD-VVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQAN----------VNLGNKNGLTPLH----LVAQEGHVGIAD-----MLVKQGASVYAASRMGY-TPLHVACHYGN----IKMVKFLLQQ-QAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKL 821          

HSP 8 Score: 136.346 bits (342), Expect = 1.920e-31
Identity = 112/379 (29.55%), Postives = 184/379 (48.55%), Query Frame = 2
Query: 2936 GQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            G   LHLA+K  H  +V   L    +L    +  G T  HIAA  G   V+ E + +  +V         G + L++AA+  H ++VK LL+ GAN +    DG T L +A + GH +++ +L     K K+                            V +K+G TPLH+AAHY  +  V ++L +  AN+            +   ++G+TPLH+AS+ G+  +VRLLL+  G ++++ T +   TPLH A++NGH  V  ILL + +  +  +   G + +H A+   H++     +   A+I+       TPLH AA  G+ ++ K+L+++GA   A   +   PL +A   NH   M  LL++  S   + E+
Sbjct:   75 GLNGLHLASKEGHVKMVLELLHNGIDLE-TTTKKGNTALHIAALAGQEKVVAELINYGANVN---AQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLS-VAQLLLNRGANV------------NFTPKNGITPLHIASRRGNVIMVRLLLD-RGAQIDAKTKDE-LTPLHCAARNGHVRVVEILLDQGA-PLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTES 433          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 1013.83 bits (2620), Expect = 0.000e+0
Identity = 596/1401 (42.54%), Postives = 832/1401 (59.39%), Query Frame = 2
Query: 1247 GAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNG-MGQTVLHIAA---EGNDETILKYLQSTIADVNVLDDMDRS-ALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESP-----LHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNN------------------EGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEH-KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGE---QMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXX-XXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFL----LFYVPLLDAY-----PCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSG------------DYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIY 5287
            G   LM A+    ++ ++  L+   +     K   +   A+H+A      E +RLL    A+ N+  G   Q  LH  A    G        L+++  D  +  D D    L +A E G+  I + L+       L R K G+T +HV+      +    L+  G  +   N  G   LH AA +G   ++K L    AN N   K   TPLH+A + GN  +VE L        F+  +L  +      +H+A+   + E  A   LK G  ++   K G   LH A+  G++ ++++LLQ+GA      KD  + LHI    C  L+VQ L+ F  + + +   +  +  P +                   GET +H AA + ++  H+  ED  II++L+E+DGD+   T  T ETPLHYCA  GN DVLLE++  +   +IQ  +NKQAKNG SPLL A+  GH  IV ILL+N ARVDVFDEHG  ALHLAAE GH  +A++LL HKAFVNAK+K GLTPLHL AQNG+  LV+ L+  + A +DA++L ++TPLH+AA  G+ +VC SLL  K   AD  A D  GQTPLHLAA+NDHS+VV+LFL+ KPEL+ +A+ +G TC HIAA+ GS AVIKE ++FNK+     +NK+  ST LHLAA GGH   VKVLL+ GA+ ++EN +GMT +HLAAK GH H+LE LK  +SFR+ S K+G+T LHVAAH+GQ+DFV E+LT VPA + SE PK+      MK+   ESG TPLHLASQSGHE+LVRLLLN  GV+ ++AT   G+TP+H A+QNGHT V  +LL KS++Q+  +D +GRT LH A+++GHIEM    IGQGA+IN +D  G+ PLH+AA+SG+L   + LVE GA+   E  D +  +  AA  NH +V+SFLL+  H+T+KLIE+ KF+FDLM+C KLNN + ++EFIL S AP + A KLS      + KEKER+ DL+  +++ ++M T+L  +A+    A  +L++VD+     LD LIE EQK+V++HP VQ+YL++VW G L+W  WKL +  +  L  P  W +  LP+  +    P++KFM YL SH++L  L    + Y PL   Y     PC+ +   +  +   L+  L+           +R  +A ++  +L F   A     L+F+         ++ RN LL  A  +  +  L+FL+ HHLFGPW IIIRDL+ DL +F VILA+F ++F   L A +QP+                 SN+   +   V L+F+LFG   P  LP    TP +   + R VFG+ L++T+IVLINLLIAMM++TY+ IQA+SDTEWK+GRA LIR+M +    PSPFNL T L  Y
Sbjct:    9 GLTPLMIAVRENRLAIVERFLELGVDLNERTKDSRT---ALHVAAAHSKDEIVRLLLAKKAEPNIPGGPKDQLPLHYTALRPNGAINVTQTLLRASHKDARLTPDKDGCIPLVLAIEAGNLGICKELLSATPEAQL-RAKSGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDRTPLHVAAERGNTNIVEILTE-----KFRSNVLARTKEGNTLMHIASQYGHPET-ALAFLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPSPIHIPVSHSNHCLVAKVKKALAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQILLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMK---ADVNATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQGAEINVTDKNGWCPLHFAARSGFLDTIRFLVECGANPILECKDGKTAIQYAAANNHQDVVSFLLKKNHNTLKLIEDRKFVFDLMVCGKLNNNRVIQEFILNSIAPLDTAVKLSRALNITAFKEKERAVDLLNAAKYSENMATELLTIASGSTNAGFILRAVDHRCTTILDCLIECEQKDVVAHPAVQKYLTEVWYGSLDWATWKLVLLFFTFLACPPVWLVFSLPLKHRFNKIPIMKFMSYLASHIFLIVLFILTIVYPPLSPIYEGRMVPCWNEWLLLAWLSGTLVSELTHHG--------ERAGLAWIRVFVLGFSAVAFFCHLLAFLFSDRDRLHCLFARNILLGVAMTLSFVQFLEFLTFHHLFGPWAIIIRDLIKDLTRFAVILAMFHVAFTMQLSAVYQPVYPEATSAQSLNETVHSESNIQDPIDITVLLFFSLFGLVEPGCLPSLNRTPQFTFVIVRFVFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTEWKFGRATLIRDMTRKPGTPSPFNLFTNLFYY 1388          

HSP 2 Score: 528.094 bits (1359), Expect = 2.358e-158
Identity = 361/971 (37.18%), Postives = 524/971 (53.96%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGG---------------------------ILDESPLHVAATTK------NGE--KCAEMLLKSGANVNE-TMKNGESALHIASRSGNLEMLKSLLQEGADPSI------ICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKA-FVNAKSKGGLTPLHLAAQNGYKDLVEKLINENK--ATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFM---------RFNKSVIHGL----KNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAE--ENNDGMTCLHLAAKYGHFHLLEVLKPKISFRV-VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQI 3670
            TPLM+A ++NRL  V+R LE+GV+ N+  KD RTALH AA  + +++V+LLLAKKA+PN+ GG    LP+H    R   +     +LL+A+ K ARL  DK+G I L+ AIEAG++   KELL A  E Q   K   SGD A+H++CRK+D +A +LL +  A ++ +N  GQT LHIAA   DE +LK L    A+ N+ D MDR+ LH+AAE+G+T IVE+L +KF+ NVL R KEGNTLMH+ S  GHPET ++ L+RG  LHMPNK G+VCLHAAA  GHV VV+ LL KGA+V+ARTKD YT LHIA +   P VV+TL+G+GAQV  KGG                           +  E+PLH+AA  K       GE  K   +L++   +++  T    E+ LH  +R GN ++L  +++  +   I        K+G SPL +     H  IVQ L+    + ++R+D        +  G+ A+H AAE      H    D     +LL++   V  +TK    TPLH CA  G +     +V  L       ++  +    +PL  A+ NG  ++ + LL   A V+  D  G T LHLAAE  H  V  + L HK   V + +  G T  H+AA  G   ++++L+  NK  AT      N  TPLHLAA  G  +  + LL      +D    +  G T +HLAAKN H  V+   L+      I ++  G+T  H+AA  G L  ++E +            KSV   L    +++ +G T LHLA++ GH  LV++LL+     A+      G T +HLAA+ GH  ++ +L  K + ++ + +K G T LH+AA  G I+ +  ++              G ++ +V  ++G  PLH A++SG  + +R L+ C    +      +G T + +A+ N H +V S LL K+ N +
Sbjct:   11 TPLMIAVRENRLAIVERFLELGVDLNERTKDSRTALHVAAAHSKDEIVRLLLAKKAEPNIPGGPKDQLPLHYTALRPNGAINVTQTLLRASHKDARLTPDKDGCIPLVLAIEAGNLGICKELLSATPEAQLRAK---SGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDRTPLHVAAERGNTNIVEILTEKFRSNVLARTKEGNTLMHIASQYGHPETALAFLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPSPIHIPVSHSNHCLVAKVKKALAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQILL----QNQARVDVF------DEHGKAALHLAAE----NGHDQIAD-----ILLKHKAFVNAKTKLG-LTPLHLCAQNGFN----HLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASD---ENGEGMTAIHLAAKNGHIHVLEA-LKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQ------------GAEI-NVTDKNGWCPLHFAARSGFLDTIRFLVECGANPILEC--KDGKTAIQYAAANNHQDVVSFLLKKNHNTL 935          

HSP 3 Score: 178.333 bits (451), Expect = 3.969e-44
Identity = 207/809 (25.59%), Postives = 344/809 (42.52%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVIS------LLKATKSARLQM-------------------------DKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNG----------------------------MGQTVLHIAA---------EGNDETILKYLQSTIADVNV-LDDMDRSALHMAAEKGHTKIVELLI-----DKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICK---DGNSPLHIGVRYCHYLIVQELVSF--------YNKTK-----------SRIDAMMLV-------NLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV--KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQ----------LVVNKQAK-NGWSPLLFASHNGHHEIVSILLKN-NARVDV-FDEHGMTALHLAAEKGHRNVANVLLLHK-AFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLR 3001
            ++ +T L ++C+     A   L+E G + +    +G+T LH AA    E ++KLL   +A+ NL     +  P+H+A  R  T+   +++      +L  TK     M                         +K GA+ L  A   G ++ ++ LL+         K  Y+   A+HIA        ++ L    AQ+ +K G                             G+T LH+AA         +G D  I++ L     D++   +    + LH  A  G+  ++  +I      + +  +  + K G + + V +  GH      LL+    + + ++ G   LH AA++GH  +   LL   A VNA+TK   TPLH+  + G   +V+ L+           +   +PLH+AA     + C   LL   A+VN T   G++ LH+A+ + + E++K  L+    P ++     +G++  HI        +++EL+ F         NKT               DA+ ++       +  N EG TA+H AA    K  H        I +L    G V  +I +  T  T LH  A  G  D + EI+  +   +           L + +Q++ +G++PL  AS +GH  +V +LL     + D      G T +HLAA+ GH  V  +LL    + ++ K K G T LHLAA NG+ +++  LI +  A ++    N   PLH AA+ G  +  R L+      A+P      G+T +  AA N+H DVV   L+
Sbjct:  144 KSGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDRT-PLHVAAERGNTNIVEILTEKFRSNVLARTKEGNTLMHIASQYGHPETALAFLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYT---ALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPSPIHIPVSHSNHCLVAKVKKALAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQILLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVC-NSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKLFLKH--KPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAA----KNGH--------IHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQG-AEINVTDKNGWCPLHFAARSGFLDTIRFLVE---CGANPILECKDGKTAIQYAAANNHQDVVSFLLK 929          

HSP 4 Score: 123.635 bits (309), Expect = 2.437e-27
Identity = 139/493 (28.19%), Postives = 211/493 (42.80%), Query Frame = 2
Query:  923 RDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTK--CLPIHLACSRTG---------TSSGTVISLLKATKSARLQM-----------------------DKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDAN---AQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGH-----------PETTMSLLRRGVP--LHMPNK---TGSVCLHAAAQSGHVNVVKTLLD-KGANVN-ARTKDLYTPLHIAVKYGNPGVVETLIGYG-AQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNK 2233
            +  +   +PL++A +      V  LL+     +   + G+ ALH AA+   + +  +LL  KA  N     TK    P+HL C++ G          +    I  +  TK   L M                       D EG   L  A E      +K  LK + E  T+      G    HIA  K     ++ L   N   A          T LH+AA G     +K L  T A  +  +    +A+H+AA+ GH  ++E L       + T  K G T +HV +  G            P T  S   + VP  LHM  +   +G   LH A+QSGH ++V+ LL+  G   + A T+   TP+H+A + G+  VV  L+    +Q++ K      + LH+AA   + E     L+  GA +N T KNG   LH A+RSG L+ ++ L++ GA+P + CKDG + +       H    Q++VSF  K
Sbjct:  450 KQAKNGRSPLLVAAEQGHTGIVQILLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVN---AKTKLGLTPLHL-CAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTS--ANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAAKNGHIHVLEALKGSVSFRI-TSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDK-RGRTCLHLAAANGHIEM-MRALIGQGAEINVTDKNGWCPLHFAARSGFLDTIRFLVECGANPILECKDGKTAIQYAAANNH----QDVVSFLLK 929          

HSP 5 Score: 74.3294 bits (181), Expect = 2.506e-12
Identity = 87/349 (24.93%), Postives = 138/349 (39.54%), Query Frame = 2
Query:  923 RDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTN-------------IKKKYSGDAAIHIACRKKDVEALRLLCD-ANAQINMKNG-MGQTVLHIAAEGNDETILKYLQS-TIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKD--LYTPLHIAVKYGNPGVVETLI 1915
            R+   D TPL LA       AV  LLE G + +D   +G TA+H AAK                            IH            V+  LK + S R+   K G  +L  A   G +  ++E+L       T+              + + SG   +H+A +      +RLL +    Q +      G T +H+AA+     ++  L S + + +++ D   R+ LH+AA  GH +++  LI +    +   DK G   +H  + SG  +T   L+  G    +  K G   +  AA + H +VV  LL K  N     +D      L +  K  N  V++  I
Sbjct:  653 RNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAAKNGH-------------------------IH------------VLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQ-GAEINVTDKNGWCPLHFAARSGFLDTIRFLVECGANPILECKDGKTAIQYAAANNHQDVVSFLLKKNHNTLKLIEDRKFVFDLMVCGKLNNNRVIQEFI 963          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 1007.28 bits (2603), Expect = 0.000e+0
Identity = 582/1326 (43.89%), Postives = 814/1326 (61.39%), Query Frame = 2
Query: 1412 LCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRS---ALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRG-VPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDK-GANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTK---SRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEH-KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGE---QMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXX-XXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFL----LFYVPLLDAY-----PCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSG------------DYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIY 5287
            L D     N+++G    VL  A E  +  I K L S   +  +     +S   ALH++  K      +LL++ +  +V  ++ EG T +H+ + +G  E  + LL +     ++ +K     LH AA+ G+ N+V+ L +K  +NV ARTK+  T +HIA +YG+P   ET + +                                LK G  ++   K G   LH A+  G++ ++++LLQ+GA      KD  + LHI    C  L+VQ L+ F  + +    ++  + L  L  N GET +H AA + ++  H+  ED  II++L+E+DGD+   T  T ETPLHYCA  GN DVLLE++  +   +IQ  +NKQAKNG SPLL A+  GH  IV ILL+N ARVDVFDEHG  ALHLAAE GH  +A++LL HKAFVNAK+K GLTPLHL AQNG+  LV+ L+  + A +DA++L ++TPLH+AA  G+ +VC SLL  K   AD  A D  GQTPLHLAA+NDHS+VV+LFL+ KPEL+ +A+ +G TC HIAA+ GS AVIKE ++FNK+     +NK+  ST LHLAA GGH   VKVLL+ GA+ ++EN +GMT +HLAAK GH H+LE LK  +SFR+ S K+G+T LHVAAH+GQ+DFV E+LT VPA + SE PK+      MK+   ESG TPLHLASQSGHE+LVRLLLN  GV+ ++AT   G+TP+H A+QNGHT V  +LL KS++Q+  +D +GRT LH A+++GHIEM    IGQGA+IN +D  G+ PLH+AA+SG+L   + LVE GA+   E  D +  +  AA  NH +V+SFLL+  H+T+KLIE+ KF+FDLM+C KLNN + ++EFIL S AP + A KLS      + KEKER+ DL+  +++ ++M T+L  +A+    A  +L++VD+     LD LIE EQK+V++HP VQ+YL++VW G L+W  WKL +  +  L  P  W +  LP+  +    P++KFM YL SH++L  L    + Y PL   Y     PC+ +   +  +   L+  L+           +R  +A ++  +L F   A     L+F+         ++ RN LL  A  +  +  L+FL+ HHLFGPW IIIRDL+ DL +F VILA+F ++F   L A +QP+                 SN+   +   V L+F+LFG   P  LP    TP +   + R VFG+ L++T+IVLINLLIAMM++TY+ IQA+SDTEWK+GRA LIR+M +    PSPFNL T L  Y
Sbjct:   25 LSDIFVHCNLQDGCIPLVL--AIEAGNLGICKELLSATPEAQLRAVSKKSGDTALHVSCRKRDADAAKLLVE-YGASVDCQNVEGQTPLHIAAWAG-DEMMLKLLHQCRANANLTDKMDRTPLHVAAERGNTNIVEILTEKFRSNVLARTKEGNTLMHIASQYGHP---ETALAF--------------------------------LKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPLSLLYPNAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQILLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMK---ADVNATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQGAEINVTDKNGWCPLHFAARSGFLDTIRFLVECGANPILECKDGKTAIQYAAANNHQDVVSFLLKKNHNTLKLIEDRKFVFDLMVCGKLNNNRVIQEFILNSIAPLDTAVKLSRALNITAFKEKERAVDLLNAAKYSENMATELLTIASGSTNAGFILRAVDHRCTTILDCLIECEQKDVVAHPAVQKYLTEVWYGSLDWATWKLVLLFFTFLACPPVWLVFSLPLKHRFNKIPIMKFMSYLASHIFLIVLFILTIVYPPLSPIYEGRMVPCWNEWLLLAWLSGTLVSELTHHG--------ERAGLAWIRVFVLGFSAVAFFCHLLAFLFSDRDRLHCLFARNILLGVAMTLSFVQFLEFLTFHHLFGPWAIIIRDLIKDLTRFAVILAMFHVAFTMQLSAVYQPVYPEATSAQSLNETVHSESNIQDPIDITVLLFFSLFGLVEPGCLPSLNRTPQFTFVIVRFVFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTEWKFGRATLIRDMTRKPGTPSPFNLFTNLFYY 1300          

HSP 2 Score: 449.129 bits (1154), Expect = 1.752e-131
Identity = 312/856 (36.45%), Postives = 457/856 (53.39%), Query Frame = 2
Query: 1241 KEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGIL------------DESPLHVAATTK------NGE--KCAEMLLKSGANVNE-TMKNGESALHIASRSGNLEMLKSLLQEGADPSI------ICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKA-FVNAKSKGGLTPLHLAAQNGYKDLVEKLINENK--ATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFM---------RFNKSVIHGL----KNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAE--ENNDGMTCLHLAAKYGHFHLLEVLKPKISFRV-VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQI 3670
            ++G I L+ AIEAG++   KELL A  E Q     K SGD A+H++CRK+D +A +LL +  A ++ +N  GQT LHIAA   DE +LK L    A+ N+ D MDR+ LH+AAE+G+T IVE+L +KF+ NVL R KEGNTLMH+ S  GHPET ++ L+RG  LHMPNK G+VCLHAAA  GHV VV+ LL KGA+V+ARTKD YT LHIA +   P VV+TL+G+GAQV  KGG +             E+PLH+AA  K       GE  K   +L++   +++  T    E+ LH  +R GN ++L  +++  +   I        K+G SPL +     H  IVQ L+    + ++R+D        +  G+ A+H AAE      H    D     +LL++   V  +TK    TPLH CA  G +     +V  L       ++  +    +PL  A+ NG  ++ + LL   A V+  D  G T LHLAAE  H  V  + L HK   V + +  G T  H+AA  G   ++++L+  NK  AT      N  TPLHLAA  G  +  + LL      +D    +  G T +HLAAKN H  V+   L+      I ++  G+T  H+AA  G L  ++E +            KSV   L    +++ +G T LHLA++ GH  LV++LL+     A+      G T +HLAA+ GH  ++ +L  K + ++ + +K G T LH+AA  G I+ +  ++              G ++ +V  ++G  PLH A++SG  + +R L+ C    +      +G T + +A+ N H +V S LL K+ N +
Sbjct:   35 QDGCIPLVLAIEAGNLGICKELLSATPEAQLRAVSKKSGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDRTPLHVAAERGNTNIVEILTEKFRSNVLARTKEGNTLMHIASQYGHPETALAFLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPLSLLYPNAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQILL----QNQARVDVF------DEHGKAALHLAAE----NGHDQIAD-----ILLKHKAFVNAKTKLG-LTPLHLCAQNGFN----HLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASD---ENGEGMTAIHLAAKNGHIHVLEA-LKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQ------------GAEI-NVTDKNGWCPLHFAARSGFLDTIRFLVECGANPILEC--KDGKTAIQYAAANNHQDVVSFLLKKNHNTL 847          

HSP 3 Score: 187.963 bits (476), Expect = 4.625e-47
Identity = 219/822 (26.64%), Postives = 347/822 (42.21%), Query Frame = 2
Query:  875 EALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVIS------LLKATKSARLQM-------------------------DKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNG-------------MGQTVLHIAA---------EGNDETILKYLQSTIADV---------------------NVLDDM-------------------DRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKG-ANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLL---QEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV--KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQ----------LVVNKQAK-NGWSPLLFASHNGHHEIVSILLKN-NARVDV-FDEHGMTALHLAAEKGHRNVANVLLLHK-AFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLR 3001
            EA LR+ SK+          + +T L ++C+     A   L+E G + +    +G+T LH AA    E ++KLL   +A+ NL     +  P+H+A  R  T+   +++      +L  TK     M                         +K GA+ L  A   G ++ ++ LL+         K  Y+   A+HIA        ++ L    AQ+ +K G              G+T LH+AA         +G D  I++ L     D+                     +VL +M                    RS L +AAE+GHT IV++L+   +  V   D+ G   +H+ + +GH +    LL+    ++   K G   LH  AQ+G  ++VK L++   A ++A +    TPLH+A   G   V  +L+   A VN    I  ++PLH+AA   + E     L      V      G +  HIA+  G+  ++K LL   + GA  +    + ++PLH+     H   V+ L+                   N EG TA+H AA    K  H        I +L    G V  +I +  T  T LH  A  G  D + EI+  +   +           L + +Q++ +G++PL  AS +GH  +V +LL     + D      G T +HLAA+ GH  V  +LL    + ++ K K G T LHLAA NG+ +++  LI +  A ++    N   PLH AA+ G  +  R L+      A+P      G+T +  AA N+H DVV   L+
Sbjct:   62 EAQLRAVSKK----------SGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDRT-PLHVAAERGNTNIVEILTEKFRSNVLARTKEGNTLMHIASQYGHPETALAFLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYT---ALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPLSLLYPNAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQILLQN-QARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMKADVN-ATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDE----------NGEGMTAIHLAA----KNGH--------IHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQG-AEINVTDKNGWCPLHFAARSGFLDTIRFLVE---CGANPILECKDGKTAIQYAAANNHQDVVSFLLK 841          

HSP 4 Score: 74.3294 bits (181), Expect = 1.965e-12
Identity = 87/349 (24.93%), Postives = 138/349 (39.54%), Query Frame = 2
Query:  923 RDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTN-------------IKKKYSGDAAIHIACRKKDVEALRLLCD-ANAQINMKNG-MGQTVLHIAAEGNDETILKYLQS-TIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKD--LYTPLHIAVKYGNPGVVETLI 1915
            R+   D TPL LA       AV  LLE G + +D   +G TA+H AAK                            IH            V+  LK + S R+   K G  +L  A   G +  ++E+L       T+              + + SG   +H+A +      +RLL +    Q +      G T +H+AA+     ++  L S + + +++ D   R+ LH+AA  GH +++  LI +    +   DK G   +H  + SG  +T   L+  G    +  K G   +  AA + H +VV  LL K  N     +D      L +  K  N  V++  I
Sbjct:  565 RNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAAKNGH-------------------------IH------------VLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQ-GAEINVTDKNGWCPLHFAARSGFLDTIRFLVECGANPILECKDGKTAIQYAAANNHQDVVSFLLKKNHNTLKLIEDRKFVFDLMVCGKLNNNRVIQEFI 875          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 334.724 bits (857), Expect = 3.541e-92
Identity = 271/839 (32.30%), Postives = 405/839 (48.27%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYG-------------------------------AQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKI-QLVVNKQAK------NGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNK---SGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSS--NQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            + L  A  GN +  L +L++ + D+N  +    +ALH+++++GH K+V  L+ K    + T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN N  T+D +TPL +A++ G+  VV  LI YG                               A V  K G    +PLH+AA  +N    A++LL  GANVN T +NG SALHIASR GN+ M++ LL  GA      KD  +PLH  VR  H  I + L          +D    +      G + +H A         S  +  D +++LL+Y   +   T     TPLH  A  G+            H++ +L+++K AK      NG++PL  A    H  ++ +LLK+ A +D   E G+T LH+A+  GH  +   LL   A  N  S    TPLH+AA+  + D+ + LI +NKA V+A   + +TPLH AA+ G  E+ R LL +  +P  P  A   G TPLHL  +  H+    L L  +     + +  G T  H+AA  G + + +  +   +   H      TG T LH+A    H  +V++LL+ GA+P     +G T LH+A K         L   + F    N     G+TPLH+AA  G  D V  +L+   AN+             +  +S LTPLHLASQ GH N+  +L++ D     +A    G  PLH A   G+  V   LL   +  N +T+  F   T LH A+  GH ++  L +  GA  N +   G TPL  A + GY+ V  +L
Sbjct:   48 SFLRAARAGNLDKALDHLRNGV-DINTCNQNGLNALHLSSKEGHVKMVTELLHK-DIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGF---TPLHIAAHYEN-LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEIL----------LDHGAPIQAKTKNGLSPIHMA---------SQGDHLDCVRLLLQYQAHIDDIT-LDHLTPLHVAAHCGH------------HRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLI-QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTA---GHTPLHLTTRGGHTQTAELLLDNQ-AAHTSMTKKGFTPLHVAAKYGKIQIAELLL---EREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARAL---LQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQ-ANVH------------LGNKSSLTPLHLASQEGHLNIAEVLVSHDASV--AAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGF---TPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 2 Score: 303.908 bits (777), Expect = 1.295e-82
Identity = 249/821 (30.33%), Postives = 383/821 (46.65%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIK--------------------------------EFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNN-------------------------------NGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            +G+ +  +  LR GV ++  N+ G   LH +++ GHV +V  LL K   +   TK   T LHIA   G   VV  L+ +G                                   ANVN   + G + L++A++  +L ++K LL+ GA+ ++  +DG +PL + ++  H  +V  L+S+  K K R+ A+              H AA           +DT    +LL+ D +  + +K T  TPLH  A   N +V   ++N   +     VN   +NG S L  AS  G+  +V +LL   A++D   +  +T LH A   GH  ++ +LL H A + AK+K GL+P+H+A+Q  + D V +L+ + +A +D +TL+  TPLH+AA  G   V + LL  K   ++ +A +  G TPLH+A K  H  V+ L L  K    I+A +  G+T  H+A+  G L ++K                                +F+  NK+ ++         T LH AA  GH+++V++LL+ GA+P      G T LHL  + GH    E+L    +      K G TPLHVAA YG+I  + E+L +  A+  S              ++GLTPLH+A    H N+VRLLLN       +A N                                 G TPLH A+Q GH ++ ++LL K +N +   +    T LH AS  GH+ +A + +   A + A   MGF PLH A   G +KV K L++  A+  A T     PL  AA   HT++++ LL+N
Sbjct:   55 AGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHG-----------------------------------ANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPAL--------------HIAAR---------NDDTRTAAVLLQNDPNADVLSK-TGFTPLHIAAHYENLNVAQLLLNRGAN-----VNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCV-RLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAK-LLLDKGAKSNARALN--GFTPLHIACKKSHIRVMELLL--KSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDD--QTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQ-IAELLLEREAHPNSA------------GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQAN-VHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN 789          

HSP 3 Score: 263.077 bits (671), Expect = 5.216e-70
Identity = 246/868 (28.34%), Postives = 404/868 (46.54%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCL-PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVE--ALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDF--VGEMLTDVP-ANIKSER-----PKTGEQMKDVLTESGLTPLHLASQSG 3517
            L L+ K+  +  V  LL   +      K G TALH AA    EDVV+ L+   A  N+   S K   P+++A          V+  L    + +    ++G   L  A++ G  + +  L+    + +  +        A+HIA R  D    A+ L  D NA +  K G   T LHIAA   +  + + L +  A+VN       SALH+A+ +G+  +V LL+D+  + +  T+D+   T +H    +GH   +  LL  G P+    K G   +H A+Q  H++ V+ LL   A+++  T D  TPLH+A   G+  V + L+  GA+ N +  +   +PLH+A   K+  +  E+LLKSGA+++   ++G + LH+AS  G+L ++K+LLQ+GA P++      +PLH+  R  H     ++  F  + K++++A                        R   D                         +TPLH  A +G+ +++  ++    H      +     G +PL   +  GH +   +LL N A      + G T LH+AA+ G   +A +LL  +A  N+  K GLTPLH+A  + + ++V  L+N+  A+      N  TPLH+A +    +  R+LL    + A   A   +G TPLHLAA+  H D+V L L  +  + +  +   +T  H+A+  G L + +  +  + SV         G   LH+A   G+ K+VK LL   AN       G T LH AA+ GH  ++ +L    +    ++ +G+TPL +A   G I    V  ++TD P   + +ER     P+T ++  DV  +    P   A+  G
Sbjct:   82 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGA--NVNSQSQKGFTPLYMAAQENHLP---VVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRL-------PALHIAARNDDTRTAAVLLQNDPNADVLSKTGF--TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNAR-ALNGFTPLHIAC-KKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAH----TDVADFLIQNKAKVNA------------------------RAKDD-------------------------QTPLHCAARSGHYEMVRLLLENGAHP-----DPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKG-ASPHCTARNGYTPLHMAVKQRSVDTARALLQ---FGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVA---AETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERHRMSFPETMDEPMDVSEDEDEPPYFRAAPPG 865          

HSP 4 Score: 242.276 bits (617), Expect = 1.477e-63
Identity = 219/721 (30.37%), Postives = 349/721 (48.40%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIK-KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNK------QAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAV 3085
            TPL +A ++N L  V  LLE G N N   +DG T L  A +   E+VV  L++         G  +   +H+A     T +  V  LL+   +A + + K G   L  A    +++  + LL     +  N+     +G +A+HIA R+ +V  +RLL D  AQI+       T LH A       I + L    A +        S +HMA++  H   V LL+ +++ ++     +  T +HV +  GH      LL +G   +     G   LH A +  H+ V++ LL  GA+++A T+   TPLH+A   G+  +V+TL+  GA  N    +  E+PLH+AA   + +  A+ L+++ A VN   K+ ++ LH A+RSG+ EM++ LL+ GA P      G++PLH+  R  H    + L          +D          +G T +H AA+         +    I ++LLE +       K T  TPLH      + ++           ++L++NK       A+NG++PL  A      +    LL+  A  +     G+T LHLAA++GH ++  +LL  +A V+  +K  LTPLHLA+Q G+ ++ E L++ + A+V A T     PLH+A  YG  +V + LL H+   A+  A    G TPLH AA+  H+D+V L L+        AS +G+T   IA   G ++V
Sbjct:  146 TPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYG-----MKGKVRLPALHIAARNDDTRTAAV--LLQNDPNADV-LSKTGFTPLHIAAHYENLNVAQLLLN----RGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLL-QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV-FSVKVETPLHMAARAAHTD-VADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELL----------LDNQAAHTSMTKKGFTPLHVAAK---------YGKIQIAELLLEREAHPNSAGK-TGLTPLHVAVYHNHLNI-----------VRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHD-ASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQ---ANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK-NGACPNQASMNGITPLAIAKRLGYISV 815          

HSP 5 Score: 198.364 bits (503), Expect = 4.373e-50
Identity = 174/568 (30.63%), Postives = 273/568 (48.06%), Query Frame = 2
Query: 2264 VNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEY-DGDVKIQTKYTE-ETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            +N  N  G  A+H ++    K  H        +KM+ E    D+ ++T   +  T LH  A AG  DV+ E+VN   +     VN Q++ G++PL  A+   H  +V  LL+N A  ++  E G T L +A ++GH NV   L+ +      K K  L  LH+AA+N        L+ +N    D L+    TPLH+AA Y    V + LL      A+       G + LH+A++  +  +VRL L    +  I+A + D +T  H A  NG + + +  +     +    KN   G + +H+A++G H   V++LL   A+  +   D +T LH+AA  GH  + ++L  K +       +G TPLH+A     I  V E+L    A+I            D +TESGLTPLH+AS  GH  +V+ LL   G   N   +    TPLH A++  HT+V   L+ ++  ++  R    +T LH A+  GH EM  L +  GA  +     G TPLH   + G+ +  +LL++  A+  + T     PL +AA +   ++   LL  +
Sbjct:   71 INTCNQNGLNALHLSS----KEGH--------VKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGAN-----VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISY----GMKGKVRLPALHIAARNDDTRTAAVLL-QNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRG---ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQ--IDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKN---GLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIR-VMELLLKSGASI------------DAVTESGLTPLHVASFMGHLPIVKTLLQ-KGASPN-VFSVKVETPLHMAARAAHTDVADFLI-QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLERE 592          

HSP 6 Score: 192.2 bits (487), Expect = 2.724e-48
Identity = 157/509 (30.84%), Postives = 250/509 (49.12%), Query Frame = 2
Query: 2435 CATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTP-LHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
             A AGN D  L+    L + +   +N   +NG + L  +S  GH ++V+ LL  +  ++   + G TALH+AA  G  +V   L+ H A VN++S+ G TPL++AAQ  +  +V K + EN A  +  T +  TPL +A Q G + V   L+ + +          + + P LH+AA+ND +    + L+  P                                N  V+       TG T LH+AA   +  + ++LL+ GAN      +G++ LH+A++ G+  ++ +L  + +      K  +TPLH A   G +  + E+L D  A I+++            T++GL+P+H+ASQ  H + VRLLL      ++  T ++  TPLH A+  GH  V  +LL K +     R   G T LH A    HI +  L +  GA I+A    G TPLH A+  G+L + K L+++GAS    +   + PL +AA   HT+V  FL++NK
Sbjct:   52 AARAGNLDKALD---HLRNGVD--INTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVV-KFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM--------KGKVRLPALHIAARNDDTRTAAVLLQNDP--------------------------------NADVL-----SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVR-ISEILLDHGAPIQAK------------TKNGLSPIHMASQGDHLDCVRLLLQYQA-HIDDITLDH-LTPLHVAAHCGHHRVAKLLLDKGAKS-NARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNK 493          

HSP 7 Score: 186.037 bits (471), Expect = 2.437e-46
Identity = 183/621 (29.47%), Postives = 275/621 (44.28%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTK--CLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGS-ISTIKELLK-------------------AECEQQTNIK-----------KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            +T  TPL +A     L     LL  G N N   ++G +ALH A++     +V+LLL + A        TK    P+H A  R G      IS +     A +Q   +  +S ++    G  +  ++ LL+                   A C      K           +  +G   +HIAC+K  +  + LL  + A I+     G T LH+A+      I+K L    A  NV      + LHMAA   HT + + LI   K  V  R K+  T +H  + SGH E    LL  G     P   G   LH   + GH    + LLD  A   + TK  +TPLH+A KYG   + E L+   A  N   G    +PLHV A   N      +LL  GA+ + T +NG + LH+A +  +++  ++LLQ GA  +     G +PLH+  +  H  +V  L+S              V+L N    T +H A++      H      +I ++L+ +D  V  +T+     PLH     GN    +++V F L+H  Q  VN   K G++PL  A+  GH +IV++LLKN A  +    +G+T L +A   G+ +V +VL L
Sbjct:  237 KTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQ---IDACTKDELTPLHCAV-RNGH---VRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPN-SAGKTGLTPLHV-AVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQAN----------VHLGNKSSLTPLHLASQ----EGH-----LNIAEVLVSHDASVAAETRMG-FAPLHVACHYGN----IKVVKFLLQH--QANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSL 821          

HSP 8 Score: 137.502 bits (345), Expect = 1.604e-31
Identity = 121/416 (29.09%), Postives = 195/416 (46.88%), Query Frame = 2
Query: 2912 DPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAP 4072
            D    +  G   LHL++K  H  +V   L  K  +L   +  G T  HIAA  G   V++E +    +V         G T L++AA+  H  +VK LL+ GAN      DG T L +A + GH +++  L     K K+                            V +K+G TPLH+AAHY  ++ V ++L +  AN+            +   ++G++ LH+AS+ G+  +VRLLL+  G ++++ T +   TPLH A +NGH  ++ ILL   +  I  +   G + +H AS   H++   L +   A I+       TPLH AA  G+ +V KLL+++GA   A   +   PL +A   +H  VM  LL++  S   + E+   L  L + S + +   V+  +    +P
Sbjct:   70 DINTCNQNGLNALHLSSKEGHVKMVTELL-HKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVN---SQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLN-VAQLLLNRGANV------------NFTPQNGISALHIASRRGNVIMVRLLLD-RGAQIDACTKDE-LTPLHCAVRNGHVRISEILLDHGA-PIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESG--LTPLHVASFMGHLPIVKTLLQKGASP 463          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 334.724 bits (857), Expect = 3.561e-92
Identity = 272/848 (32.08%), Postives = 408/848 (48.11%), Query Frame = 2
Query: 1433 INMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYG-------------------------------AQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKI-QLVVNKQAK------NGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNK---SGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSS--NQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            + +K     + L  A  GN +  L +L++ + D+N  +    +ALH+++++GH K+V  L+ K    + T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN N  T+D +TPL +A++ G+  VV  LI YG                               A V  K G    +PLH+AA  +N    A++LL  GANVN T +NG SALHIASR GN+ M++ LL  GA      KD  +PLH  VR  H  I + L          +D    +      G + +H A         S  +  D +++LL+Y   +   T     TPLH  A  G+            H++ +L+++K AK      NG++PL  A    H  ++ +LLK+ A +D   E G+T LH+A+  GH  +   LL   A  N  S    TPLH+AA+  + D+ + LI +NKA V+A   + +TPLH AA+ G  E+ R LL +  +P  P  A   G TPLHL  +  H+    L L  +     + +  G T  H+AA  G + + +  +   +   H      TG T LH+A    H  +V++LL+ GA+P     +G T LH+A K         L   + F    N     G+TPLH+AA  G  D V  +L+   AN+             +  +S LTPLHLASQ GH N+  +L++ D     +A    G  PLH A   G+  V   LL   +  N +T+  F   T LH A+  GH ++  L +  GA  N +   G TPL  A + GY+ V  +L
Sbjct:    2 MRLKADAATSFLRAARAGNLDKALDHLRNGV-DINTCNQNGLNALHLSSKEGHVKMVTELLHK-DIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGF---TPLHIAAHYEN-LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEIL----------LDHGAPIQAKTKNGLSPIHMA---------SQGDHLDCVRLLLQYQAHIDDIT-LDHLTPLHVAAHCGH------------HRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLI-QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTA---GHTPLHLTTRGGHTQTAELLLDNQ-AAHTSMTKKGFTPLHVAAKYGKIQIAELLL---EREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARAL---LQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQ-ANVH------------LGNKSSLTPLHLASQEGHLNIAEVLVSHDASV--AAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGF---TPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 782          

HSP 2 Score: 302.753 bits (774), Expect = 2.812e-82
Identity = 249/821 (30.33%), Postives = 383/821 (46.65%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIK--------------------------------EFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNN-------------------------------NGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            +G+ +  +  LR GV ++  N+ G   LH +++ GHV +V  LL K   +   TK   T LHIA   G   VV  L+ +G                                   ANVN   + G + L++A++  +L ++K LL+ GA+ ++  +DG +PL + ++  H  +V  L+S+  K K R+ A+              H AA           +DT    +LL+ D +  + +K T  TPLH  A   N +V   ++N   +     VN   +NG S L  AS  G+  +V +LL   A++D   +  +T LH A   GH  ++ +LL H A + AK+K GL+P+H+A+Q  + D V +L+ + +A +D +TL+  TPLH+AA  G   V + LL  K   ++ +A +  G TPLH+A K  H  V+ L L  K    I+A +  G+T  H+A+  G L ++K                                +F+  NK+ ++         T LH AA  GH+++V++LL+ GA+P      G T LHL  + GH    E+L    +      K G TPLHVAA YG+I  + E+L +  A+  S              ++GLTPLH+A    H N+VRLLLN       +A N                                 G TPLH A+Q GH ++ ++LL K +N +   +    T LH AS  GH+ +A + +   A + A   MGF PLH A   G +KV K L++  A+  A T     PL  AA   HT++++ LL+N
Sbjct:   18 AGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHG-----------------------------------ANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPAL--------------HIAAR---------NDDTRTAAVLLQNDPNADVLSK-TGFTPLHIAAHYENLNVAQLLLNRGAN-----VNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCV-RLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAK-LLLDKGAKSNARALN--GFTPLHIACKKSHIRVMELLL--KSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDD--QTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQ-IAELLLEREAHPNSA------------GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQAN-VHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN 752          

HSP 3 Score: 262.692 bits (670), Expect = 8.274e-70
Identity = 246/868 (28.34%), Postives = 404/868 (46.54%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCL-PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVE--ALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDF--VGEMLTDVP-ANIKSER-----PKTGEQMKDVLTESGLTPLHLASQSG 3517
            L L+ K+  +  V  LL   +      K G TALH AA    EDVV+ L+   A  N+   S K   P+++A          V+  L    + +    ++G   L  A++ G  + +  L+    + +  +        A+HIA R  D    A+ L  D NA +  K G   T LHIAA   +  + + L +  A+VN       SALH+A+ +G+  +V LL+D+  + +  T+D+   T +H    +GH   +  LL  G P+    K G   +H A+Q  H++ V+ LL   A+++  T D  TPLH+A   G+  V + L+  GA+ N +  +   +PLH+A   K+  +  E+LLKSGA+++   ++G + LH+AS  G+L ++K+LLQ+GA P++      +PLH+  R  H     ++  F  + K++++A                        R   D                         +TPLH  A +G+ +++  ++    H      +     G +PL   +  GH +   +LL N A      + G T LH+AA+ G   +A +LL  +A  N+  K GLTPLH+A  + + ++V  L+N+  A+      N  TPLH+A +    +  R+LL    + A   A   +G TPLHLAA+  H D+V L L  +  + +  +   +T  H+A+  G L + +  +  + SV         G   LH+A   G+ K+VK LL   AN       G T LH AA+ GH  ++ +L    +    ++ +G+TPL +A   G I    V  ++TD P   + +ER     P+T ++  DV  +    P   A+  G
Sbjct:   45 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGA--NVNSQSQKGFTPLYMAAQENHLP---VVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRL-------PALHIAARNDDTRTAAVLLQNDPNADVLSKTGF--TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNAR-ALNGFTPLHIAC-KKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAH----TDVADFLIQNKAKVNA------------------------RAKDD-------------------------QTPLHCAARSGHYEMVRLLLENGAHP-----DPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKG-ASPHCTARNGYTPLHMAVKQRSVDTARALLQ---FGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVA---AETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERHRMSFPETMDEPMDVSEDEDEPPYFRAAPPG 828          

HSP 4 Score: 241.506 bits (615), Expect = 2.130e-63
Identity = 219/721 (30.37%), Postives = 349/721 (48.40%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIK-KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNK------QAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAV 3085
            TPL +A ++N L  V  LLE G N N   +DG T L  A +   E+VV  L++         G  +   +H+A     T +  V  LL+   +A + + K G   L  A    +++  + LL     +  N+     +G +A+HIA R+ +V  +RLL D  AQI+       T LH A       I + L    A +        S +HMA++  H   V LL+ +++ ++     +  T +HV +  GH      LL +G   +     G   LH A +  H+ V++ LL  GA+++A T+   TPLH+A   G+  +V+TL+  GA  N    +  E+PLH+AA   + +  A+ L+++ A VN   K+ ++ LH A+RSG+ EM++ LL+ GA P      G++PLH+  R  H    + L          +D          +G T +H AA+         +    I ++LLE +       K T  TPLH      + ++           ++L++NK       A+NG++PL  A      +    LL+  A  +     G+T LHLAA++GH ++  +LL  +A V+  +K  LTPLHLA+Q G+ ++ E L++ + A+V A T     PLH+A  YG  +V + LL H+   A+  A    G TPLH AA+  H+D+V L L+        AS +G+T   IA   G ++V
Sbjct:  109 TPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYG-----MKGKVRLPALHIAARNDDTRTAAV--LLQNDPNADV-LSKTGFTPLHIAAHYENLNVAQLLLN----RGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLL-QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV-FSVKVETPLHMAARAAHTD-VADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELL----------LDNQAAHTSMTKKGFTPLHVAAK---------YGKIQIAELLLEREAHPNSAGK-TGLTPLHVAVYHNHLNI-----------VRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHD-ASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQ---ANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK-NGACPNQASMNGITPLAIAKRLGYISV 778          

HSP 5 Score: 197.593 bits (501), Expect = 6.998e-50
Identity = 174/568 (30.63%), Postives = 273/568 (48.06%), Query Frame = 2
Query: 2264 VNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEY-DGDVKIQTKYTE-ETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            +N  N  G  A+H ++    K  H        +KM+ E    D+ ++T   +  T LH  A AG  DV+ E+VN   +     VN Q++ G++PL  A+   H  +V  LL+N A  ++  E G T L +A ++GH NV   L+ +      K K  L  LH+AA+N        L+ +N    D L+    TPLH+AA Y    V + LL      A+       G + LH+A++  +  +VRL L    +  I+A + D +T  H A  NG + + +  +     +    KN   G + +H+A++G H   V++LL   A+  +   D +T LH+AA  GH  + ++L  K +       +G TPLH+A     I  V E+L    A+I            D +TESGLTPLH+AS  GH  +V+ LL   G   N   +    TPLH A++  HT+V   L+ ++  ++  R    +T LH A+  GH EM  L +  GA  +     G TPLH   + G+ +  +LL++  A+  + T     PL +AA +   ++   LL  +
Sbjct:   34 INTCNQNGLNALHLSS----KEGH--------VKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGAN-----VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISY----GMKGKVRLPALHIAARNDDTRTAAVLL-QNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRG---ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQ--IDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKN---GLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIR-VMELLLKSGASI------------DAVTESGLTPLHVASFMGHLPIVKTLLQ-KGASPN-VFSVKVETPLHMAARAAHTDVADFLI-QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLERE 555          

HSP 6 Score: 191.43 bits (485), Expect = 4.439e-48
Identity = 157/509 (30.84%), Postives = 250/509 (49.12%), Query Frame = 2
Query: 2435 CATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTP-LHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
             A AGN D  L+    L + +   +N   +NG + L  +S  GH ++V+ LL  +  ++   + G TALH+AA  G  +V   L+ H A VN++S+ G TPL++AAQ  +  +V K + EN A  +  T +  TPL +A Q G + V   L+ + +          + + P LH+AA+ND +    + L+  P                                N  V+       TG T LH+AA   +  + ++LL+ GAN      +G++ LH+A++ G+  ++ +L  + +      K  +TPLH A   G +  + E+L D  A I+++            T++GL+P+H+ASQ  H + VRLLL      ++  T ++  TPLH A+  GH  V  +LL K +     R   G T LH A    HI +  L +  GA I+A    G TPLH A+  G+L + K L+++GAS    +   + PL +AA   HT+V  FL++NK
Sbjct:   15 AARAGNLDKALD---HLRNGVD--INTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVV-KFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM--------KGKVRLPALHIAARNDDTRTAAVLLQNDP--------------------------------NADVL-----SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVR-ISEILLDHGAPIQAK------------TKNGLSPIHMASQGDHLDCVRLLLQYQA-HIDDITLDH-LTPLHVAAHCGHHRVAKLLLDKGAKS-NARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNK 456          

HSP 7 Score: 185.652 bits (470), Expect = 3.059e-46
Identity = 183/621 (29.47%), Postives = 275/621 (44.28%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTK--CLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGS-ISTIKELLK-------------------AECEQQTNIK-----------KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            +T  TPL +A     L     LL  G N N   ++G +ALH A++     +V+LLL + A        TK    P+H A  R G      IS +     A +Q   +  +S ++    G  +  ++ LL+                   A C      K           +  +G   +HIAC+K  +  + LL  + A I+     G T LH+A+      I+K L    A  NV      + LHMAA   HT + + LI   K  V  R K+  T +H  + SGH E    LL  G     P   G   LH   + GH    + LLD  A   + TK  +TPLH+A KYG   + E L+   A  N   G    +PLHV A   N      +LL  GA+ + T +NG + LH+A +  +++  ++LLQ GA  +     G +PLH+  +  H  +V  L+S              V+L N    T +H A++      H      +I ++L+ +D  V  +T+     PLH     GN    +++V F L+H  Q  VN   K G++PL  A+  GH +IV++LLKN A  +    +G+T L +A   G+ +V +VL L
Sbjct:  200 KTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQ---IDACTKDELTPLHCAV-RNGH---VRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPN-SAGKTGLTPLHV-AVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQAN----------VHLGNKSSLTPLHLASQ----EGH-----LNIAEVLVSHDASVAAETRMG-FAPLHVACHYGN----IKVVKFLLQH--QANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSL 784          

HSP 8 Score: 136.732 bits (343), Expect = 2.340e-31
Identity = 121/416 (29.09%), Postives = 195/416 (46.88%), Query Frame = 2
Query: 2912 DPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAP 4072
            D    +  G   LHL++K  H  +V   L  K  +L   +  G T  HIAA  G   V++E +    +V         G T L++AA+  H  +VK LL+ GAN      DG T L +A + GH +++  L     K K+                            V +K+G TPLH+AAHY  ++ V ++L +  AN+            +   ++G++ LH+AS+ G+  +VRLLL+  G ++++ T +   TPLH A +NGH  ++ ILL   +  I  +   G + +H AS   H++   L +   A I+       TPLH AA  G+ +V KLL+++GA   A   +   PL +A   +H  VM  LL++  S   + E+   L  L + S + +   V+  +    +P
Sbjct:   33 DINTCNQNGLNALHLSSKEGHVKMVTELLH-KDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVN---SQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLN-VAQLLLNRGANV------------NFTPQNGISALHIASRRGNVIMVRLLLD-RGAQIDACTKDE-LTPLHCAVRNGHVRISEILLDHGA-PIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESG--LTPLHVASFMGHLPIVKTLLQKGASP 426          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 334.339 bits (856), Expect = 5.323e-92
Identity = 271/839 (32.30%), Postives = 405/839 (48.27%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYG-------------------------------AQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKI-QLVVNKQAK------NGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNK---SGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSS--NQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            + L  A  GN +  L +L++ + D+N  +    +ALH+++++GH K+V  L+ K    + T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN N  T+D +TPL +A++ G+  VV  LI YG                               A V  K G    +PLH+AA  +N    A++LL  GANVN T +NG SALHIASR GN+ M++ LL  GA      KD  +PLH  VR  H  I + L          +D    +      G + +H A         S  +  D +++LL+Y   +   T     TPLH  A  G+            H++ +L+++K AK      NG++PL  A    H  ++ +LLK+ A +D   E G+T LH+A+  GH  +   LL   A  N  S    TPLH+AA+  + D+ + LI +NKA V+A   + +TPLH AA+ G  E+ R LL +  +P  P  A   G TPLHL  +  H+    L L  +     + +  G T  H+AA  G + + +  +   +   H      TG T LH+A    H  +V++LL+ GA+P     +G T LH+A K         L   + F    N     G+TPLH+AA  G  D V  +L+   AN+             +  +S LTPLHLASQ GH N+  +L++ D     +A    G  PLH A   G+  V   LL   +  N +T+  F   T LH A+  GH ++  L +  GA  N +   G TPL  A + GY+ V  +L
Sbjct:   48 SFLRAARAGNLDKALDHLRNGV-DINTCNQNGLNALHLSSKEGHVKMVTELLHK-DIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGF---TPLHIAAHYEN-LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEIL----------LDHGAPIQAKTKNGLSPIHMA---------SQGDHLDCVRLLLQYQAHIDDIT-LDHLTPLHVAAHCGH------------HRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLI-QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTA---GHTPLHLTTRGGHTQTAELLLDNQ-AAHTSMTKKGFTPLHVAAKYGKIQIAELLL---EREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARAL---LQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQ-ANVH------------LGNKSSLTPLHLASQEGHLNIAEVLVSHDASV--AAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGF---TPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 2 Score: 303.523 bits (776), Expect = 1.874e-82
Identity = 249/821 (30.33%), Postives = 383/821 (46.65%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIK--------------------------------EFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNN-------------------------------NGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            +G+ +  +  LR GV ++  N+ G   LH +++ GHV +V  LL K   +   TK   T LHIA   G   VV  L+ +G                                   ANVN   + G + L++A++  +L ++K LL+ GA+ ++  +DG +PL + ++  H  +V  L+S+  K K R+ A+              H AA           +DT    +LL+ D +  + +K T  TPLH  A   N +V   ++N   +     VN   +NG S L  AS  G+  +V +LL   A++D   +  +T LH A   GH  ++ +LL H A + AK+K GL+P+H+A+Q  + D V +L+ + +A +D +TL+  TPLH+AA  G   V + LL  K   ++ +A +  G TPLH+A K  H  V+ L L  K    I+A +  G+T  H+A+  G L ++K                                +F+  NK+ ++         T LH AA  GH+++V++LL+ GA+P      G T LHL  + GH    E+L    +      K G TPLHVAA YG+I  + E+L +  A+  S              ++GLTPLH+A    H N+VRLLLN       +A N                                 G TPLH A+Q GH ++ ++LL K +N +   +    T LH AS  GH+ +A + +   A + A   MGF PLH A   G +KV K L++  A+  A T     PL  AA   HT++++ LL+N
Sbjct:   55 AGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHG-----------------------------------ANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPAL--------------HIAAR---------NDDTRTAAVLLQNDPNADVLSK-TGFTPLHIAAHYENLNVAQLLLNRGAN-----VNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCV-RLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAK-LLLDKGAKSNARALN--GFTPLHIACKKSHIRVMELLL--KSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNA--RAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQ-IAELLLEREAHPNSA------------GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQAN-VHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN 789          

HSP 3 Score: 263.077 bits (671), Expect = 6.277e-70
Identity = 246/868 (28.34%), Postives = 404/868 (46.54%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCL-PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVE--ALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDF--VGEMLTDVP-ANIKSER-----PKTGEQMKDVLTESGLTPLHLASQSG 3517
            L L+ K+  +  V  LL   +      K G TALH AA    EDVV+ L+   A  N+   S K   P+++A          V+  L    + +    ++G   L  A++ G  + +  L+    + +  +        A+HIA R  D    A+ L  D NA +  K G   T LHIAA   +  + + L +  A+VN       SALH+A+ +G+  +V LL+D+  + +  T+D+   T +H    +GH   +  LL  G P+    K G   +H A+Q  H++ V+ LL   A+++  T D  TPLH+A   G+  V + L+  GA+ N +  +   +PLH+A   K+  +  E+LLKSGA+++   ++G + LH+AS  G+L ++K+LLQ+GA P++      +PLH+  R  H     ++  F  + K++++A                        R   D                         +TPLH  A +G+ +++  ++    H      +     G +PL   +  GH +   +LL N A      + G T LH+AA+ G   +A +LL  +A  N+  K GLTPLH+A  + + ++V  L+N+  A+      N  TPLH+A +    +  R+LL    + A   A   +G TPLHLAA+  H D+V L L  +  + +  +   +T  H+A+  G L + +  +  + SV         G   LH+A   G+ K+VK LL   AN       G T LH AA+ GH  ++ +L    +    ++ +G+TPL +A   G I    V  ++TD P   + +ER     P+T ++  DV  +    P   A+  G
Sbjct:   82 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGA--NVNSQSQKGFTPLYMAAQENHLP---VVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRL-------PALHIAARNDDTRTAAVLLQNDPNADVLSKTGF--TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNAR-ALNGFTPLHIAC-KKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAH----TDVADFLIQNKAKVNA------------------------RAKDD-------------------------QTPLHCAARSGHYEMVRLLLENGAHP-----DPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKG-ASPHCTARNGYTPLHMAVKQRSVDTARALLQ---FGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVA---AETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERHRMSFPETMDEPMDVSEDEDEPPYFRAAPPG 865          

HSP 4 Score: 241.891 bits (616), Expect = 1.607e-63
Identity = 219/721 (30.37%), Postives = 349/721 (48.40%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIK-KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNK------QAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAV 3085
            TPL +A ++N L  V  LLE G N N   +DG T L  A +   E+VV  L++         G  +   +H+A     T +  V  LL+   +A + + K G   L  A    +++  + LL     +  N+     +G +A+HIA R+ +V  +RLL D  AQI+       T LH A       I + L    A +        S +HMA++  H   V LL+ +++ ++     +  T +HV +  GH      LL +G   +     G   LH A +  H+ V++ LL  GA+++A T+   TPLH+A   G+  +V+TL+  GA  N    +  E+PLH+AA   + +  A+ L+++ A VN   K+ ++ LH A+RSG+ EM++ LL+ GA P      G++PLH+  R  H    + L          +D          +G T +H AA+         +    I ++LLE +       K T  TPLH      + ++           ++L++NK       A+NG++PL  A      +    LL+  A  +     G+T LHLAA++GH ++  +LL  +A V+  +K  LTPLHLA+Q G+ ++ E L++ + A+V A T     PLH+A  YG  +V + LL H+   A+  A    G TPLH AA+  H+D+V L L+        AS +G+T   IA   G ++V
Sbjct:  146 TPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYG-----MKGKVRLPALHIAARNDDTRTAAV--LLQNDPNADV-LSKTGFTPLHIAAHYENLNVAQLLLN----RGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLL-QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV-FSVKVETPLHMAARAAHTD-VADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELL----------LDNQAAHTSMTKKGFTPLHVAAK---------YGKIQIAELLLEREAHPNSAGK-TGLTPLHVAVYHNHLNI-----------VRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHD-ASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQ---ANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK-NGACPNQASMNGITPLAIAKRLGYISV 815          

HSP 5 Score: 197.978 bits (502), Expect = 5.654e-50
Identity = 174/568 (30.63%), Postives = 273/568 (48.06%), Query Frame = 2
Query: 2264 VNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEY-DGDVKIQTKYTE-ETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            +N  N  G  A+H ++    K  H        +KM+ E    D+ ++T   +  T LH  A AG  DV+ E+VN   +     VN Q++ G++PL  A+   H  +V  LL+N A  ++  E G T L +A ++GH NV   L+ +      K K  L  LH+AA+N        L+ +N    D L+    TPLH+AA Y    V + LL      A+       G + LH+A++  +  +VRL L    +  I+A + D +T  H A  NG + + +  +     +    KN   G + +H+A++G H   V++LL   A+  +   D +T LH+AA  GH  + ++L  K +       +G TPLH+A     I  V E+L    A+I            D +TESGLTPLH+AS  GH  +V+ LL   G   N   +    TPLH A++  HT+V   L+ ++  ++  R    +T LH A+  GH EM  L +  GA  +     G TPLH   + G+ +  +LL++  A+  + T     PL +AA +   ++   LL  +
Sbjct:   71 INTCNQNGLNALHLSS----KEGH--------VKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGAN-----VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISY----GMKGKVRLPALHIAARNDDTRTAAVLL-QNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRG---ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQ--IDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKN---GLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIR-VMELLLKSGASI------------DAVTESGLTPLHVASFMGHLPIVKTLLQ-KGASPN-VFSVKVETPLHMAARAAHTDVADFLI-QNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLERE 592          

HSP 6 Score: 192.2 bits (487), Expect = 3.292e-48
Identity = 157/509 (30.84%), Postives = 250/509 (49.12%), Query Frame = 2
Query: 2435 CATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTP-LHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
             A AGN D  L+    L + +   +N   +NG + L  +S  GH ++V+ LL  +  ++   + G TALH+AA  G  +V   L+ H A VN++S+ G TPL++AAQ  +  +V K + EN A  +  T +  TPL +A Q G + V   L+ + +          + + P LH+AA+ND +    + L+  P                                N  V+       TG T LH+AA   +  + ++LL+ GAN      +G++ LH+A++ G+  ++ +L  + +      K  +TPLH A   G +  + E+L D  A I+++            T++GL+P+H+ASQ  H + VRLLL      ++  T ++  TPLH A+  GH  V  +LL K +     R   G T LH A    HI +  L +  GA I+A    G TPLH A+  G+L + K L+++GAS    +   + PL +AA   HT+V  FL++NK
Sbjct:   52 AARAGNLDKALD---HLRNGVD--INTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVV-KFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM--------KGKVRLPALHIAARNDDTRTAAVLLQNDP--------------------------------NADVL-----SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVR-ISEILLDHGAPIQAK------------TKNGLSPIHMASQGDHLDCVRLLLQYQA-HIDDITLDH-LTPLHVAAHCGHHRVAKLLLDKGAKS-NARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNK 493          

HSP 7 Score: 185.652 bits (470), Expect = 2.947e-46
Identity = 183/621 (29.47%), Postives = 275/621 (44.28%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTK--CLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGS-ISTIKELLK-------------------AECEQQTNIK-----------KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            +T  TPL +A     L     LL  G N N   ++G +ALH A++     +V+LLL + A        TK    P+H A  R G      IS +     A +Q   +  +S ++    G  +  ++ LL+                   A C      K           +  +G   +HIAC+K  +  + LL  + A I+     G T LH+A+      I+K L    A  NV      + LHMAA   HT + + LI   K  V  R K+  T +H  + SGH E    LL  G     P   G   LH   + GH    + LLD  A   + TK  +TPLH+A KYG   + E L+   A  N   G    +PLHV A   N      +LL  GA+ + T +NG + LH+A +  +++  ++LLQ GA  +     G +PLH+  +  H  +V  L+S              V+L N    T +H A++      H      +I ++L+ +D  V  +T+     PLH     GN    +++V F L+H  Q  VN   K G++PL  A+  GH +IV++LLKN A  +    +G+T L +A   G+ +V +VL L
Sbjct:  237 KTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQ---IDACTKDELTPLHCAV-RNGH---VRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPN-SAGKTGLTPLHV-AVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQAN----------VHLGNKSSLTPLHLASQ----EGH-----LNIAEVLVSHDASVAAETRMG-FAPLHVACHYGN----IKVVKFLLQH--QANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSL 821          

HSP 8 Score: 137.117 bits (344), Expect = 1.712e-31
Identity = 121/416 (29.09%), Postives = 195/416 (46.88%), Query Frame = 2
Query: 2912 DPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAP 4072
            D    +  G   LHL++K  H  +V   L  K  +L   +  G T  HIAA  G   V++E +    +V         G T L++AA+  H  +VK LL+ GAN      DG T L +A + GH +++  L     K K+                            V +K+G TPLH+AAHY  ++ V ++L +  AN+            +   ++G++ LH+AS+ G+  +VRLLL+  G ++++ T +   TPLH A +NGH  ++ ILL   +  I  +   G + +H AS   H++   L +   A I+       TPLH AA  G+ +V KLL+++GA   A   +   PL +A   +H  VM  LL++  S   + E+   L  L + S + +   V+  +    +P
Sbjct:   70 DINTCNQNGLNALHLSSKEGHVKMVTELL-HKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVN---SQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLN-VAQLLLNRGANV------------NFTPQNGISALHIASRRGNVIMVRLLLD-RGAQIDACTKDE-LTPLHCAVRNGHVRISEILLDHGA-PIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESG--LTPLHVASFMGHLPIVKTLLQKGASP 463          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 323.168 bits (827), Expect = 2.594e-88
Identity = 249/818 (30.44%), Postives = 397/818 (48.53%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAM---------------------------MLVNLPNNEGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE+++ LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+                           M+VN     G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHLAA  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+                 ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LL +++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +    L  AA   HT +++ LL+N  S  +L  N
Sbjct:   51 AGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRSAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAAT---TSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGAS------------PHAAAKNGYTPLHIAAKKNQMDIATSLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVN 803          

HSP 2 Score: 275.404 bits (703), Expect = 1.065e-73
Identity = 253/807 (31.35%), Postives = 384/807 (47.58%), Query Frame = 2
Query: 1364 AIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGAN--------VNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLP----NNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEH--KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEM 3736
            A+H+A ++  VE +  L    A ++     G T LHIA+      ++K L +  A+VN       + L+MAA++ H ++V  L+D      L  + +G T + V    GH +    LL          K     LH AA+         LL    N        VN  T+  +TPLHIA  YGN  V   L+   A V+F     D +PLHVA+   N     ++LL  GA ++   ++G + LH  +RSG+ ++++ LL   A      K+G SPLH+  +  H   VQ L+                N+P     N+  TA+H AA     +         + K+LL+       +      TPLH  A   N   ++E+   L+H   IQ V     ++G +P+  A+  GH  IVS L+ + A  +  +  G TALH+AA  G   V   L+   A V AK+K   TPLH++A+ G  D+V++L+ +  A+ +A T +  TPLHLAA+ G ++V   LL H    A       +G TPLH+AAK    +V  L L+ K      A   G+T  H+AA   +  V    +    S     KN   G T LH+AA+     +   LL+ GA+       G+  +HLAA+ GH  ++ +L  + +   +SNKSG+TPLH+AA   +++ V E+L +  A++            D  T+ G TPLH+    G+  +V  LL     +VN+ T  NG T LH A+Q GHT++ ++LL    S N++T     G TAL  A   G+I +
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN-DITPLHVASKRGNA-NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--------------NVPVDDVTNDYLTALHVAAHCGHYK---------VAKVLLDKKASPNAKA-LNGFTPLH-IACKKNRIRVMEL--LLKHGASIQAVT----ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG-ASPNAATTSGYTPLHLAAREGHEDVAAFLLDHG---ASLSITTKKGFTPLHVAAKYGKLEVASLLLQ-KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN---GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHV------------DAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKT-KNGYTALHQAAQQGHTHIINVLLQNNASPNELT---VNGNTALAIARRLGYISV 819          

HSP 3 Score: 273.863 bits (699), Expect = 3.157e-73
Identity = 239/802 (29.80%), Postives = 385/802 (48.00%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQI------NMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +      N     G T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  +  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    +  ++++A         + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ S+LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G TALH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACK-KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV----QDGAQVEAKA------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLAAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 824          

HSP 4 Score: 205.682 bits (522), Expect = 2.370e-52
Identity = 190/628 (30.25%), Postives = 304/628 (48.41%), Query Frame = 2
Query:  923 RDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAK--KADPNLFGGSTKCLPIHLACSRTGTSSG--TVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKL 2785
            R  E+  TPL +A     +     LL      +  A++  T LH A+K    ++VKLLL +  K D     G T   P+H  C   G  SG   V+ +L    +  L   K G   L  A +   ++ ++ LL+       ++   Y    A+H+A      +  ++L D  A  N K   G T LHIA + N   +++ L    A +  + +   + +H+AA  GH  IV  L+     +  T +  G T +H+ + SG  E    L++ G  +    K     LH +A+ G  ++V+ LL +GA+ NA T   YTPLH+A + G+  V   L+ +GA ++   K G    +PLHVAA  K G+ + A +LL+  A+ +   K+G + LH+A+   N ++   LL +GA P    K+G +PLHI  +     I   L+ +        DA    N    +G  +VH AA+      H      D++ +LL  + +V +  K +  TPLH  A     +V   +VN   H     V+ Q K G++PL    H G+ +IV+ LL+++A+V+   ++G TALH AA++GH ++ NVLL + A  N  +  G T L +A + GY  +V+ L
Sbjct:  238 RATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLT---PLH--C---GARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD-DVTNDYL--TALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM-HHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGF---TPLHVAA--KYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYG------ADA----NAVTRQGIASVHLAAQ----EGH-----VDMVSLLLSRNANVNLSNK-SGLTPLHLAAQEDRVNVAEVLVNQGAH-----VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 5 Score: 98.5969 bits (244), Expect = 8.129e-20
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV+VN   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V + L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   48 AARAGHLEKALDYIKN--GVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 195          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 322.013 bits (824), Expect = 3.846e-88
Identity = 246/810 (30.37%), Postives = 398/810 (49.14%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE+++ LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+ +                    ++ +  G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHLAA  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LL +++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +    L  AA   HT +++ LL+N  S  +L  N
Sbjct:   34 AGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRSAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAA---TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHA------------AAKNGYTPLHIAAKKNQMDIATSLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVN 778          

HSP 2 Score: 284.648 bits (727), Expect = 1.344e-76
Identity = 254/843 (30.13%), Postives = 399/843 (47.33%), Query Frame = 2
Query: 1343 KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI--GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS----FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            KK   +A+   A R   +E           +N+ N  G   LH+A+ EG+ E + + LQ   A+V+       +ALH+A+  G  ++V++L+     NV  + + G T +++ +   H E    LL  G    +  + G   L  A Q GH  VV  LL+     + + K     LHIA +  +      L+     A V  K G    +PLH+AA   N    A +LL   A V+ T +N  + LH+AS+ GN  M+K LL  GA      +DG +PLH G R  H  +V+ L+       +KTK+              G + +H A +          +  + +++LL+++  V  +   Y   T LH  A  G+  V   +++      +   N +A NG++PL  A       ++ +LLK+ A +    E G+T +H+AA  GH N+ + L+ H A  N  +  G T LH+AA++G  ++V  L+ ++ A V+A   + +TPLH++A+ G+ ++ + LL      A P AA + G TPLHLAA+  H DV    L     L I  +  G T  H+AA  G L V    ++  KS       KS G T LH+AA   + K+  +LLD GA+P     +G T LH+AAK     +   L    +      + G+  +H+AA  G +D V  +L+   AN+            ++  +SGLTPLHLA+Q    N+  +L+N  G  V++ T   G TPLH     G+  + + LL + S ++  +   G TALH A+  GH  +  + +   A  N     G T L  A + GY+ V   L
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQRE-ANVDAATKKGNTALHIASLAGQAEVVKVLVTN-GANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGF---TPLHIAAHYGN-INVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--------------GLSPLHMATQ---------GDHLNCVQLLLQHNVPVDDVTNDYL--TALHVAAHCGHYKVAKVLLD-----KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG---ASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSI-TTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKS-GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN-ANV------------NLSNKSGLTPLHLAAQEDRVNVAEVLVN-QGAHVDAQT-KMGYTPLHVGCHYGNIKIVNFLL-QHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 3 Score: 277.715 bits (709), Expect = 1.647e-74
Identity = 238/796 (29.90%), Postives = 384/796 (48.24%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  +  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    + +++            + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ S+LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G TALH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDTNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACK-KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA----------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLAAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 4 Score: 216.468 bits (550), Expect = 1.083e-55
Identity = 184/587 (31.35%), Postives = 279/587 (47.53%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  +  + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+      V  + K+  T +H+++  G  +    LL++G   +    +G   LH AA+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  SLL+ GAD + + + G + +H+  +  H  +V  L+S              VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++ L  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  251 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNA---KALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 98.5969 bits (244), Expect = 8.570e-20
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV+VN   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V + L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   31 AARAGHLEKALDYIKN--GVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 6 Score: 86.2705 bits (212), Expect = 4.605e-16
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q    +  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNIC-NQNGLNALHLASKEGHVEVVSELLQR-EANV------------DAATKKGNTALHIASLAGQAEVVKVLV-TNGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 268          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 321.242 bits (822), Expect = 4.977e-88
Identity = 246/810 (30.37%), Postives = 398/810 (49.14%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE+++ LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+ +                    ++ +  G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHLAA  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LL +++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +    L  AA   HT +++ LL+N  S  +L  N
Sbjct:   34 AGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRSAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAA---TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHAA------------AKNGYTPLHIAAKKNQMDIATSLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVN 778          

HSP 2 Score: 283.493 bits (724), Expect = 2.010e-76
Identity = 254/843 (30.13%), Postives = 399/843 (47.33%), Query Frame = 2
Query: 1343 KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI--GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS----FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            KK   +A+   A R   +E           +N+ N  G   LH+A+ EG+ E + + LQ   A+V+       +ALH+A+  G  ++V++L+     NV  + + G T +++ +   H E    LL  G    +  + G   L  A Q GH  VV  LL+     + + K     LHIA +  +      L+     A V  K G    +PLH+AA   N    A +LL   A V+ T +N  + LH+AS+ GN  M+K LL  GA      +DG +PLH G R  H  +V+ L+       +KTK+              G + +H A +          +  + +++LL+++  V  +   Y   T LH  A  G+  V   +++      +   N +A NG++PL  A       ++ +LLK+ A +    E G+T +H+AA  GH N+ + L+ H A  N  +  G T LH+AA++G  ++V  L+ ++ A V+A   + +TPLH++A+ G+ ++ + LL      A P AA + G TPLHLAA+  H DV    L     L I  +  G T  H+AA  G L V    ++  KS       KS G T LH+AA   + K+  +LLD GA+P     +G T LH+AAK     +   L    +      + G+  +H+AA  G +D V  +L+   AN+            ++  +SGLTPLHLA+Q    N+  +L+N  G  V++ T   G TPLH     G+  + + LL + S ++  +   G TALH A+  GH  +  + +   A  N     G T L  A + GY+ V   L
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQRE-ANVDAATKKGNTALHIASLAGQAEVVKVLVTN-GANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGF---TPLHIAAHYGN-INVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--------------GLSPLHMATQ---------GDHLNCVQLLLQHNVPVDDVTNDYL--TALHVAAHCGHYKVAKVLLD-----KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG---ASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSI-TTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKS-GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSR-NANV------------NLSNKSGLTPLHLAAQEDRVNVAEVLVN-QGAHVDAQT-KMGYTPLHVGCHYGNIKIVNFLL-QHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 3 Score: 276.944 bits (707), Expect = 2.605e-74
Identity = 238/796 (29.90%), Postives = 384/796 (48.24%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  +  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    + +++            + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ S+LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G TALH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDTNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACK-KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA----------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLAAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 4 Score: 216.083 bits (549), Expect = 1.037e-55
Identity = 184/587 (31.35%), Postives = 279/587 (47.53%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  +  + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+      V  + K+  T +H+++  G  +    LL++G   +    +G   LH AA+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  SLL+ GAD + + + G + +H+  +  H  +V  L+S              VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++ L  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  251 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNA---KALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 98.2117 bits (243), Expect = 1.012e-19
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV+VN   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V + L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   31 AARAGHLEKALDYIKN--GVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 6 Score: 85.8853 bits (211), Expect = 5.372e-16
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q    +  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNIC-NQNGLNALHLASKEGHVEVVSELLQR-EANV------------DAATKKGNTALHIASLAGQAEVVKVLV-TNGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 268          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 321.242 bits (822), Expect = 5.179e-88
Identity = 246/810 (30.37%), Postives = 398/810 (49.14%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE+++ LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+ +                    ++ +  G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHLAA  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LL +++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +    L  AA   HT +++ LL+N  S  +L  N
Sbjct:   34 AGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRSAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAA---TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHAA------------AKNGYTPLHIAAKKNQMDIATSLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVN 778          

HSP 2 Score: 283.878 bits (725), Expect = 1.824e-76
Identity = 254/843 (30.13%), Postives = 399/843 (47.33%), Query Frame = 2
Query: 1343 KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI--GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS----FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            KK   +A+   A R   +E           +N+ N  G   LH+A+ EG+ E + + LQ   A+V+       +ALH+A+  G  ++V++L+     NV  + + G T +++ +   H E    LL  G    +  + G   L  A Q GH  VV  LL+     + + K     LHIA +  +      L+     A V  K G    +PLH+AA   N    A +LL   A V+ T +N  + LH+AS+ GN  M+K LL  GA      +DG +PLH G R  H  +V+ L+       +KTK+              G + +H A +          +  + +++LL+++  V  +   Y   T LH  A  G+  V   +++      +   N +A NG++PL  A       ++ +LLK+ A +    E G+T +H+AA  GH N+ + L+ H A  N  +  G T LH+AA++G  ++V  L+ ++ A V+A   + +TPLH++A+ G+ ++ + LL      A P AA + G TPLHLAA+  H DV    L     L I  +  G T  H+AA  G L V    ++  KS       KS G T LH+AA   + K+  +LLD GA+P     +G T LH+AAK     +   L    +      + G+  +H+AA  G +D V  +L+   AN+            ++  +SGLTPLHLA+Q    N+  +L+N  G  V++ T   G TPLH     G+  + + LL + S ++  +   G TALH A+  GH  +  + +   A  N     G T L  A + GY+ V   L
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQRE-ANVDAATKKGNTALHIASLAGQAEVVKVLVTN-GANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGF---TPLHIAAHYGN-INVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--------------GLSPLHMATQ---------GDHLNCVQLLLQHNVPVDDVTNDYL--TALHVAAHCGHYKVAKVLLD-----KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG---ASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT-TKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKS-GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN-ANV------------NLSNKSGLTPLHLAAQEDRVNVAEVLVN-QGAHVDAQT-KMGYTPLHVGCHYGNIKIVNFLL-QHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 3 Score: 277.33 bits (708), Expect = 2.093e-74
Identity = 238/796 (29.90%), Postives = 384/796 (48.24%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  +  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    + +++            + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ S+LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G TALH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDTNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACK-KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA----------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLAAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 4 Score: 216.468 bits (550), Expect = 1.058e-55
Identity = 184/587 (31.35%), Postives = 279/587 (47.53%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  +  + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+      V  + K+  T +H+++  G  +    LL++G   +    +G   LH AA+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  SLL+ GAD + + + G + +H+  +  H  +V  L+S              VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++ L  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  251 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNA---KALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 98.2117 bits (243), Expect = 9.662e-20
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV+VN   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V + L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   31 AARAGHLEKALDYIKN--GVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 6 Score: 85.8853 bits (211), Expect = 5.654e-16
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q    +  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNIC-NQNGLNALHLASKEGHVEVVSELLQR-EANV------------DAATKKGNTALHIASLAGQAEVVKVLVT-NGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 268          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 321.242 bits (822), Expect = 5.216e-88
Identity = 246/810 (30.37%), Postives = 398/810 (49.14%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE+++ LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+ +                    ++ +  G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHLAA  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LL +++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +    L  AA   HT +++ LL+N  S  +L  N
Sbjct:   34 AGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRSAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAA---TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHAA------------AKNGYTPLHIAAKKNQMDIATSLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVN 778          

HSP 2 Score: 283.878 bits (725), Expect = 1.916e-76
Identity = 254/843 (30.13%), Postives = 399/843 (47.33%), Query Frame = 2
Query: 1343 KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI--GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS----FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            KK   +A+   A R   +E           +N+ N  G   LH+A+ EG+ E + + LQ   A+V+       +ALH+A+  G  ++V++L+     NV  + + G T +++ +   H E    LL  G    +  + G   L  A Q GH  VV  LL+     + + K     LHIA +  +      L+     A V  K G    +PLH+AA   N    A +LL   A V+ T +N  + LH+AS+ GN  M+K LL  GA      +DG +PLH G R  H  +V+ L+       +KTK+              G + +H A +          +  + +++LL+++  V  +   Y   T LH  A  G+  V   +++      +   N +A NG++PL  A       ++ +LLK+ A +    E G+T +H+AA  GH N+ + L+ H A  N  +  G T LH+AA++G  ++V  L+ ++ A V+A   + +TPLH++A+ G+ ++ + LL      A P AA + G TPLHLAA+  H DV    L     L I  +  G T  H+AA  G L V    ++  KS       KS G T LH+AA   + K+  +LLD GA+P     +G T LH+AAK     +   L    +      + G+  +H+AA  G +D V  +L+   AN+            ++  +SGLTPLHLA+Q    N+  +L+N  G  V++ T   G TPLH     G+  + + LL + S ++  +   G TALH A+  GH  +  + +   A  N     G T L  A + GY+ V   L
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQRE-ANVDAATKKGNTALHIASLAGQAEVVKVLVTN-GANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGF---TPLHIAAHYGN-INVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--------------GLSPLHMATQ---------GDHLNCVQLLLQHNVPVDDVTNDYL--TALHVAAHCGHYKVAKVLLD-----KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG---ASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT-TKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKS-GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN-ANV------------NLSNKSGLTPLHLAAQEDRVNVAEVLVN-QGAHVDAQT-KMGYTPLHVGCHYGNIKIVNFLL-QHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 3 Score: 277.33 bits (708), Expect = 1.970e-74
Identity = 238/796 (29.90%), Postives = 384/796 (48.24%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  +  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    + +++            + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ S+LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G TALH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDTNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACK-KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA----------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLAAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 4 Score: 216.468 bits (550), Expect = 1.004e-55
Identity = 184/587 (31.35%), Postives = 279/587 (47.53%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  +  + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+      V  + K+  T +H+++  G  +    LL++G   +    +G   LH AA+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  SLL+ GAD + + + G + +H+  +  H  +V  L+S              VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++ L  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  251 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNA---KALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 98.2117 bits (243), Expect = 9.555e-20
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV+VN   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V + L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   31 AARAGHLEKALDYIKN--GVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 6 Score: 85.8853 bits (211), Expect = 5.642e-16
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q    +  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNIC-NQNGLNALHLASKEGHVEVVSELLQR-EANV------------DAATKKGNTALHIASLAGQAEVVKVLV-TNGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 268          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 327.405 bits (838), Expect = 1.389e-88
Identity = 254/811 (31.32%), Postives = 401/811 (49.45%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAM-------------MLVNLPNN------EGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEE-TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE++K LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+             +L+   NN       G T +H AA          L+ +    DF                + +++K+LL  D   KI  K  +  TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHL+A  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LLG+++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +   PL  AA   HT +++ LL+N  S  +L  N
Sbjct:   51 AGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLL--DRGAKIDAKTRDGLTPLHCGARSGHE----QVVEMLLDRAAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAAT---TSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHA------------AAKNGYTPLHIAAKKNQMDIATTLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLGRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVN 795          

HSP 2 Score: 281.952 bits (720), Expect = 1.010e-74
Identity = 251/801 (31.34%), Postives = 388/801 (48.44%), Query Frame = 2
Query: 1364 AIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV--PLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLP----NNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEH--KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEM 3736
            A+H+A ++  VE +  L    A ++     G T LHIA+      ++K L +  A+VN       + L+MAA++ H ++V+ L+D      L  + +G T + V    GH +    LL       + +P       LH AA+         LL    N +  +K  +TPLHIA  YGN  V   L+   A V+F     D +PLHVA+   N     ++LL  GA ++   ++G + LH  +RSG+ ++++ LL   A      K+G SPLH+  +  H   VQ L+                N+P     N+  TA+H AA     +         + K+LL+   +   +      TPLH  A   N   ++E+   L+H   IQ V     ++G +P+  A+  GH  IVS L+ + A  +  +  G TALH+AA  G   V   L+   A V AK+K   TPLH++A+ G  D+V++L+ +  A+ +A T +  TPLHL+A+ G ++V   LL H    A       +G TPLH+AAK    +V  L L+ K      A   G+T  H+AA   +  V    +    S     KN   G T LH+AA+     +   LL+ GA+       G+  +HLAA+ GH  ++ +L  + +   +SNKSG+TPLH+AA   +++ V E+L +  A++            D  T+ G TPLH+    G+  +V  LL     +VN+ T  NG TPLH A+Q GHT++ ++LL    S N++T     G TAL  A   G+I +
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN-DITPLHVASKRGNA-NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--------------NVPVDDVTNDYLTALHVAAHCGHYK---------VAKVLLDKKANPNAKA-LNGFTPLH-IACKKNRIKVMEL--LLKHGASIQAVT----ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG-ASPNAATTSGYTPLHLSAREGHEDVAAFLLDHG---ASLSITTKKGFTPLHVAAKYGKLEVANLLLQ-KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN---GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHV------------DAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKT-KNGYTPLHQAAQQGHTHIINVLLQNNASPNELT---VNGNTALGIARRLGYISV 811          

HSP 3 Score: 272.707 bits (696), Expect = 6.911e-72
Identity = 238/796 (29.90%), Postives = 385/796 (48.37%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  K  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    +  ++++A         + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ ++LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G T LH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDNNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACK-KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV----QDGAQVEAKA------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAAT-TSGYTPLHLSAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 4 Score: 212.616 bits (540), Expect = 1.693e-53
Identity = 182/587 (31.01%), Postives = 281/587 (47.87%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  ++ + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+ +    V  + K+  T +H+++  G  +    LL++G   +    +G   LH +A+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  +LL+ GAD + + + G + +H+  +  H  +V  L+               VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++PL  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  268 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNA---KALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 5 Score: 202.986 bits (515), Expect = 1.252e-50
Identity = 196/702 (27.92%), Postives = 313/702 (44.59%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADV-----------------------------NV-LDDMDR---SALHMAAEKGHTKIVELLIDK----------------FKC----------------NVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHY----LIVQELVSFY--------------NKTKSRIDAMML-----VNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKL 2785
            TPL +A ++N L  V  LL+ G + +   +DG T L  A +   + VV LLL      N   G  +   +H+A  +  T +  +  LL+   +A ++  K G   L  A   G+I+    LL          +   +    +H+A ++ +   ++LL D  A+I+ K   G T LH  A    E +++ L    A +                             NV +DD+     +ALH+AA  GH K+ ++L+DK                  C                ++    + G T +HV +  GH      L+  G   +  N  G   LH AA+SG   VV+ L+  GA V A+ KD  TPLHI+ + G   +V+ L+  GA  N        +PLH++A  +  E  A  LL  GA+++ T K G + LH+A++ G LE+   LLQ+ A P    K G +PLH+   Y +     L++ +  S +               K +  I   +L      N    +G  +VH AA+      H      D++ +LL  + +V +  K +  TPLH  A     +V   +VN   H     V+ Q K G++PL    H G+ +IV+ LL+++A+V+   ++G T LH AA++GH ++ NVLL + A  N  +  G T L +A + GY  +V+ L
Sbjct:  142 TPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAAL--LLQNDNNADVE-SKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDIT---PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPN-AATTSGYTPLHLSAR-EGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQ----EGH-----VDMVSLLLGRNANVNLSNK-SGLTPLHLAAQEDRVNVAEVLVNQGAH-----VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 6 Score: 199.904 bits (507), Expect = 1.259e-49
Identity = 161/502 (32.07%), Postives = 248/502 (49.40%), Query Frame = 2
Query: 2543 LFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFK-------PELLINASHD---------------------GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLT-DVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            L A+  GH E     +KN   +++ +++G+ ALHLA+++GH  V + LL  +A V+A +K G T LH+A+  G  ++V+ L+  N A V+A + N  TPL++AAQ    EV + LL +    A    A   G TPL +A +  H  VV L L          P L I A  D                     G T  HIAA  G++ V    +    +V    +N     T LH+A++ G+  +VK+LLD GA    +  DG+T LH  A+ GH  ++E+L  + +  +   K+G++PLH+A     ++ V  +L  +VP               D +T   LT LH+A+  GH  + ++LL  D     +A   NG TPLH A +     V  +LL  G S   +T     G T +H A+  GH+ + +  +  GA  N ++  G T LH AA+SG  +V + LV+ GA  EA+  D Q PL ++A     +++  LL+ 
Sbjct:   46 LRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVT-NGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNG---ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN---DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV--------------DDVTNDYLTALHVAAHCGHYKVAKVLL--DKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTE---SGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ 521          

HSP 7 Score: 85.5001 bits (210), Expect = 5.657e-15
Identity = 74/257 (28.79%), Postives = 122/257 (47.47%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQ-ITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNN 4030
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q +   D  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N
Sbjct:   48 AARAGHLEKALDYIKNGVDINIC-NQNGLNALHLASKEGHVEVVSELLQRE-ANV------------DAATKKGNTALHIASLAGQAEVVKVLV-TNGANVN-AQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATED--GFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGN 280          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 326.635 bits (836), Expect = 1.456e-88
Identity = 248/818 (30.32%), Postives = 398/818 (48.66%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS---------------------------FYNKTKSRIDAMMLVNLPNNEGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE+++ LL  GA  S+  +DG +PL + ++  H  +V  L+                              N T + I++ M+VN     G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHL+A  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+                 ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LL +++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +   PL  AA   HT +++ LL+N  S  +L  N
Sbjct:   51 AGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRAAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAAT---TSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGAS------------PHAAAKNGYTPLHIAAKKNQMDIATSLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVN 803          

HSP 2 Score: 275.789 bits (704), Expect = 6.236e-73
Identity = 242/814 (29.73%), Postives = 387/814 (47.54%), Query Frame = 2
Query: 1433 INMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGIL----DES---PLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            +N+ N  G   LH+A+ EG+ E + + LQ   A+V+       +ALH+A+  G  ++V++L+     NV  + + G T +++ +   H E    LL  G    +  + G   L  A Q GH  VV  LL+     + + K     LHIA +  +      L+      + +  ++     ES   PLH+AA   N    A +LL   A V+ T +N  + LH+AS+ GN  M+K LL  GA      +DG +PLH G R  H  +V+ L          +D    +      G + +H A +          +  + +++LL+++  V  +   Y   T LH  A  G+  V   +++   +      N +A NG++PL  A       ++ +LLK+ A +    E G+T +H+AA  GH N+ + L+ H A  N  +  G T LH+AA++G  ++V  L+ ++ A V+A   + +TPLH++A+ G+ ++ + LL      A P AA + G TPLHL+A+  H DV    L     L I  +  G T  H+AA  G L V    ++  KS       KS G T LH+AA   + K+  +LLD GA+P     +G T LH+AAK     +   L    +      + G+  +H+AA  G +D V  +L+   AN+            ++  +SGLTPLHLA+Q    N+  +L+N  G  V++ T   G TPLH     G+  + + LL + S ++  +   G T LH A+  GH  +  + +   A  N     G T L  A + GY+ V   L
Sbjct:   67 VNICNQNGLNALHLASKEGHVEVVSELLQRE-ANVDAATKKGNTALHIASLAGQAEVVKVLVTN-GANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGN-INVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML----------LDRAAPILSKTKNGLSPLHMATQ---------GDHLNCVQLLLQHNVPVDDVTNDYL--TALHVAAHCGHYKVAKVLLDKKANP-----NAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG---ASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSIT-TKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKS-GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN-ANV------------NLSNKSGLTPLHLAAQEDRVNVAEVLVN-QGAHVDAQT-KMGYTPLHVGCHYGNIKIVNFLL-QHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 3 Score: 273.092 bits (697), Expect = 4.542e-72
Identity = 239/802 (29.80%), Postives = 384/802 (47.88%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQI------NMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA I      N     G T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  +  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    +  ++++A         + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ S+LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G T LH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACK-KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV----QDGAQVEAKA------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLSAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 824          

HSP 4 Score: 134.806 bits (338), Expect = 5.173e-30
Identity = 119/394 (30.20%), Postives = 183/394 (46.45%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSL 2116
            ET L +A +  +   V  L++ G      AKD +T LH +A+    D+V+ LL + A PN    ++   P+HL+ +R G     V + L    ++     K+G   L  A + G +     LL+         K   SG   +H+A    + +   LL D  A  +     G T LHIAA+ N   I   L    AD N +     +++H+AA++GH  +V L                                  LL R   +++ NK+G   LH AAQ   VNV + L+++GA+V+A+TK  YTPLH+   YGN  +V  L+ + A+VN   K G    +PLH AA  +       +LL++ A+ NE   NG +AL IA R G + ++ +L
Sbjct:  475 ETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNA-ATTSGYTPLHLS-AREGHED--VAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK---SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSL----------------------------------LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY---TPLHQAA-QQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 5 Score: 98.9821 bits (245), Expect = 4.928e-19
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV+VN   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V + L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   48 AARAGHLEKALDYIKN--GVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 195          

HSP 6 Score: 84.3445 bits (207), Expect = 1.180e-14
Identity = 86/304 (28.29%), Postives = 131/304 (43.09%), Query Frame = 2
Query: 3167 AAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRT---ALHFASSHGHIEMAALFIGQ--GADI------NASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA  GH +     +  G +    N +G+  LHLA+K GH  ++  L  + +    + K G T LH+A+  GQ + V  ++T+  AN+ ++            +++G TPL++A+Q  H  +VR LL+ +G   + AT + G TPL  A Q GH  V S+LL          D KG+    ALH A+     + AAL +     ADI      N +   GFTPLH                                 +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNG-ANVNAQ------------SQNGFTPLYMAAQENHLEVVRFLLD-NGASQSLATED-GFTPLAVALQQGHDQVVSLLL--------ENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLH---------------------------------IAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 293          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 325.479 bits (833), Expect = 1.939e-88
Identity = 261/834 (31.29%), Postives = 410/834 (49.16%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVV-------NKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNK---SGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            + L  A  GN +  L +L++ + D+N  +    + LH+A+++GH K+V  L+ K +  + T  K+GNT +H+ +++G  E    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN N  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GA+VN T +NG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  I + L          +D    +      G + +H AA+          +  D +++LL+YD ++   T     TPLH  A  G+            H++  V+       N +A NG++PL  A    H  ++ +LLK  A +D   E G+T LH+A+  GH  +   LL   A  N  +    TPLH+AA+ G+ ++ + L+ +NKA V+A   + +TPLH AA+ G   + + LL +    A+P  A + G TPLH+AA+  H + V L L  K       +  G T  H+AA  G + V +  +  +       KN   G T LH+A    +  +VK+LL  G +P     +G T LH+AAK      +EV +  + +   +N     G+TPLH+AA  G  + V  +L+              +   ++  +SGLTPLHL +Q GH  +  +L+   GV V+ AT   G TPLH AS  G+  +   LL   ++ +  +   G + LH A+  GH ++  L +  GA  N   + G TPL  A + GY+ V  +L
Sbjct:   15 SFLRAARSGNLDKALDHLRNGV-DINTCNQNGLNGLHLASKEGHVKMVVELLHK-EIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEIL----------LDHGAPIQAKTKNGLSPIHMAAQ---------GDHLDCVRLLLQYDAEIDDIT-LDHLTPLHVAAHCGH------------HRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENN---ANPNLATTAGHTPLHIAAREGHVETV-LALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN---GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ---VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK-------------QANGNLGNKSGLTPLHLVAQEGHVPVADVLIK-HGVMVD-ATTRMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 2 Score: 321.242 bits (822), Expect = 3.411e-87
Identity = 259/809 (32.01%), Postives = 402/809 (49.69%), Query Frame = 2
Query: 1643 RDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGES-----------------------------ALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEE-TPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            R+ +  T     + SG+ +  +  LR GV ++  N+ G   LH A++ GHV +V  LL K   +   TK   T LHIA   G   VV  L+ YGA VN +   G    +PL++AA  +N  +  + LL++GAN N   ++G +                             ALHIA+R+ +      LLQ   +P ++ K G +PLHI   Y +  + Q L+   N+  S       VN     G T +H A+              ++I + L  D   +I+TK  +E TPLH CA       + EI   L+H     +  + KNG SP+  A+   H + V +LL+ +A +D      +T LH+AA  GH  VA VLL   A  N+++  G TPLH+A +  +  ++E L+ +  A++DA+T +  TPLH+A+  G   + ++LL      A P  ++ + +TPLH+AA+  H++V +  L+ K +  +NA + D  T  H AA  G   ++K  +  N +      N +T  G T LH+AA  GH + V  LL+  A+ A     G T LH+AAKYG   + E+L  + +    + K+G+TPLHVA H+  +D V  +L           P+ G         +G TPLH+A++     + R LL   G    +A +  G TPLH A+Q GH  + ++LL K +N     +  G T LH  +  GH+ +A + I  G  ++A+  MG+TPLH A+  G +K+ K L++  A   A+T     PL  AA   HT++++ LL+N  S
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGF---TPLYMAA-QENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLL---NRGAS-------VNFTPQNGITPLHIAS-----------RRGNVIMVRLLLDRGAQIETKTKDELTPLH-CAARNGHVRISEI--LLDHGAP--IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL-KTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG---ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK--VNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-----PNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL-----------PRGGSPHSPAW--NGYTPLHIAAKQNQVEVARSLLQYGGSA--NAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 759          

HSP 3 Score: 311.997 bits (798), Expect = 2.647e-84
Identity = 262/807 (32.47%), Postives = 411/807 (50.93%), Query Frame = 2
Query: 1238 DKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRF--KPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            ++ G   L  A + G +  + ELL  E   +T  KK   G+ A+HIA      E +R L +  A +N ++  G T L++AA+ N   ++K+L    A+ NV  +   + L +A ++GH  +V  LI     N  T+ K     +H+ + +    T   LL+      + +KTG   LH AA   ++NV + LL++GA+VN   ++  TPLHIA + GN  +V  L+  GAQ+  K    DE +PLH AA  +NG  + +E+LL  GA +    KNG S +H+A++  +L+ ++ LLQ  A+   I  D  +PLH+     H+ + + L+    K  SR      +N     G T +H A     K+ H       ++++LL+    +   T+ +  TPLH  +  G+  +   + N L+      V+       +PL  A+  GH E+   LL+N A+V+   +   T LH AA  GH N+  +LL + A  N  +  G TPLH+AA+ G+ + V  L+ E +A+   +T    TPLH+AA+YG+  V   LL      A P AA   G TPLH+A  +++ D+V+L L     P    + + +G T  HIAA    + V +  +++  S          G T LHLAA+ GH ++V +LL   AN    N  G+T LHL A+ GH  + +VL         + + G TPLHVA+HYG I  V + L    A++ ++            T+ G +PLH A+Q GH ++V LLL  +G   N  + ++GTTPL  A + G+ +VT +L
Sbjct:   42 NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKK---GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETK--TKDELTPLHCAA--RNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-----LN-----GFTPLHIAC----KKNH-----VRVMELLLKTGASIDAVTE-SGLTPLHVASFMGHLPI---VKNLLQRGASPNVSNVKVE--TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL-EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERD---AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH---SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSAN---AESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLV-KFLLQHQADVNAK------------TKLGYSPLHQAAQQGHTDIVTLLLK-NGASPNEVS-SDGTTPLAIAKRLGYISVTDVL 786          

HSP 4 Score: 274.248 bits (700), Expect = 1.288e-72
Identity = 232/806 (28.78%), Postives = 400/806 (49.63%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCL-PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHD-GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK---PKISFRVVSNKSGMT 3352
            L LA K+  +  V  LL   +      K G TALH AA    ++VV+ L+   A  N+   S K   P+++A          V+  L    + +    ++G   L  A++ G  + +  L+    + +  +        A+HIA R  D     +L   +   ++ +  G T LHIAA   +  + + L +  A VN       + LH+A+ +G+  +V LL+D+    + T+ K+  T +H  + +GH   +  LL  G P+    K G   +H AAQ  H++ V+ LL   A ++  T D  TPLH+A   G+  V + L+  GA+ N +  +   +PLH+A   KN  +  E+LLK+GA+++   ++G + LH+AS  G+L ++K+LLQ GA P++      +PLH+  R  H  + + L+   NK K        VN    + +T +H AA +           T+++K+LLE + +  + T     TPLH  A  G+ + +L +   LE +         K G++PL  A+  G   +  +LL+ +A  +   ++G+T LH+A    + ++  +LL      ++ +  G TPLH+AA+    ++   L+ +   + +A ++   TPLHLAAQ G  E+   LL  +   A+    +  G TPLHL A+  H  V  + ++    ++++A+   G T  H+A+  G++ ++K  ++    V    K    G + LH AA+ GH  +V +LL  GA+P E ++DG T L +A + G+  + +VLK    + SF +VS+K  M+
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGA--NVNAQSQKGFTPLYMAAQENHLE---VVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRL-------PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACK-KNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ--NKAK--------VNAKAKDDQTPLHCAARIGH---------TNMVKLLLENNANPNLATT-AGHTPLHIAAREGHVETVLAL---LEKEASQAC--MTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLL-QYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQ---ANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHG--VMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTK---LGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMS 805          

HSP 5 Score: 246.899 bits (629), Expect = 3.004e-64
Identity = 229/718 (31.89%), Postives = 345/718 (48.05%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFG--GSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLR--FKPELLINASHDGMTCGHIAAANGSLAV 3085
            TPL +A ++N L  V  LLE G N N   +DG T L  A +   E+VV  L+        +G  G  +   +H+A     T +  V  LL+   +  + + K G   L  A    +++  + LL        N   + +G   +HIA R+ +V  +RLL D  AQI  K     T LH AA      I + L    A +        S +HMAA+  H   V LL+ ++   +     +  T +HV +  GH      LL +G   +     G   LH A +  HV V++ LL  GA+++A T+   TPLH+A   G+  +V+ L+  GA  N    +  E+PLH+AA   + E  A+ LL++ A VN   K+ ++ LH A+R G+  M+K LL+  A+P++    G++PLHI  R  H   V+ +++   K  S+  A M       +G T +H AA+  + R         + ++LLE D       K    TPLH      N    L+IV  L  +     +  A NG++PL  A+     E+   LL+     +     G+T LHLAA++GH  +  +LL  +A  N  +K GLTPLHL AQ G+  + + LI ++   VDA T    TPLH+A+ YG  ++ + LL H+   AD  A    G +PLH AA+  H+D+V L L+    P      S DG T   IA   G ++V
Sbjct:  113 TPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAV--LLQNDPNPDV-LSKTGFTPLHIAAHYENLNVAQLLLNRGA--SVNFTPQ-NGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL-QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVS-NVKVETPLHMAARAGHTE-VAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGH---VETVLALLEKEASQ--ACM-----TKKGFTPLHVAAKYGKVR---------VAELLLERDAHPNAAGK-NGLTPLHVAVHHNN----LDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-KHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ---ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN---EVSSDGTTPLAIAKRLGYISV 782          

HSP 6 Score: 152.525 bits (384), Expect = 2.032e-35
Identity = 144/490 (29.39%), Postives = 226/490 (46.12%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKT-------KSRID----AMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEY 2380
            TPL +ACK N +  ++ LL+ G + + V + G T LH A+      +VK LL + A PN+     +  P+H+A     T     +   KA  +A+ + D+     L  A   G  + +K LL  E     N+    +G   +HIA R+  VE +  L +  A        G T LH+AA+     + + L    A  N       + LH+A    +  IV+LL+ +   +  +    G T +H+ +     E   SLL+ G   +  +  G   LH AAQ GH  +V  LL K AN N   K   TPLH+  + G+  V + LI +G  V+     +  +PLHVA+   N  K  + LL+  A+VN   K G S LH A++ G+ +++  LL+ GA P+ +  DG +PL I  R  +  +   L    ++T       K R+        ++++  +EGE  + F AE        D  D D  K LL++
Sbjct:  373 TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQ---TPLHCAARIGHTNMVKLLL--ENNANPNLATT-AGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTR-MGYTPLHVASHYGN-IKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAE------RRDSRDVDEEKELLDF 846          

HSP 7 Score: 142.895 bits (359), Expect = 1.846e-32
Identity = 121/416 (29.09%), Postives = 199/416 (47.84%), Query Frame = 2
Query: 2912 DPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAP 4072
            D    +  G   LHLA+K  H  +V + L  K  +L   +  G T  HIAA  G   V++E + +  +V         G T L++AA+  H ++VK LL+ GAN      DG T L +A + GH +++  L     K K+                            V +K+G TPLH+AAHY  ++ V ++L +  A++            +   ++G+TPLH+AS+ G+  +VRLLL+  G ++ + T +   TPLH A++NGH  ++ ILL   +  I  +   G + +H A+   H++   L +   A+I+       TPLH AA  G+ +V K+L+++GA   +   +   PL +A   NH  VM  LL+   S   + E+   L  L + S + +   V+  +    +P
Sbjct:   37 DINTCNQNGLNGLHLASKEGHVKMV-VELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVN---AQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLN-VAQLLLNRGASV------------NFTPQNGITPLHIASRRGNVIMVRLLLD-RGAQIETKTKDE-LTPLHCAARNGHVRISEILLDHGA-PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESG--LTPLHVASFMGHLPIVKNLLQRGASP 430          

HSP 8 Score: 132.494 bits (332), Expect = 2.845e-29
Identity = 104/332 (31.33%), Postives = 168/332 (50.60%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN 1936
            ETPL +A +         LL+     N  AKD +T LH AA+    ++VKLLL   A+PNL   +    P+H+A +R G    TV++LL+  ++++  M K+G   L  A + G +   + LL+ +       K   +G   +H+A    +++ ++LL       +     G T LHIAA+ N   + + L       N       + LH+AA++GH ++V LL+ K + N    +K G T +H+ +  GH      L++ GV +    + G   LH A+  G++ +VK LL   A+VNA+TK  Y+PLH A + G+  +V  L+  GA  N
Sbjct:  438 ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL-ATTAGHTPLHIA-AREGHVE-TVLALLE-KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGK---NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK-QANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN 761          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.105e-87
Identity = 246/810 (30.37%), Postives = 398/810 (49.14%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAE---------LVQKRKHSDFE---------------DTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            +GH E  +  ++ GV +++ N+ G   LH A++ GHV VV  LL + ANV+A TK   T LHIA   G   VV+ L+                                    +GANVN   +NG + L++A++  +LE+++ LL  GA  S+  +DG +PL + ++  H  +V  L+    K K R+ A+ +                    ++ +  G T +H AA          L+ +    DF                + +++K+LL+    +  +T+    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL++N  VD      +TALH+AA  GH  VA VLL  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G   +   L++H    A P   + RG+T LH+AA++  ++VVR  ++   ++   A  D  T  HI+A  G   ++++ ++   S        ++G T LHLAA  GH  +   LLD GA+ +     G T LH+AAKYG   +  +L  K +    + KSG+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++    ++   LL   G + N+ T   G   +H A+Q GH ++ S+LL +++N +   +  G T LH A+    + +A + + QGA ++A   MG+TPLH     G +K+   L++  A   A+T +    L  AA   HT +++ LL+N  S  +L  N
Sbjct:   34 AGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTR-DGLTPLHCGARSGHE----QVVEMLLDRSAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG---ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAA---TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDN-QKVALLLLDQGASPHAA------------AKNGYTPLHIAAKKNQMDIATSLLEY-GADANAVTRQ-GIASVHLAAQEGHVDMVSLLLSRNAN-VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVN 778          

HSP 2 Score: 283.878 bits (725), Expect = 1.506e-75
Identity = 254/843 (30.13%), Postives = 399/843 (47.33%), Query Frame = 2
Query: 1343 KKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI--GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS----FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            KK   +A+   A R   +E           +N+ N  G   LH+A+ EG+ E + + LQ   A+V+       +ALH+A+  G  ++V++L+     NV  + + G T +++ +   H E    LL  G    +  + G   L  A Q GH  VV  LL+     + + K     LHIA +  +      L+     A V  K G    +PLH+AA   N    A +LL   A V+ T +N  + LH+AS+ GN  M+K LL  GA      +DG +PLH G R  H  +V+ L+       +KTK+              G + +H A +          +  + +++LL+++  V  +   Y   T LH  A  G+  V   +++      +   N +A NG++PL  A       ++ +LLK+ A +    E G+T +H+AA  GH N+ + L+ H A  N  +  G T LH+AA++G  ++V  L+ ++ A V+A   + +TPLH++A+ G+ ++ + LL      A P AA + G TPLHLAA+  H DV    L     L I  +  G T  H+AA  G L V    ++  KS       KS G T LH+AA   + K+  +LLD GA+P     +G T LH+AAK     +   L    +      + G+  +H+AA  G +D V  +L+   AN+            ++  +SGLTPLHLA+Q    N+  +L+N  G  V++ T   G TPLH     G+  + + LL + S ++  +   G TALH A+  GH  +  + +   A  N     G T L  A + GY+ V   L
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQRE-ANVDAATKKGNTALHIASLAGQAEVVKVLVTN-GANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGF---TPLHIAAHYGN-INVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--------------GLSPLHMATQ---------GDHLNCVQLLLQHNVPVDDVTNDYL--TALHVAAHCGHYKVAKVLLD-----KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV-QDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQG---ASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT-TKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKS-GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN-ANV------------NLSNKSGLTPLHLAAQEDRVNVAEVLVN-QGAHVDAQT-KMGYTPLHVGCHYGNIKIVNFLL-QHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 3 Score: 277.33 bits (708), Expect = 1.599e-73
Identity = 238/796 (29.90%), Postives = 384/796 (48.24%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK-FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-------SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+   N +   K G TALH A+     +VVK+L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +A  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+     D + LH+A+++G+  +V+LL+D+  K +  TRD  G T +H  + SGH +    LL R  P+    K G   LH A Q  H+N V+ LL     V+  T D  T LH+A   G+  V + L+   A  N K  +   +PLH+A   KN  +  E+LLK GA++    ++G + +H+A+  G++ ++  L+  GA P+     G + LH+  R     +V+ LV    + +++            + +T +H +A L +          DI++ LL+        T  +  TPLH  A  G+ DV       L+H   L +    K G++PL  A+  G  E+ S+LL+ +A  D   + G+T LH+AA   ++ VA +LL   A  +A +K G TPLH+AA+    D+   L+ E  A  +A+T      +HLAAQ G  ++   LL      A+   ++  G TPLHLAA+ D  +V         E+L+N        +  G T  H+    G++ ++   ++ +  V    KN   G TALH AA+ GH  ++ VLL   A+P E   +G T L +A + G+  +++ LK
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKAAALLLQNDTNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACK-KNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA----------KDDQTPLHISARLGK---------ADIVQQLLQQGASPNAATT-SGYTPLHLAAREGHEDV---AAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL-EYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRN---ANVNLSNKSGLTPLHLAAQEDRVNVA--------EVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN---GYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 4 Score: 216.083 bits (549), Expect = 8.645e-55
Identity = 184/587 (31.35%), Postives = 279/587 (47.53%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFED-TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNF-LEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVL 2686
            D TPL +A K      V  LL+ G   +   +DG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K LL  +        K  +G   +HIAC+K  +  + LL    A I      G T +H+AA      I+  L    A  N  +    +ALHMAA  G  ++V  L+      V  + K+  T +H+++  G  +    LL++G   +    +G   LH AA+ GH +V   LLD GA+++  TK  +TPLH+A KYG   V   L+   A  +  G  G+   +PLHVAA   N +K A +LL  GA+ +   KNG + LHIA++   +++  SLL+ GAD + + + G + +H+  +  H  +V  L+S              VNL N  G T +H AA+          ED  ++ ++L+     V  QTK    TPLH     GN    ++IVNF L+H  +  VN + KNG++ L  A+  GH  I+++LL+NNA  +    +G TAL +A   G+ +V + L
Sbjct:  251 DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNA---KALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGL---TPLHVAAHYDN-QKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNAN----------VNLSNKSGLTPLHLAAQ----------EDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGN----IKIVNFLLQHSAK--VNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 5 Score: 98.2117 bits (243), Expect = 6.445e-19
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query: 3503 ASQSGH-ENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            A+++GH E  +  + N  GV+VN   N NG   LH AS+ GH  V S LL + +N +     KG TALH AS  G  E+  + +  GA++NA    GFTPL+ AA+  +L+V + L++ GAS    T D   PL +A    H +V+S LL N
Sbjct:   31 AARAGHLEKALDYIKN--GVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREAN-VDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 6 Score: 85.8853 bits (211), Expect = 3.998e-15
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ GH    L+ +K  +   +  N++G+  LH+A+  G ++ V E+L    AN+            D  T+ G T LH+AS +G   +V++L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q    +  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +      ND  +  L + SK  N   V+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNIC-NQNGLNALHLASKEGHVEVVSELLQR-EANV------------DAATKKGNTALHIASLAGQAEVVKVLVT-NGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARND--ITPLHVASKRGNANMVK 268          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q505D1|ANR28_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus OX=10090 GN=Ankrd28 PE=1 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 2.952e-86
Identity = 282/947 (29.78%), Postives = 434/947 (45.83%), Query Frame = 2
Query: 1367 IHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS-----------------------FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFA-SHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHR----------------------------NVANVLLLHKAF-----------------VNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAA----DSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLK---NKSTGSTALHLAAEGGHHKLVKVLLDAG----ANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGAD---INASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEA-ETNDFQIPLILAAHFNHTEVMSFLL 3949
            +H A      EA+++L   +A +N ++   QT LHIAA        + L   +++VNV D   R+ALH AA  GH ++V+LL+ +   N+   DK+    +H  +  GH E    L+  G  +   +K     LHAAA SG ++VVK LLD G ++N       TPLH+A   G   VV  LI  GA VN K   G    +PLH AA + +G  C E+L+ +GA+VN   K+G++ LH+ +  G     ++++Q GA      K+GN+PLHI  RY H L++  L++                       F +  +  + +   ++ P++ G T +H AA        +   +T           D   + K+   +PLHY A   N   L  +V          VN   + G +PL +A + +   + +  LL+N+A   + D+ G  A+H +A  GHR                            N A +  LH A                  ++ ++  G TPL LAA  G+ + V+ LIN+  + +    + ++TP+H AA  G  E  R L    I  A+P+ A    D  GQTPL L+  N H+D V   L  K   +      G T  H  A  G    +   ++      HG K     S G T +HL+A  GH  ++  LL +     ANPA  +N G T LH A   GH   +E+L  +  F+ + + +  +PLH A      +   EML D            G  + +     G TPLH A+ + H   ++LLL+    +VNSA ++ G TPL  A++NG TN   +L+  +S  +T +D    TALH A   GH   A L + +  D   INA++    TPLH AA++G   V + L+ +GAS  A + N +   L  A + +  + ++ +L
Sbjct:   78 LHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSR-GANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGF---TPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTG---------ADFNKKDKFGR-SPLHYAAANCNYQCLFALVGS-----GASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLL----IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLN-KGANVDAKDKWGRTALHRGAVTGHEECVDALLQ------HGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKI-DGNAFSPLHCAV-INDNEGAAEMLID----------SLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLS-QNAQVNSA-DSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          

HSP 2 Score: 250.366 bits (638), Expect = 1.671e-66
Identity = 257/882 (29.14%), Postives = 398/882 (45.12%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETI-LKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLL-------RRGV----PLHM----------------------PNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE---SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGN---LEMLKS-----LLQEGADPSIICKDGN----SPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKL------INENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHD-GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLL-DAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVV---SNKSGMTPLHVAAHYGQIDFVGEML 3406
            +TPL +A  +  +   + L+ +  N N   + GRTALH+AA     ++VKLLL++ A+ N F    +   IH A          V+ LL +  +     DK+    L  A  +G IS +K LL    +   N    Y G+  +H+AC       +  L D  A +N KN  G T LH AA      + L+ L    ADVN+     ++ LHM A  G     + +I      +   DK GNT +H+ +  GH     +L+       +RG+    PLH+                      P+  G  CLHAAA  G++  +  LL+ GA+ N + K   +PLH A    N   +  L+G GA VN     LDE   +PLH AAT+    KC E LL++ AN     K G +A+H ++  G+   L+++ S     +L E +   ++    N    SPLH+   + H+  ++ LV           +++ +++ N+ G T +  AA     + H      + + +L+     + ++    + TP+H  AT G+S+ L  ++   E   Q  V+ Q  NG +PL+ +  NGH + V  LL   A VD  D+ G TALH  A  GH    + LL H A    +   G TP+HL+A  G+  ++  L      ++ N A VD    +  T LH A   G +     LL   ++    +  D    +PLH A  ND+     + +      ++NA+   G T  H AA    +  ++  +  N  V       STG T L +AAE G    V++L+  A A+   ++    T LHLA   GH     ++  KI+ R +   +N +  TPLHVAA  G    V E+L
Sbjct:  108 QTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDR-RAIHWAAYMGHIE---VVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDM--NEPNAY-GNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAV-IDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVN----DLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQ----------SLLDLDVRNSSGRTPLDLAA----FKGH-----VECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAE--PQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDN---HGYTALHWACYNGHETCVELLLEQDVF----QKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSA---DSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELL 946          

HSP 3 Score: 243.432 bits (620), Expect = 2.992e-64
Identity = 231/813 (28.41%), Postives = 370/813 (45.51%), Query Frame = 2
Query: 1682 ISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGW--SPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL-HKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHD-GMTCGHIAAANGSL----------AVIKEFMRFNKSVIHGLKNKST--------------------GSTALHLAAEGG-HHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSG------------MTPLHVAAHYGQ---IDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKS--SNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
             +G P+   +L+ +   ++  +      LHAAA  G   +++ L+  GA VNA+     TPLH AV   +   V+ L+ + A VN +     ++PLH+AA  K   KCAE L+   +NVN + + G +ALH A+ SG+ EM+K LL  GA+                           ++ ++K   R                A+H+AA +            +++K+L+ +  +V  + K +  TPLH  A++G    ++ +V +L   + L V+    N +  +PL  A +NG   +V+ L+   A V+  +E G T LH AA   H  +   LL+ + A VN KSK G TPLH+ A +G     + +I ++ A +D    N  TPLH+AA+YG + +  +L+      AD       G  PLHLAA +  SD  R  L    +  I+   D G TC H AAA G+L          A   +  +F +S +H                           G T LH AA      K ++ LL   ANP   +  G   +H +A YGH   L+++  +    V+   SG            ++PLH+AA++G    ++ + + L D+                DV   SG TPL LA+  GH   V +L+N  G  +         TP+H A+ NGH+    +L+G +   N +  +D  G+T L  +  +GH +     + +GA+++A D  G T LH  A +G+ +    L++ GA C    +  + P+ L+A   H  V+  LL++  S
Sbjct:   17 FNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNW-QTPLHIAAANK-AVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGAN---------------------------INAFDKKDRR----------------AIHWAAYMGH---------IEVVKLLVSHGAEVTCKDKKSY-TPLHAAASSG----MISVVKYL---LDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTII-QSGAVIDCEDKNGNTPLHIAARYGHELLINTLI---TSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFD--IDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDL----------------DVRNSSGRTPLDLAAFKGHVECVDVLIN-QGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATS 744          

HSP 4 Score: 234.572 bits (597), Expect = 2.255e-61
Identity = 252/865 (29.13%), Postives = 394/865 (45.55%), Query Frame = 2
Query: 1553 DRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNS--PLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIV--NFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLIN-ASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVK---------VLLDAGANPAEENNDG---MTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLL-NCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIK--LIENDKF------LFDLMICSKLNNFKSVEEFILLS 4063
            D+ +L  A   G    V  LI K K +V  +D E  T +H  +  G  E    L+  G  ++  +      LH A  S     V+ LL   A+VNAR K+  TPLHIA         E+L+   + VN   + G    + LH AA + +GE   ++LL  GAN+N   K    A+H A+  G++E++K L+  GA+  + CKD  S  PLH         +V+ L          +D  + +N PN  G T +H A    Q           ++  L++   +V  Q      TPLH+ A + +  + LE++  N  +      VN ++K+G +PL   + +G       ++++ A +D  D++G T LH+AA  GH  + N L+   A    +   G+ PLHLAA +G+ D   KL++     +D      +T LH AA  G  E    L       AD    D  G++PLH AA N   +   LF        +N     G T  H AA + +     E++  N +   G+++K  G  A+H +A  GH   ++         VL++        ++D    ++ LHLAA +GH   LEVL   +    V N SG TPL +AA  G ++ V ++L +  A+I          +KD + +   TP+H A+ +GH   +RLL+ N +        + NG TPL  +  NGHT+    LL K +N +  +D  GRTALH  +  GH E     +  GA     D+ G TP+H +A  G++ V   L++   S +A       P ++  H      + +   N H T    L+E D F       F  + C+ +N+ +   E ++ S
Sbjct:    8 DQPSLVQAIFNGDPDEVRALIFK-KEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAG---RTALHHAAFSGHGEM-VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAE--VTCKDKKSYTPLHAAASSGMISVVKYL----------LDLGVDMNEPNAYGNTPLHVACYNGQDV---------VVNELIDCGANVN-QKNEKGFTPLHFAAASTHGALCLELLVGNGAD------VNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSG-FDIDTPDDFGRTCLHAAAAGGNLE---CLNLLLNTGADFNKKDKFGRSPLHYAAAN--CNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANP-GIRDKQ-GYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECV-DVLINQGASI---------LVKDYVLKR--TPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGAN-VDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDAN------PAVVDNHG--YTALHWACYNGHETCVELLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDS 810          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JZM7 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Lingula unguis OX=7574 GN=LOC106177569 PE=3 SV=1)

HSP 1 Score: 1572.37 bits (4070), Expect = 0.000e+0
Identity = 806/1596 (50.50%), Postives = 1083/1596 (67.86%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFL-EHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXX-XXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXI-NPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVP-------------GVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAA-----LKNEEDKLEN---------------------------VVNWNVIVRRYLSIRNV 5473
            +  +LC KG+W  +E +LR+  K  P     D +T  TPLM+A K+N+L+ V+RL+++GV  ND AKDGRT +H+AA +A +D++KLL+ KKAD  + GG  + LP+H+AC+R+  +   V  LLK + K  RL  DK+G+I +  + E G+++  KE L  + EQQ   +++ +GD  +H+ACR+KDV+  +L  +  A  +++N  G T LHI+A   DE ++KYL    A+ N+ D MDRS LH+AAE+G+T +VELL+DKFK NV  R K+G+TLMH+ S  GHP+T ++ L++GVPLHMPNK G+VCLHAAA+ GH  VV++LL KGA V+ARTKD YT LHIAV+   P VV+TL+G+GAQV  KGG+  E+PLH+AA T  GEKCAEML+KSGANVN   +NGE+A+HIA+R G ++M+ +LL+EG DP    K G +PLH+ VR+CH+ +  EL+ F    KS IDA+MLVN  N EGET VH+AAE+ +   H +FED D+IK++LEY+GD   QT+ T ETPLHYC+ AGN D+LLE+V  L  +++QL VNKQAKNGWSPLL A   GH +IV IL++N+ARVDVFDEHG  ALHLAAE GH  VA+VLL HKAFVNAKSK G+TPLHLAAQNG   LV+ LI  + AT+DAL+L +KTPLH+AAQ G+ EVC + L  K   AD  A D  GQTPLHLAA+NDHSDVV+LFL+ KPEL+  A+ +GMTC HIAA+ GS+ VIKE MRFNK V+   +N++  STALHLAAEGGH ++V+VLL+AGA+  +EN +GMT +HL+AK+GH H+L+ LK  + F V S K+G+T LHVAAHYGQ DFV E LT +PA + SE P +   +KDV  ESGLTPLHLASQSGHE LVRLLLN  GV+ ++AT   G+ PLH A+QNGHT+V S+LL KS++QI  +D +GRT LH +++HGH +M AL +GQGADIN  D  G+TPLH+AAK+GYLKV KLL+E GA+ + E+ + ++P+  AA  NHTEV+S+L++  H+T  L+++ KF+FDLM+C K NN +S++EFI LSPAP + AAK+S  F  L+ +EKERS+DL+    +C+ M T+L A+A+  NGA  LLKSVD  G  FLDILIE EQKEV+SHP +Q+YLSDVW G+L W  WK+ +   L LI P  W    LP+  +    PL+KFM YL+SH YL  L     +   YP ++  + +      LL+     L+   + NP DR  +  +K  ++      ++V  L+F          +Y+RNQ  + A   C ++ LDFLS HHLFGPW IIIRDLM DL +F+VIL  F+L F   L A +QP+     SN                 +     L+F+LFG   P  LP    +P + + L ++VFG  +++T+IVLINLLIAMM++TY+ IQA+SD EWK+GRAKLIRNM +TS  PSP NL T+LI Y  K+ Y+ + +    E   +   H  E+L  D  A     L+N +  L N                           V++W  +V +YL + N+
Sbjct:   48 RVYNLCQKGDWSVLEQVLRTLEKGSPEAACSDEDTGITPLMVAVKENKLVIVERLIDLGVGLNDRAKDGRTVMHFAASYARDDIMKLLINKKADATIPGGPKEQLPLHMACARSSGALAIVQMLLKVSGKDCRLVEDKDGSIPIFLSSEVGNVAVCKECLTQQTEQQIKYQRRGNGDNLMHVACRRKDVDLAKLFVEYGANFDVQNYEGHTPLHISAWEGDEAMMKYLYQAKANPNITDQMDRSPLHIAAERGNTSVVELLVDKFKANVAARTKDGSTLMHIASECGHPDTALTFLKKGVPLHMPNKAGAVCLHAAAKRGHTAVVRSLLQKGAQVDARTKDNYTALHIAVEACRPLVVQTLLGFGAQVELKGGLAQETPLHIAARTSEGEKCAEMLIKSGANVNSIQENGETAMHIAARYGLIKMVIALLEEGGDPCWQSKLGETPLHVSVRHCHWDVADELLRFVATEKSHIDAVMLVNQQNTEGETCVHYAAEITKNMCHREFEDVDVIKLMLEYNGDTNTQTRMTHETPLHYCSRAGNEDILLEMVRHLGPNRVQLAVNKQAKNGWSPLLVACEQGHLDIVKILMQNHARVDVFDEHGKAALHLAAENGHDEVADVLLWHKAFVNAKSKLGVTPLHLAAQNGCNKLVKLLIETHGATIDALSLAKKTPLHMAAQNGQMEVCSTFLKMK---ADANATDVHGQTPLHLAAENDHSDVVKLFLKHKPELVTMANTNGMTCAHIAASKGSVGVIKELMRFNKMVVTTARNRTNNSTALHLAAEGGHVEVVQVLLEAGASATDENAEGMTAIHLSAKHGHVHILDALKGHVDFAVTSAKTGLTALHVAAHYGQADFVRETLTSIPATVTSEAPDSETGLKDVTAESGLTPLHLASQSGHEGLVRLLLNSPGVQADAATKVQGSIPLHMAAQNGHTSVVSLLLSKSTSQIHVKDKRGRTGLHLSAAHGHYDMVALLLGQGADINVYDKNGWTPLHFAAKAGYLKVVKLLIESGAAPKYESKEGKVPICYAAAMNHTEVVSYLMKRDHNTQHLMDDKKFVFDLMVCGKTNNNRSIQEFITLSPAPVDTAAKMSKNFALLAIREKERSRDLLHAGAYCEKMATELMAIASGTNGASALLKSVDCRGTPFLDILIENEQKEVVSHPTIQKYLSDVWKGNLKWNTWKVVMVFTLFLIVPPVWVYFSLPLRNRYNKVPLIKFMSYLVSHFYLIILFIMTTVAPIYPIFQSGSLIPHWYEWLLLAWLSGLLVSELTNPGDRAGLGWIKVFVIAVSALGIVVHLLAFAFNEDERYVCLYVRNQFFALALLFCFVLLLDFLSFHHLFGPWAIIIRDLMKDLIRFLVILLAFMLGFTLHLSAIYQPVYPPQVSNSSIGQGNGGGGAKSLTPIDTFELLFFSLFGLIEPDTLPTIAQSPDWTINLVKSVFGAYMLVTLIVLINLLIAMMSDTYQRIQAQSDVEWKFGRAKLIRNMNRTSATPSPLNLFTKLITYC-KVAYKHKGKICSAE--AQSYIHEEEDLNEDYDARSVDLLQNNQVMLRNMMRRNTQVAPESYLRAPQQRGPQCIDDVIDWQFVVHKYLEVNNL 1637          

HSP 2 Score: 119.013 bits (297), Expect = 9.890e-23
Identity = 125/494 (25.30%), Postives = 213/494 (43.12%), Query Frame = 2
Query: 2402 TKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGG---LTPLHLAA--QNGYKDLVEKLIN-ENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFM--RFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDA-GANPAEENNDGMTCLHLAAKYGHFHL-LEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVE 3853
            T  T  T ++     G+  VL +++  LE             G +PL+ A       IV  L+     ++   + G T +H AA     ++  +L+  KA  +A   GG     PLH+A    +G   +V+ L+    K        +   P+ L+++ G   VC+  L  +            G   +H+A +    D+ +LF+ +     +  +++G T  HI+A  G  A++K     + N ++   +       + LH+AAE G+  +V++L+D   AN A    DG T +H+A++ GH    L  LK  +    + NK+G   LH AA  G    V  +L            + G Q+ D  T+   T LH+A ++    +V+ LL   G +V         TPLH A++       + +L KS   +      G TA+H A+ +G I+M    + +G D      +G TPLH + +  +  V   L+ 
Sbjct:   41 TATTVNTRVYNLCQKGDWSVLEQVLRTLEKGSPEAACSDEDTGITPLMVAVKENKLVIVERLIDLGVGLNDRAKDGRTVMHFAASYARDDIMKLLINKKA--DATIPGGPKEQLPLHMACARSSGALAIVQMLLKVSGKDCRLVEDKDGSIPIFLSSEVGNVAVCKECLTQQTEQQIKYQRRGNGDNLMHVACRRKDVDLAKLFVEYGANFDVQ-NYEGHTPLHISAWEGDEAMMKYLYQAKANPNITDQMDR-----SPLHIAAERGNTSVVELLVDKFKANVAARTKDGSTLMHIASECGHPDTALTFLKKGVPLH-MPNKAGAVCLHAAAKRGHTAVVRSLL------------QKGAQV-DARTKDNYTALHIAVEACRPLVVQTLLGF-GAQVELKGGLAQETPLHIAARTSEGEKCAEMLIKSGANVNSIQENGETAMHIAARYGLIKMVIALLEEGGDPCWQSKLGETPLHVSVRHCHWDVADELLR 511          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267FPR4 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014653g1 PE=3 SV=1)

HSP 1 Score: 1571.21 bits (4067), Expect = 0.000e+0
Identity = 823/1567 (52.52%), Postives = 1115/1567 (71.16%), Query Frame = 2
Query:  854 KGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGAD---KLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWK-XXXXXXXXXXPLSWFIILLPVG-KKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAY---PCY-RQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSF-MPMPILIP-ELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVV-----FLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLI--IYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDI---AALKNEED---------KLENVVNWNVIVRRYLSI 5464
            +GEW N+E+LLR    +       D  + ETPLM+ACKDN+L+ VDRLLE G + +D + DGRT LH+A++FA +DV+KLLL++KADP+  GG     P+H AC RT  +   V  LLKAT++ RL  DK   I L YA+E G+   +KELL  + E Q   KK ++G+ A+HIA  +KD+EA+++LCDA A++N++N  G T LHI+A   DET +K+  +  AD ++LD  DRS LHMAAE+G T++VELLIDKFKCNVL R K+G+TLMHVTS  G+P+TT++ LRRGVPLHMPNK G VCLHAAA+SGH +VV+ LLDKGANVNARTKD  T LH AV  G+P VVETL+G+GA V+FKGG  +++PLH+AA T+ GE+CAEMLLKSGA+VN T + G++ LH A++ GNL ML++LL EG DP+ +C+ GNSPLH+  R+C   +   ++    +TKSR DA+ LVNL N EGETA+H+AAEL +++  +DFEDTD++K+LL Y+GDV +QTKYT ETPLHYCA +GN D+LLEIV FL+HKIQLVVNKQ  NGWSPLL AS  G   IV ILL+ +ARVDVFD  G  ALHLAA+  + NV   LL   AFVNAKSK   TPLHLAAQ G+ ++V  L+ ++   VDA TL+ KTPLHLAAQ G KEVC +L+ H    AD KA D+ GQTPLHLAA++D S VV++FLR K +++  AS  GMTC HIAA+ GS++VI E +R N++++   K K+ G TALHLAA+ GH ++VK+L++AGA+P++EN DGMT LHLAA+ GH  +L+ LK K+  R+ S KSG+TPLH+AAH G+ DFV E+L  VPAN+ S +PK     KD++++ G TPLHLASQSGHE+LVR LLN   V+V+SAT  +G  PLH A+QNG TNV S+LL + +NQI   D  GRTALH+A++ GH +M AL +GQGAD+N  D+  +TPLH+AAK G+L+V +LLV+  A+CEAET D ++P+  AA  NH EV+SFLL+ +H+T  L+E+ KFL+++M+CSK++  K++EEFIL+SPAPAE AAKLS +F  LS++EKER+K+L+ + ++C++MCT+L A+AA E+G D   KLLK+VD  GVQFLDIL+ETEQKEVI+HP VQRYL+DVW G+L+WP WK L +F + L  P       LP+   +    P++KF+ YLI+HV+L FL  +V +   +   P Y R+    T +ECLLL+ LSG LVSEL NP DR  +   K  ++      V+    +F +P       + ++ RNQL ++AT +C ++ L+FL+ HHLFGPW+IIIRDLM DL +F+VILAIF+  F   L + + P+   D  + P  + K +      L+FALFG   P +LP+   +P + + L + +FG  L+IT+IVLINLLIAMM++TYE I+AESDTEWK+GRAKLI NM KTS  P+P  L+TQLI  + + +  +R++ +   +E+D         +  G +   A    +E+         K+E+VV+W  +++++ SI
Sbjct:  188 RGEWANIESLLRKGDFQPGDVSEADEVSGETPLMMACKDNKLVIVDRLLENGASVSDKSSDGRTPLHFASQFAKDDVIKLLLSRKADPSQPGGVKNQTPLHYACQRTQAALPAVQLLLKATRNGRLLPDKVDNIPLFYAVEQGNAVVVKELLDRDTEAQVKWKKSFNGETALHIAASRKDMEAIKILCDAGAEVNVQNNDGLTPLHISAHEGDETAIKFFHTCKADASLLDKFDRSPLHMAAERGQTRVVELLIDKFKCNVLARTKDGSTLMHVTSQFGYPDTTLAFLRRGVPLHMPNKGGGVCLHAAAKSGHASVVRGLLDKGANVNARTKDKLTALHAAVACGHPHVVETLLGFGASVDFKGGEDEDTPLHLAARTRGGERCAEMLLKSGADVNRTNRLGQTPLHTAAKGGNLNMLRALLDEGGDPTRVCQQGNSPLHMAARHCRQAVAAAIIEHVTQTKSRHDAVNLVNLGNKEGETALHYAAELTKEKARTDFEDTDLVKLLLRYEGDVSVQTKYTNETPLHYCARSGNEDILLEIVKFLDHKIQLVVNKQTTNGWSPLLIASDCGRDGIVDILLRKHARVDVFDTKGFAALHLAAKNNNANVVRALLRMNAFVNAKSKECYTPLHLAAQEGHNEVVLILLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHS---ADCKATDNNGQTPLHLAAEHDRSHVVKMFLR-KKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENVDGMTPLHLAAQNGHSKVLQALKEKVDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANLASIKPKDYNLFKDMVSDYGFTPLHLASQSGHESLVRYLLNSTSVKVDSATIKHGMIPLHLAAQNGETNVASLLLSRDTNQIRLADSHGRTALHWAANKGHYDMTALLVGQGADVNGRDHSNWTPLHFAAKMGHLRVMQLLVDSKANCEAETKDGKLPVAYAAENNHVEVVSFLLKERHNTYALMEDWKFLYNIMLCSKISGNKTLEEFILVSPAPAETAAKLSKKFVILSEREKERAKELVQMGKYCENMCTELVAVAAAESGGDGAAKLLKAVDNRGVQFLDILLETEQKEVIAHPAVQRYLTDVWKGNLDWPTWKFLLLFTVFLAIPPVMMAFSLPLSCNRYHRKPVIKFIAYLIAHVHLIFLFVFVAVEPEWLGPPYYTRRDLMPTWLECLLLLWLSGQLVSELTNPADRSGLGIFKVIVIAVAAVGVITHLAAFALPSDTNARLDALFARNQLFAFATLLCFVMFLEFLTFHHLFGPWSIIIRDLMRDLMRFLVILAIFMAGFTVHLRSLYVPVYRPDTYDTPVAMGKSLLTAFELLFFALFGYIEPDNLPNMTQSPTWTMTLVKVIFGCYLIITLIVLINLLIAMMSDTYERIRAESDTEWKFGRAKLISNMNKTSSTPTPLILVTQLIFVLRNFRRKHRVQSQSGLEEDDVDASRGDVTHSRGAVNRNAQSSGQENATEHRGGPAKIEDVVDWESVIKKFSSI 1750          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3H7A8 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A-like OS=Lingula unguis OX=7574 GN=LOC106152811 PE=3 SV=1)

HSP 1 Score: 1570.44 bits (4065), Expect = 0.000e+0
Identity = 805/1596 (50.44%), Postives = 1083/1596 (67.86%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKAT-KSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFL-EHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXX-XXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXI-NPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVP-------------GVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAA-----LKNEEDKLEN---------------------------VVNWNVIVRRYLSIRNV 5473
            +  +LC KG+W  +E +LR+  K  P     D +T  TPLM+A K+N+L+ V+RL+++GV  ND AKDGRT +H+AA +A +D++KLL+ KKAD  + GG  + LP+H+AC+R+  +   V  LLK + K  RL  DK+G+I +  + E G+++  KE L  + EQQ   +++ +GD  +H+ACR+KDV+  +L  +  A  +++N  G T LHI+A   DE ++KYL    A+ N+ D MDRS LH+AAE+G+T +VELL+DKFK NV  R K+G+TLMH+ S  GHP+T ++ L++GVPLHMPNK G+VCLHAAA+ GH  VV++LL KGA V+ARTKD YT LHIAV+   P VV+TL+G+GAQV  KGG+  E+PLH+AA T  GEKCAEML+KSGANVN   +NGE+A+HIA+R G ++M+ +LL+EG DP    K G +PLH+ VR+CH+ +  EL+ F    KS IDA+MLVN  N EGET VH+AAE+ +   H +FED D+IK++LEY+GD   QT+ T ETPLHYC+ AGN D+LLE+V  L  +++QL VNKQAKNGWSPLL A   GH +IV IL++N+ARVDVFDEHG  ALHLAAE GH  VA+VLL HKAFVNAKSK G+TPLHLAAQNG   LV+ LI  + AT+DAL+L +KTPLH+AAQ G+ EVC + L  K   AD  A D  GQTPLHLAA+NDHSDVV+LFL+ KPEL+  A+ +GMTC HIAA+ GS+ VIKE MRFNK V+   +N++  STALHLAAEGGH ++V+VLL+AGA+  +EN +GMT +HL+AK+GH H+L+ LK  + F V S K+G+T LHVAAHYGQ DFV E LT +PA + SE P +   +KDV  ESGLTPLHLASQSGHE LVRLLLN  GV+ ++AT   G+ PLH A+QNGHT+V S+LL KS++QI  +D +GRT LH +++HGH +M AL +GQGADIN  D  G+TPLH+AAK+GYLKV KLL+E GA+ + E+ + ++P+  AA  NHTEV+S+L++  H+T  L+++ KF+FDLM+C K NN +S++EFI LSPAP + AAK+S  F  L+ +EKERS+DL+    +C+ M T+L A+A+  NGA  LLKSVD  G  FLDILIE EQKEV+SHP +Q+YLSDVW G+L W  WK+ +   L LI P  W    LP+  +    PL+KFM YL+SH YL  L     +   YP ++  + +      LL+     L+   + NP DR  +  +K  ++      ++V  L+F          +Y+RNQ  + A   C ++ LDFLS HHLFGPW IIIRDLM DL +F+VIL  F+L F   L A +QP+     +N                 +     L+F+LFG   P  LP    +P + + L ++VFG  +++T+IVLINLLIAMM++TY+ IQA+SD EWK+GRAKLIRNM +TS  PSP NL T+LI Y  K+ Y+ + +    E   +   H  E+L  D  A     L+N +  L N                           V++W  +V +YL + N+
Sbjct:   48 RVYNLCQKGDWSVLEQVLRTLEKGSPEAACSDEDTGITPLMVAVKENKLVIVERLIDLGVGLNDRAKDGRTVMHFAASYARDDIMKLLINKKADATIPGGPKEQLPLHMACARSSGALAIVQMLLKVSGKDCRLVEDKDGSIPIFLSSEVGNVAVCKECLTQQTEQQIKFQRRGNGDNLMHVACRRKDVDLAKLFVEYGANFDVQNYEGHTPLHISAWEGDEAMMKYLYQAKANPNITDQMDRSPLHIAAERGNTSVVELLVDKFKANVAARTKDGSTLMHIASECGHPDTALTFLKKGVPLHMPNKAGAVCLHAAAKRGHTAVVRSLLQKGAQVDARTKDNYTALHIAVEACRPLVVQTLLGFGAQVELKGGLAQETPLHIAARTSEGEKCAEMLIKSGANVNSIQENGETAMHIAARYGLIKMVIALLEEGGDPCWQSKLGETPLHVSVRHCHWDVADELLRFVATEKSHIDAVMLVNQQNTEGETCVHYAAEITKNMCHREFEDVDVIKLMLEYNGDTNTQTRMTHETPLHYCSRAGNEDILLEMVRHLGPNRVQLAVNKQAKNGWSPLLVACEQGHLDIVKILMQNHARVDVFDEHGKAALHLAAENGHDEVADVLLWHKAFVNAKSKLGVTPLHLAAQNGCNKLVKLLIETHGATIDALSLAKKTPLHMAAQNGQMEVCSTFLKMK---ADANATDVHGQTPLHLAAENDHSDVVKLFLKHKPELVTMANTNGMTCAHIAASKGSVGVIKELMRFNKMVVTTARNRTNNSTALHLAAEGGHVEVVQVLLEAGASATDENAEGMTAIHLSAKHGHVHILDALKGHVDFAVTSAKTGLTALHVAAHYGQADFVRETLTSIPATVTSEAPDSETGLKDVTAESGLTPLHLASQSGHEGLVRLLLNSPGVQADAATKVQGSIPLHMAAQNGHTSVVSLLLSKSTSQIHVKDKRGRTGLHLSAAHGHYDMVALLLGQGADINVYDKNGWTPLHFAAKAGYLKVVKLLIESGAAPKYESKEGKVPICYAAAMNHTEVVSYLMKRDHNTQHLMDDKKFVFDLMVCGKTNNNRSIQEFITLSPAPVDTAAKMSKNFALLAIREKERSRDLLHAGAYCEKMATELMAIASGTNGASALLKSVDCRGTPFLDILIENEQKEVVSHPTIQKYLSDVWKGNLKWNTWKVVMVFTLFLIVPPVWVYFSLPLRNRYNKVPLIKFMSYLVSHFYLIILFIMTTVAPIYPIFQSGSLIPHWYEWLLLAWLSGLLVSELTNPGDRAGLGWIKVFVIAVSALGIVVHLLAFAFNEDERYVCLYVRNQFFALALLFCFVLLLDFLSFHHLFGPWAIIIRDLMKDLIRFLVILLAFMLGFTLHLSAIYQPVYPPQVTNSSIGQGNGGGGAKSLTPIDTFELLFFSLFGLIEPDTLPTIAQSPDWTINLVKSVFGAYMLVTLIVLINLLIAMMSDTYQRIQAQSDVEWKFGRAKLIRNMNRTSATPSPLNLFTKLITYC-KVAYKHKGKICSAE--AQSYIHEEEDLNEDYDARSVDLLQNNQVMLRNMMRRNTQVAPESYLRAPQQRGPQCIDDVIDWQFVVHKYLEVNNL 1637          

HSP 2 Score: 117.857 bits (294), Expect = 2.043e-22
Identity = 125/494 (25.30%), Postives = 213/494 (43.12%), Query Frame = 2
Query: 2402 TKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGG---LTPLHLAA--QNGYKDLVEKLIN-ENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEF--MRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDA-GANPAEENNDGMTCLHLAAKYGHFHL-LEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVE 3853
            T  T  T ++     G+  VL +++  LE             G +PL+ A       IV  L+     ++   + G T +H AA     ++  +L+  KA  +A   GG     PLH+A    +G   +V+ L+    K        +   P+ L+++ G   VC+  L  +            G   +H+A +    D+ +LF+ +     +  +++G T  HI+A  G  A++K     + N ++   +       + LH+AAE G+  +V++L+D   AN A    DG T +H+A++ GH    L  LK  +    + NK+G   LH AA  G    V  +L            + G Q+ D  T+   T LH+A ++    +V+ LL   G +V         TPLH A++       + +L KS   +      G TA+H A+ +G I+M    + +G D      +G TPLH + +  +  V   L+ 
Sbjct:   41 TATTVNTRVYNLCQKGDWSVLEQVLRTLEKGSPEAACSDEDTGITPLMVAVKENKLVIVERLIDLGVGLNDRAKDGRTVMHFAASYARDDIMKLLINKKA--DATIPGGPKEQLPLHMACARSSGALAIVQMLLKVSGKDCRLVEDKDGSIPIFLSSEVGNVAVCKECLTQQTEQQIKFQRRGNGDNLMHVACRRKDVDLAKLFVEYGANFDVQ-NYEGHTPLHISAWEGDEAMMKYLYQAKANPNITDQMDR-----SPLHIAAERGNTSVVELLVDKFKANVAARTKDGSTLMHIASECGHPDTALTFLKKGVPLH-MPNKAGAVCLHAAAKRGHTAVVRSLL------------QKGAQV-DARTKDNYTALHIAVEACRPLVVQTLLGF-GAQVELKGGLAQETPLHIAARTSEGEKCAEMLIKSGANVNSIQENGETAMHIAARYGLIKMVIALLEEGGDPCWQSKLGETPLHVSVRHCHWDVADELLR 511          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267DZS7 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025367g1 PE=3 SV=1)

HSP 1 Score: 1565.44 bits (4052), Expect = 0.000e+0
Identity = 822/1574 (52.22%), Postives = 1115/1574 (70.84%), Query Frame = 2
Query:  854 KGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGAD---KLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWK-XXXXXXXXXXPLSWFIILLPVG-KKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAY---PCY-RQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSF-MPMPILIP-ELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVV-----FLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLI--IYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDI-----AALKNEED--------------KLENVVNWNVIVRRYLSI 5464
            +GEW NVE+LLR    +       D  + ETPLM+ACKDN+L+ VDRLLE G + +D + DGRT LH+A++FA +DV+KLLL++KADP+  GG     P+H AC RT  +   V  LLKAT++ RL  DK   I L YA+E G+   +KELL  + E Q   KK ++G+ A+HIA  +KD+EA+++LCDA A++N++N  G T LHI+A   DET +K+  +  AD ++LD  DRS LHMAAE+G T++VELLIDKFKCNVL R K+G+TLMHVTS  G+P+TT++ LRRGVPLHMPNK G VCLHAAA+SGH +VV+ LLDKGANVNARTKD  T LH AV  G+P VVETL+G+GA V+FKGG  +++PLH+AA T+ GE+CAEMLLKSGA+VN T + G++ LH A++ GNL ML++LL EG DP+ +C+ GNSPLH+  R+C   +   ++    +TKSR DA+ LVNL N EGETA+H+AAEL +++  +DFEDTD++K+LL Y+GDV +QTKYT ETPLHYCA +GN D+LLEIV FL+HKIQLVVNKQ  NGWSPLL AS  G   IV ILL+ +ARVDVFD  G  ALHLAA+  + NV   LL   AFVNAKSK   TPLHLAAQ G+ ++V  L+ ++   VDA TL+ KTPLHLAAQ G KEVC +L+ H    AD KA D+ GQTPLHLAA++D S VV++FLR K +++  AS  GMTC HIAA+ GS++VI E +R N++++   K K+ G TALHLAA+ GH ++VK+L++AGA+P++EN DGMT LHLAA+ GH  +L+ LK K+  R+ S KSG+TPLH+AAH G+ DFV E+L  VPAN+ S +PK     K+++++ G TPLHLASQSGHE+LVR LLN   V+V+SAT  +G  PLH A+QNG TNV S+LL + +NQI   D  GRTALH+A++ GH +M AL +GQGAD+N  D+  + PLH+AAK G+L+V +LLV+  A+CEAET D ++P+  AA  NH EV+SFLL+ +H+T  L+E+ KFL+++M+CSK++  K++EEFIL+SPAPAE AAKLS +F  LS++EKER+K+L+ + ++C++MCT+L A+AA E+G D   KLLK+VD  GVQFLDIL+ETEQKEVI+HP VQRYL+DVW G+L+WP WK L +F + L  P       LP+   +    P++KF+ YLI+HV+L FL  +V +   +   P Y R+    T +ECLLL+ LSG LVSEL NP DR  +   K  ++      V+    +F +P       + ++ RNQL ++AT +C ++ L+FL+ HHLFGPW+IIIRDLM DL +F+VILAIF+  F   L + + P+   D  + P  + K +      L+FALFG   P +LP+   +P + + L + +FG  L+IT+IVLINLLIAMM++TYE I+AESDTEWK+GRAKLI N+ KTS  P+P  L+TQLI  + + +  +R++ +   +E+D        +   GD+     A  +N +               K+E+VV+W  +++++ SI
Sbjct:  188 RGEWANVESLLRKGDFQPGDVSEADEVSGETPLMMACKDNKLVIVDRLLENGASVSDKSSDGRTPLHFASQFAKDDVIKLLLSRKADPSQPGGVKNQTPLHYACQRTQAALPAVQLLLKATRNGRLLPDKVDNIPLFYAVEQGNAVVVKELLDRDTEAQVKWKKSFNGETALHIAASRKDMEAIKILCDAGAEVNVQNNDGLTPLHISAHEGDETAIKFFHTCKADASLLDKFDRSPLHMAAERGQTRVVELLIDKFKCNVLARTKDGSTLMHVTSQFGYPDTTLAFLRRGVPLHMPNKGGGVCLHAAAKSGHASVVRGLLDKGANVNARTKDKLTALHAAVACGHPHVVETLLGFGASVDFKGGEDEDTPLHLAARTRGGERCAEMLLKSGADVNRTNRLGQTPLHTAAKGGNLNMLRALLDEGGDPTRVCQQGNSPLHMAARHCRQAVAAAIIEHVTQTKSRHDAVNLVNLGNKEGETALHYAAELTKEKARTDFEDTDLVKLLLRYEGDVSVQTKYTNETPLHYCARSGNEDILLEIVKFLDHKIQLVVNKQTTNGWSPLLIASDCGRDGIVDILLRKHARVDVFDTKGFAALHLAAKNNNANVVRALLRMNAFVNAKSKECYTPLHLAAQEGHNEVVLILLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHS---ADCKATDNNGQTPLHLAAEHDRSHVVKMFLR-KKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGMTPLHLAAQNGHSKVLQALKEKVDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANLASIKPKDYNLFKEMVSDYGFTPLHLASQSGHESLVRYLLNSTSVKVDSATIKHGMIPLHLAAQNGETNVASLLLSRDTNQIRLADSHGRTALHWAANKGHYDMTALLVGQGADVNGRDHSNWAPLHFAAKMGHLRVMQLLVDSKANCEAETKDGKLPVAYAAENNHVEVVSFLLKERHNTYALMEDWKFLYNIMLCSKISGNKTLEEFILVSPAPAETAAKLSKKFVILSEREKERAKELVQMGKYCENMCTELVAVAAAESGGDGAAKLLKAVDNRGVQFLDILLETEQKEVIAHPAVQRYLTDVWRGNLDWPTWKFLLLFTVFLAIPPVMMAFSLPLSCNRYHRKPVIKFIAYLIAHVHLIFLFVFVAVEPEWLGPPYYTRRDLMPTWLECLLLLWLSGQLVSELTNPADRSGLGIFKVIVIAVAAVGVITHLAAFALPSDTNARLDALFARNQLFAFATLLCFVMFLEFLTFHHLFGPWSIIIRDLMRDLMRFLVILAIFMAGFTVHLRSLYVPVYRPDTYDTPVAMGKSLLTAFELLFFALFGYIEPDNLPNMTQSPTWTMTLVKVIFGCYLIITLIVLINLLIAMMSDTYERIRAESDTEWKFGRAKLISNINKTSSTPTPMILVTQLIFVLRNFRRKHRVQSQSGLEEDD-------VDTSRGDVMHSRGAVNRNAQSSGQENATEHRGGPAKIEDVVDWESVIKKFSSI 1750          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267GWH2 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007249g1 PE=3 SV=1)

HSP 1 Score: 1563.51 bits (4047), Expect = 0.000e+0
Identity = 812/1514 (53.63%), Postives = 1093/1514 (72.19%), Query Frame = 2
Query:  854 KGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGAD---KLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWK-XXXXXXXXXXPLSWFIILLPVG-KKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAY---PCY-RQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSF-MPMPILIP-ELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVV-----FLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLI--IYSTKIYYRIRKRPLYKEND 5341
            +GEW N+E+LLR    +       D  + ETPLM+ACKDN+L+ VDRLLE G + +D + DGRT LH+A++FA +DV+KLLL++KADP+  GG     P+H AC RT  +   V  LLKAT++ RL  DK   I L YA+E G+   +KELL  + E Q   KK ++G+ A+HIA  +KD+EA+++LCDA A++N++N  G T LHI+A   DET +K+  +  AD ++LD  DRS LHMAAE+G T++VELLIDKFKCNVL R K+G+TLMHVTS  G+P+TT++ LRRGVPLHMPNK G VCLHAAA+SGH +VV+ LLDKGANVNARTKD  T LH AV  G+P VVETL+G+GA V+FKGG  +++PLH+AA T+ GE+CAEMLLKSGA+VN T + G++ LH A++ GNL ML++LL EG DP+ +C+ GNSPLH+  R+C   +   ++    +TKSR DA+ LVNL N EGETA+H+AAEL +++  +DFEDTD++K+LL Y+GDV +QTKYT ETPLHYCA +GN D+LLEIV FL+HKIQLVVNKQ  NGWSPLL AS  G   IV ILL+ +ARVDVFD  G  ALHLAA+  H NV   LL   AFVNAKSK   TPLHLAAQ G+ ++V  L+ ++ + VDA TL+ KTPLHLAAQ G KEVC +L+ H    AD KA D+ GQTPLHLAA++D S VV++FLR K +L+  AS  GMTC HIAA+ GS++VI E +R N++++   K K+ G TALHLAA+ GH ++VK+L++AGA+P++EN DGMT LHLAA+ GH  +L+ LK K+  R+ S KSG+TPLH+AAH G+ DFV E+L  VPAN+ S +PK     K+++++ G TPLHLASQSGHE+LVR LLN   V+V+SAT  +G  PLH A+QNG TNV S+LL + +NQI   D  GRTALH+A++ GH +M AL +GQGAD+N  D+  + PLH+AAK G+L+V +LLV+  A+CEAET D ++P+  AA  NH EV+SFLL+ +H+T  L+E+ KFL+++M+CSK++  K++EEFIL+SPAPAE AAKLS +F  LS++EKER+K+L+ + ++C++MCT+L A+AA E+G D   KLLK+VD  GVQFLDIL+ETEQKEVI+HP VQRYL+DVW G+L+WP WK L +F + L  P       LP+   +    P++KF+ YLI+HV+L FL  +V +   +   P Y R+    T +ECLLL+ LSG LVSEL NP DR  +   K  ++      V+    +F +P       + ++ RNQL ++AT +C ++ L+FL+ HHLFGPW+IIIRDLM DL +F+VILAIF+  F   L + + P+   D  + P  + K +      L+FALFG   P +LP+   +P + + L + +FG  L+IT+IVLINLLIAMM++TYE I+AESDTEWK+GRAKLI N+ KTS  P+P  L+TQLI  + + +  +R++ +   +E+D
Sbjct:  188 RGEWANIESLLRKGDFQPGDVSEADEVSGETPLMMACKDNKLVIVDRLLENGASVSDKSSDGRTPLHFASQFAKDDVIKLLLSRKADPSQPGGVKNQTPLHYACQRTQAALPAVQLLLKATRNGRLLPDKVDNIPLFYAVEQGNAVVVKELLDRDTEAQVKWKKSFNGETALHIAASRKDMEAIKILCDAGAEVNVQNNDGLTPLHISAHEGDETAIKFFHTCKADASLLDKFDRSPLHMAAERGQTRVVELLIDKFKCNVLARTKDGSTLMHVTSQFGYPDTTLAFLRRGVPLHMPNKGGGVCLHAAAKSGHASVVRGLLDKGANVNARTKDKLTALHAAVACGHPHVVETLLGFGASVDFKGGEDEDTPLHLAARTRGGERCAEMLLKSGADVNRTNRLGQTPLHTAAKGGNLNMLRALLDEGGDPTRVCQQGNSPLHMAARHCRQAVAAAIIEHVTQTKSRHDAVNLVNLGNKEGETALHYAAELTKEKARTDFEDTDLVKLLLRYEGDVSVQTKYTNETPLHYCARSGNEDILLEIVKFLDHKIQLVVNKQTTNGWSPLLIASDCGRDGIVDILLRKHARVDVFDTKGFAALHLAAKNNHANVVRALLRMNAFVNAKSKECYTPLHLAAQEGHNEVVLILLKQDGSEVDARTLHSKTPLHLAAQRGHKEVCETLVDHS---ADCKATDNNGQTPLHLAAEHDRSHVVKMFLR-KKDLVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGMTPLHLAAQNGHSKVLQALKEKVDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANLASIKPKDYNLFKEMVSDYGFTPLHLASQSGHESLVRYLLNSTSVKVDSATIKHGMIPLHLAAQNGETNVASLLLSRDTNQIRLADSHGRTALHWAANKGHYDMTALLVGQGADVNGRDHSNWAPLHFAAKMGHLRVMQLLVDSKANCEAETKDGKLPVAYAAENNHVEVVSFLLKERHNTYALMEDWKFLYNIMLCSKISGNKTLEEFILVSPAPAETAAKLSKKFVILSEREKERAKELVQMGKYCENMCTELVAVAAAESGGDGAAKLLKAVDNRGVQFLDILLETEQKEVIAHPAVQRYLTDVWRGNLDWPTWKFLLLFTVFLAIPPVMMAFSLPLSCNRYHRKPVIKFIAYLIAHVHLIFLFVFVAVEPEWLGPPYYTRRDLMPTWLECLLLLWLSGQLVSELTNPADRSGLGIFKVIVIAVAAVGVITHLAAFALPSDTNARLDALFARNQLFAFATLLCFVMFLEFLTFHHLFGPWSIIIRDLMRDLMRFLVILAIFMAGFTVHLRSLYVPVYRPDTYDTPVAMGKSLLTAFELLFFALFGYIEPDNLPNMTQSPTWTMTLVKVIFGCYLIITLIVLINLLIAMMSDTYERIRAESDTEWKFGRAKLISNINKTSSTPTPMILVTQLIFVLRNFRRKHRVQSQSGLEEDD 1697          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048767.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 1325.84 bits (3430), Expect = 0.000e+0
Identity = 723/1530 (47.25%), Postives = 1008/1530 (65.88%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLK-ATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIV-NFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERP-------KTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK-HSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALA--AVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXX-PLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFL----LFYVP--------LLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGF----FAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPI---------------LSGDYSNVP-GVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIY 5287
            + + LC +GEW  +E  L+S  K  P     D E+  + +M+A ++NRL  V+RLLE+GV+P + AKDGRTALH AA  + +D+VKLL A+K DPN  GG    LP+H A SR   S   V +LLK + K ARL  DK+G I L+ A+EAG++  IKELL  + E Q   ++   GD A+HI CRKKDVE  ++L +  A ++ +N  GQT LHIAA   DE +LK+   + A+ N+ D +DRS LH+ AE+GHT +VE+L +KFK NVL R K+G+TL+H+ S  GHPET ++ L++GVPLHMPNK+G+VCLHAAA+ GH  VVK LL KGA+V+A TKD  T LHIAV+   P VV+ L+G+GAQV  +GG   E+PLHVAA  K GEK AEMLLKSGA VN   +NGE+A+H+A+R G L+M+++L +EGAD +   K G +PLH+ V +CH  +V+ +++  +  +SR +A + V   N  GETA+H AAEL  +  H D ED  II+ L+EY+ D+   T+   ETPLHYCA  GN+ VL E++ N    ++Q  +NK +KNG SPLL A+  GH  +V +LL+N+ARVDVFDE G+ ALHLAAE+GH ++A++LL HKAFVNAK+K GLTPLHL+AQ+G   LV  L+  ++A VDAL+L+++TPLHLAA  G+ +VC +LL  +   AD  A D  GQTPLHLAA+NDHS+VV+LFL+ +PEL   AS +G TC HIAAA GS+AVI+E ++F++  +  L +K+ GS  LHLAA GGH ++VKVLL+AGA+ AEE+++GMT +HLAA+ GH H+L VLK  +  +++S+K+G+T LHVAA +GQ+DFV E+LT V A I+SE P       + G     + TESG TPLHLA+QSGHE++VRLLLN  GV+ ++ T++ G+TPLH A+ NGHT V  +LL KS++ +  RD +GRT LH AS++GH+    + +GQGADIN +D  G T LHYA K+G L+V + LVE GAS  +E +  + PL   A  NH   +SFLLR + ++T++L+E+ KF+FDLM+C +LN+  ++EE +L S +P   A +LS      + +EKERS  L   + HC+ M +DL  LA  A  +GA  +L++VD+ G   LD LIE  QK V++HP VQ+YL++VW G L+W +W++ + +  L+  P  W  + LP+  +  T P++KFM +L+SH++L  L    + Y P        LL  +  +     + GM    L            +P +R  +A ++  +L  GF        +   +    P+     ++ RN LL+ A  +  I  L+FL+ HHLFGPW IIIRDL+ DL +F VIL +F  +F+  L A  QP+                 G  S+     L   V L+FALFG     D+P    +P  A  LAR  FGI L++++IVL+NLLIAMM++TY+ IQA+SDTEWK+GRA LIR+M + S  PSPFNLLT L+ +
Sbjct:   14 RLLQLCLRGEWVALEQNLKSLEKGDPEICQTDEESGLSLMMIAVRENRLSIVERLLELGVSPAEKAKDGRTALHIAAAHSKDDLVKLL-ARKVDPNAPGGPKAQLPLHYAASRPAGSPAVVQTLLKLSNKEARLTADKDGCIPLLLAVEAGNVGIIKELLSGQTEPQLQTQRTGHGDTALHICCRKKDVEMAKVLVELGASMDFQNVEGQTPLHIAAWEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEILTEKFKSNVLARTKDGSTLLHIASQCGHPETALTFLKKGVPLHMPNKSGAVCLHAAAKRGHTAVVKALLLKGAHVDATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAARVKEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHLSAQSGSARLVRLLVETHQACVDALSLSKQTPLHLAAISGQLDVCSNLLNLR---ADITATDIHGQTPLHLAAENDHSEVVKLFLKHRPELATLASVEGATCTHIAAAKGSVAVIRELLKFSQGGLTTLHSKANGSCPLHLAAAGGHTEVVKVLLEAGASAAEEDSEGMTAVHLAARSGHTHILVVLKASVPLKIISSKTGLTALHVAASFGQVDFVREILTRVSAAIRSELPAGSAGISRDGTLKHQLHTESGYTPLHLAAQSGHESVVRLLLNSPGVQADAETDSEGSTPLHLAACNGHTAVVGLLLSKSASLLHLRDRRGRTCLHLASANGHVATVRVLLGQGADINQTDKSGCTALHYAGKAGCLEVVRFLVESGASTRSECSAGRTPLQYTAEENHQASVSFLLRRRDNNTLRLLEDRKFVFDLMVCGRLNDNATLEELVLHSSSPLCTAVRLSRALSLAALREKERSAHLQAAAHHCEAMASDLLTLASSAEGHGAGVILRAVDHRGASVLDCLIEGRQKSVVAHPAVQKYLTEVWYGSLHWDSWRILLLFFSLLLCPPLWLFLSLPLKHRFNTVPIIKFMSHLVSHLFLLALFILTIVYPPINPLSEGRLLPGWCEWLLLTWLCGMLVSELS-----------HPGERAGLAWVR--LLLLGFSASALLCHLLAAALQSWPLAPLNCLFARNVLLTVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILLLFHTAFSLSLTAICQPVYPENELNSSNSNVSNSEGSRSDSELNPLYVSVLLFFALFGLTEQEDIPAMDRSPAAANILARLTFGIYLVVSVIVLVNLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGTPSPFNLLTSLVFF 1526          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000016978.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 1309.66 bits (3388), Expect = 0.000e+0
Identity = 718/1527 (47.02%), Postives = 1002/1527 (65.62%), Query Frame = 2
Query:  833 KFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLK-ATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIV-NFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK-HSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALA--AVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXX-PLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFL----LFYVP--------LLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGF----FAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPI---------------LSGDYSNVP-GVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKI 5299
            + + LC +GEW  +E  L+S  K  P     D E+  + +M+A ++NRL  V+RLLE+GV+P + AKDGRTALH AA  + +D+VKLL A+K DPN  GG    LP+H A SR   S   V +LLK + K ARL  DK+G I L+ A+EAG++  IKELL  + E Q   ++   GD A+HI CRKKDVE  ++L +  A ++ +N  GQT LHIAA   DE +LK+   + A+ N+ D +DRS LH+ AE+GHT +VE+L +KFK NVL R K+G+TL+H+ S  GHPET ++ L++GVPLHMPNK+G+VCLHAAA+ GH  VVK LL KGA+V+A TKD  T LHIAV+   P VV+ L+G+GAQV  +GG   E+PLHVAA  K GEK AEMLLKSGA VN   +NGE+A+H+A+R G L+M+++L +EGAD +   K G +PLH+ V +CH  +V+ +++  +  +SR +A + V   N  GETA+H AAEL  +  H D ED  II+ L+EY+ D+   T+   ETPLHYCA  GN+ VL E++ N    ++Q  +NK +KNG SPLL A+  GH  +V +LL+N+ARVDVFDE G+ ALHLAAE+GH ++A++LL HKAFVNAK+K GLTPLHL+AQ+G   LV  L+  ++A VDAL+L+++TPLHLAA  G+ +VC +LL  +   AD  A D  GQTPLHLAA+NDHS+VV+LFL+ +PEL   AS +G TC HIAAA GS+AVI+E ++F++  +  L +K+ GS  LHLAA GGH ++VKVLL+AGA+ AEE+++GMT +HLAA+ GH H+L VLK  +  +++S+K+G+T LHVAA +GQ+DFV E+LT V A I+SE P         ++  G TPLHLA+QSGHE++VRLLLN  GV+ ++ T++ G+TPLH A+ NGHT V  +LL KS++ +  RD +GRT LH AS++GH+    + +GQGADIN +D  G T LHYA K+G L+V + LVE GAS  +E +  + PL   A  NH   +SFLLR + ++T++L+E+ KF+FDLM+C +LN+  ++EE +L S +P   A +LS      + +EKERS  L   + HC+ M +DL  LA  A  +GA  +L++VD+ G   LD LIE  QK V++HP VQ+YL++VW G L+W +W++ + +  L+  P  W  + L       T P++KFM +L+SH++L  L    + Y P        LL  +  +     + GM    L            +P +R  +A ++  +L  GF        +   +    P+     ++ RN LL+ A  +  I  L+FL+ HHLFGPW IIIRDL+ DL +F VIL +F  +F+  L A  QP+                 G  S+     L   V L+FALFG     D+P    +P  A  LAR  FGI L++++IVL+NLLIAMM++TY+ IQA+SDTEWK+GRA LIR+M + S  PSPFNLLT L  +  ++
Sbjct:   14 RLLQLCLRGEWVALEQNLKSLEKGDPEICQTDEESGLSLMMIAVRENRLSIVERLLELGVSPAEKAKDGRTALHIAAAHSKDDLVKLL-ARKVDPNAPGGPKAQLPLHYAASRPAGSPAVVQTLLKLSNKEARLTADKDGCIPLLLAVEAGNVGIIKELLSGQTEPQLQTQRTGHGDTALHICCRKKDVEMAKVLVELGASMDFQNVEGQTPLHIAAWEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEILTEKFKSNVLARTKDGSTLLHIASQCGHPETALTFLKKGVPLHMPNKSGAVCLHAAAKRGHTAVVKALLLKGAHVDATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAARVKEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHLSAQSGSARLVRLLVETHQACVDALSLSKQTPLHLAAISGQLDVCSNLLNLR---ADITATDIHGQTPLHLAAENDHSEVVKLFLKHRPELATLASVEGATCTHIAAAKGSVAVIRELLKFSQGGLTTLHSKANGSCPLHLAAAGGHTEVVKVLLEAGASAAEEDSEGMTAVHLAARSGHTHILVVLKASVPLKIISSKTGLTALHVAASFGQVDFVREILTRVSAAIRSELPAGSAG----ISRDGYTPLHLAAQSGHESVVRLLLNSPGVQADAETDSEGSTPLHLAACNGHTAVVGLLLSKSASLLHLRDRRGRTCLHLASANGHVATVRVLLGQGADINQTDKSGCTALHYAGKAGCLEVVRFLVESGASTRSECSAGRTPLQYTAEENHQASVSFLLRRRDNNTLRLLEDRKFVFDLMVCGRLNDNATLEELVLHSSSPLCTAVRLSRALSLAALREKERSAHLQAAAHHCEAMASDLLTLASSAEGHGAGVILRAVDHRGASVLDCLIEGRQKSVVAHPAVQKYLTEVWYGSLHWDSWRILLLFFSLLLCPPLWLFLSL-----FNTVPIIKFMSHLVSHLFLLALFILTIVYPPINPLSEGRLLPGWCEWLLLTWLCGMLVSELS-----------HPGERAGLAWVR--LLLLGFSASALLCHLLAAALQSWPLAPLNCLFARNVLLTVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILLLFHTAFSLSLTAICQPVYPENELNSSNSNVSNSEGSRSDSELNPLYVSVLLFFALFGLTEQEDIPAMDRSPAAANILARLTFGIYLVVSVIVLVNLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGTPSPFNLLTSLYNFGQEV 1514          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 342.428 bits (877), Expect = 4.605e-96
Identity = 265/851 (31.14%), Postives = 417/851 (49.00%), Query Frame = 2
Query: 1502 LKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIV-ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGN---SDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSA----TNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFL 3946
            L ++++ IA +N  +    + LH+A+++GH K+V ELL      ++ T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN +  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GANVN T KNG + LHIA+R GN+ M++ LL  GA      KD  +PLH   R  H  +++ L          +D    +      G + +H AA+          +  D ++ LL+Y+ ++   T     TPLH  A  G+   + VLL+             N +A NG++PL  A    H   + +LLK++A ++   E G+T LH+AA  GH N+   LL   A  NA +    TPLH+AA+ G+ ++ + L+ +N A VDA   + +TPLH AA+ G KE+ + LL HK   A+P +A + G TPLH+AA+  H+   R+ L        NA    MT                                 G T LH+A + G   + ++LL+ GANP     +G+T LH+A  + +  ++++L  K      + ++G TPLH+AA   Q++    +L    AN  SE            +  G+TPLHLA+Q G  ++V LL++  G  VN      T     TPLH  +Q GH  +  +L+ K    +      G TALH A  +G+I+M    + Q A +N    +G+TPLH AA+ G+  +  LL++ GA     T +   PL +A    +  V+  L
Sbjct:    4 LDHIKNGIA-INTANQNGLNGLHLASKEGHVKMVLELL--HHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-LSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEIL----------LDQGAPIQAKTKNGLSPIHMAAQ---------GDHMDCVRQLLQYNAEIDDIT-LDHLTPLHVAAHCGHHRMAKVLLD--------KGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLL-QNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHK---ANPDSATTAGHTPLHIAAREGHAHTTRILLDG------NAQQTKMT-------------------------------KKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLL-QCGANANSE------------SLQGITPLHLAAQEGRPDMVALLISKQG-NVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLV-KQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 2 Score: 300.442 bits (768), Expect = 1.719e-82
Identity = 244/804 (30.35%), Postives = 374/804 (46.52%), Query Frame = 2
Query: 1715 LRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKS--------------------------VIHGLKNKSTGS----TALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPAN-----------------------IKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSN----QITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            ++ G+ ++  N+ G   LH A++ GHV +V  LL  G ++   TK   T LHIA   G   VV  L+ Y                                   GANVN   + G S L++A++  +LE++K LL+ GA+ S+  +DG +PL + ++  H  +V  L+++  K K R+ A+              H AA           +DT    +LL+ D +  + +K T  TPLH  A   N  V   ++N   +     VN   KNG +PL  A+  G+  +V +LL   A++D   +  +T LH AA  GH  V  +LL   A + AK+K GL+P+H+AAQ  + D V +L+  N A +D +TL+  TPLH+AA  G   + + LL  K   A+ +A +  G TPLH+A K +H   + L L+    L    +  G+T  H+AA  G L ++K  ++   S                          ++  L      +    T LH AA  GH +LVK+LL+  ANP      G T LH+AA+ GH H   +L    + +    K G TPLHVA  YG++D V E+L +  AN                       +K    K G         +G TPLH+A++     +   LL C G   NS +   G TPLH A+Q G  ++ ++L+ K  N       R      T LH  +  GH+ +A + + QGA + ++  MG+T LH A   G +K+ K L+++ A    +T     PL  AA   HT++++ LL++
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHY-----------------------------------GANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPAL--------------HIAAR---------NDDTRTAAVLLQNDPNPDVLSK-TGFTPLHIAAHYENLSVAQLLLNRGAN-----VNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN-AEIDDITLDHLTPLHVAAHCGHHRMAKVLL-DKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVD-VAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTA--RNGYTPLHIAAKQNQLEVASSLLQC-GANANSESLQ-GITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKH 736          

HSP 3 Score: 270.396 bits (690), Expect = 6.285e-73
Identity = 247/803 (30.76%), Postives = 382/803 (47.57%), Query Frame = 2
Query: 1352 SGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV-------PLHM-----------------PN-----KTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKN--GWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENN-----DGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            +G   +H+A ++  V+ +  L      +      G T LHIAA    E ++  L    A+VN       S L+MAA++ H ++V+ L++      L  + +G T + V    GH      L+  G         LH+                 PN     KTG   LH AA   +++V + LL++GANVN   K+  TPLHIA + GN  +V  L+  GAQ++ +    DE +PLH AA  +NG  +  E+LL  GA +    KNG S +H+A++  +++ ++ LLQ  A+   I  D  +PLH+     H+ + + L+    K  +R  A+         G T +H A     K+ H    D     +LL++   ++  T+ +  TPLH  A  G+       +N ++  +Q   +  A N    +PL  A+  GH E+   LL+N A+VD   +   T LH AA  GH+ +  +LL HKA  ++ +  G TPLH+AA+ G+      L++ N A    +T    TPLH+A +YG+ +V   LL      A+P AA   G TPLH+A  +++ DVV+L +  K     + + +G T  HIAA    L V    ++   +          G T LHLAA+ G   +V +L+    N    N        +T LHL A+ GH  + ++L  + +    +++ G T LHVA HYG I  V  +L               +   +  T  G TPLH A+Q GH ++V LLL   G   N  T  NGT+PL  A + G+ +V  +L
Sbjct:   19 NGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDAR--TKDELTPLHCAA--RNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANAR--AL--------NGFTPLHIAC----KKNHMRSMD-----LLLKHSASLEAVTE-SGLTPLHVAAFMGH-------LNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGN-AQQTKMTKKGFTPLHVACKYGKVDVAELLLERG---ANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANAN---SESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQ-------------QAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLK-HGALPNEIT-TNGTSPLGIAKRLGYISVIDVL 766          

HSP 4 Score: 233.032 bits (593), Expect = 3.244e-61
Identity = 206/790 (26.08%), Postives = 358/790 (45.32%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHK--IYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            +PL +A ++N L  V  LLE G N +   +DG T L  A +   E+VV LL+          G  +   +H+A     T +  V+          LQ D    +                                +G   +HIA   +++   +LL +  A +N     G T LHIAA   +  +++ L    A ++     + + LH AA  GH +++E+L+D+                                  G P+    K G   +H AAQ  H++ V+ LL   A ++  T D  TPLH+A   G+  + + L+  GA+ N +  +   +PLH+A   KN  +  ++LLK  A++    ++G + LH+A+  G+L ++KSLLQ GA P+       +PLH+  R  H     E+  F  +  +++DA         + +T +H AA +  K         +++K+LLE+  +    T     TPLH  A  G++     +++    +      K  K G++PL  A   G  ++  +LL+  A  +   ++G+T LH+A    + +V  +L+      ++ ++ G TPLH+AA+    ++   L+ +  A  ++ +L   TPLHLAAQ GR ++   L+  +  +   +         TPLHL A+  H  +  + ++ +   + +AS  G T  H+A   G++ ++K  ++    V    K +  G T LH AA+ GH  +V +LL  GA P E   +G + L +A + G+  +++VLK
Sbjct:   88 SPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVL----------LQNDPNPDV-----------------------------LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQ----------------------------------GAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANAR-ALNGFTPLHIAC-KKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHC----EVAQFLLQNLAQVDAKA------KDDQTPLHCAARMGHK---------ELVKLLLEHKANPDSATT-AGHTPLHIAAREGHAHTTRILLDGNAQQ-----TKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLL-QCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVK-QGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHV--NCKTR-VGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 767          

HSP 5 Score: 206.838 bits (525), Expect = 4.203e-53
Identity = 163/494 (33.00%), Postives = 257/494 (52.02%), Query Frame = 2
Query: 2483 LEH-KIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTP-LHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            L+H K  + +N   +NG + L  AS  GH ++V  LL +   ++   + G TALH+AA  G   V   L+ + A VNA+S+ G +PL++AAQ  + ++V+ L+ EN A     T +  TPL +A Q G + V   L+ +            + + P LH+AA+ND +    + L+  P   +  S  G T  HIAA   +L+V +  +    +V    KN   G T LH+AA  G+  +V++LLD GA       D +T LH AA+ GH  ++E+L  + +      K+G++P+H+AA    +D V ++L            +   ++ D+ T   LTPLH+A+  GH  + ++LL+  G + N A   NG TPLH A +  H     +LL K S  +      G T LH A+  GH+ +    + +GA  NAS+    TPLH AA++G+ +V + L++  A  +A+  D Q PL  AA   H E++  LL +K
Sbjct:    4 LDHIKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLL-ENGANQSLPTEDGFTPLAVALQQGHENVVALLINY--------GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDV-LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKN---GITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLL------------QYNAEIDDI-TLDHLTPLHVAAHCGHHRMAKVLLD-KGAKAN-ARALNGFTPLHIACKKNHMRSMDLLL-KHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHK 468          

HSP 6 Score: 184.111 bits (466), Expect = 3.683e-46
Identity = 190/676 (28.11%), Postives = 303/676 (44.82%), Query Frame = 2
Query:  869 NVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMD---KEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAA--------------------TTKNG------------EKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV----KIQTKYTEETPLHYCATAGN---SDVL--------------------------LEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            NV ALL +Y  +    K R P      L +A +++       LL+   NP+ ++K G T LH AA +    V +LLL + A+ N F       P+H+A  R     G VI +++       Q+D   K+    L  A   G +  I+ LL      Q   K   +G + IH+A +   ++ +R L   NA+I+       T LH+AA      + K L    A  N       + LH+A +K H + ++LL+ K   ++    + G T +HV +  GH     SLL+RG   +  N      LH AA++GH  V + LL   A V+A+ KD  TPLH A + G+  +V+ L+ + A  +        +PLH+AA                     TK G               AE+LL+ GAN N   KNG + LH+A    NL+++K L+ +G  P    ++G +PLHI  +     +   L+       S           + +G T +H AA+  + R        D++ +L+   G+V    K++T+ T  TPLH  A  G+   +D+L                          +++V FL  + Q  VN + + G++PL  A+  GH +IV++LLK+ A  +    +G + L +A   G+ +V +VL L
Sbjct:  133 NVVALLINYGTKG---KVRLPA-----LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN-FTPKNGITPLHIAARR-----GNVI-MVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTK---NGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLL-KHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPD-SATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSE----------SLQGITPLHLAAQ--EGRP-------DMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQ-QAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKL 768          

HSP 7 Score: 137.887 bits (346), Expect = 5.684e-32
Identity = 117/412 (28.40%), Postives = 197/412 (47.82%), Query Frame = 2
Query: 2924 ADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAP 4072
            A+  G   LHLA+K  H  +V   L    +L    +  G T  HIAA  G   V+ E + +  +V         G + L++AA+  H ++VK LL+ GAN +    DG T L +A + GH +++ +L     K K+                            V +K+G TPLH+AAHY  +  V ++L +  AN+            +   ++G+TPLH+A++ G+  +VRLLL+  G ++++ T +   TPLH A++NGH  V  ILL + +  I  +   G + +H A+   H++     +   A+I+       TPLH AA  G+ ++ K+L+++GA   A   +   PL +A   NH   M  LL++  S   + E+   L  L + + + +   V+  +    +P
Sbjct:   16 ANQNGLNGLHLASKEGHVKMVLELLHHGIDLE-TTTKKGNTALHIAALAGQEKVVAELVHYGANVN---AQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLS-VAQLLLNRGANV------------NFTPKNGITPLHIAARRGNVIMVRLLLD-RGAQIDARTKDE-LTPLHCAARNGHVRVIEILLDQGA-PIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESG--LTPLHVAAFMGHLNIVKSLLQRGASP 405          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 337.806 bits (865), Expect = 1.981e-94
Identity = 262/842 (31.12%), Postives = 414/842 (49.17%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIV-ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE--SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVV-------NKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLT-DVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFL 3946
            + L  A  GN +  L ++++ I D+N  +    + LH+A+++GH K+V ELL +       T  K+GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ VVK LL+ GAN +  T+   + + +A  Y  P  + T   +    N    I     +PLH+AA  +N    A++LL  GANVN T KNG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  I++ L          +D    +      G + +H AA+          +  D ++ LL+Y+ ++   T     TPLH  A  G+            H++  V+       N +A NG++PL  A    H  ++ +LLK++A ++   E G+T LH+A+  GH N+  +LL   A  NA +    TPLH+A++ G+ ++ E L+ +N A VDA   + +T LH AA+ G KE+ + LL HK   A+P +  + G TPLH+AA+  H+  VR+ L       +NA    MT                                 G T LH+AA+ G   + ++LL+ GANP     +G+T LH+A  + +  ++ +L  K      + ++G TPLH+A+   Q++    +L     AN +S +              G+TPLHLA+Q G  ++V LL++     VN   N +G TPLH  +Q GH  +  IL+  G S    TR    G T LH A  +G+I+M    + Q A++N     G+TPLH AA+ G+  +  LL++ GA     T +    L +A    +  V+  L
Sbjct:   13 SFLRAARSGNLDKALDHIKNGI-DINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTT--KKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYEN-LNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEIL----------LDQGAPIQAKTKNGLSPIHMAAQ---------GDHMDCVRQLLQYNAEIDDIT-LDHLTPLHVAAHCGH------------HRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLL-QNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHK---ANPNSTTTAGHTPLHIAAREGHTQTVRILLD------MNAQQTKMT-------------------------------KKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQ--------------GVTPLHLAAQEGRADMVSLLIS-KQANVNLG-NKSGLTPLHLVAQEGHVGIADILVKQGASVYAATR---MGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 2 Score: 293.508 bits (750), Expect = 3.321e-80
Identity = 247/809 (30.53%), Postives = 389/809 (48.08%), Query Frame = 2
Query: 1238 DKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVEL----LIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGA--QVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            ++ G   L  A + G +  + ELL      +T  KK   G+ A+HIA      + +  L +  A +N ++  G T L++AA+ N   ++K+L    A+ ++  ++  SA+ +A        +      +  K  C+ +T    G T +H+ +   +      LL RG  ++   K G   LH A++ G+V +V+ LLD+GA ++A+TKD  TPLH A + G+  ++E L+  GA  Q   K G+   SP+H+AA   + + C   LL+  A +++   +  + LH+A+  G+  M K LL +GA P+    +G +PLHI  +  H  ++  L+    K  + ++A+         G T +H A         S     +I+K+LL+  G     +    ETPLH                                       AS  GH E+   LL+N A VD   +   T+LH AA  GH+ +  +LL HKA  N+ +  G TPLH+AA+ G+   V  L++ N A    +T    TPLH+AA+YG+ +V   LL      A+P AA   G TPLH+A  +++ DVV L +  K     +A+ +G T  HIA+    + V    +++  S          G T LHLAA+ G   +V +L+   AN    N  G+T LHL A+ GH  + ++L  + +    + + G TPLHVA HYG I  V + L    AN+  +            T +G TPLH A+Q GH ++V LLL   G + N  T  NGT+ L  A + G+ +V  +L
Sbjct:   40 NQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKK---GNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFIT--ATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGL---SPIHMAAQGDHMD-CVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLL----KHSASLEAV------TESGLTPLHVA---------SFMGHLNIVKILLQ-KGASPNASNVKVETPLH--------------------------------------MASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMN-AQQTKMTKKGFTPLHVAAKYGKVDVAELLLERG---ANPNAAGKNGLTPLHVAVHHNNLDVVNLLVS-KGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGAS---ANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMV-KFLLQQQANVNGK------------TRAGYTPLHQAAQQGHTDIVTLLLK-HGAQPNEIT-TNGTSALAIAKRLGYISVIDVL 758          

HSP 3 Score: 281.182 bits (718), Expect = 2.489e-76
Identity = 225/726 (30.99%), Postives = 349/726 (48.07%), Query Frame = 2
Query: 1976 AATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEET---------PLHYCATAGNSDVLLEIVNFLE----------------HKIQLVVNKQA------KNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIK--------------------------------EFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            AA + N +K  + + K+G ++N   +NG + LH+AS+ G+++M+  LL  G       K GN+ LHI        +V ELV++             VN  + +G T ++ AA+      H      +++K LLE   +  I T+              PL Y +T  +   L  + +F+                 +  QL++N+ A      KNG +PL  AS  G+  +V +LL   A +D   +  +T LH AA  GH  +  +LL   A + AK+K GL+P+H+AAQ  + D V +L+  N A +D +TL+  TPLH+AA  G   + + LL      A P      G TPLH+A K +H  V+ L L+    L    +  G+T  H+A+  G L ++K                                EF+  N + +          T+LH AA  GH +LVK+LL+  ANP      G T LH+AA+ GH   + +L    + +    K G TPLHVAA YG++D V E+L +  AN             +   ++GLTPLH+A    + ++V LL++  G   ++A   NG TPLH AS+     V S LL  G S+N       +G T LH A+  G  +M +L I + A++N  +  G TPLH  A+ G++ +  +LV++GAS  A T     PL +A H+ + +++ FLL+ +
Sbjct:   17 AARSGNLDKALDHI-KNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGAN----------VNAQSQKGFTPLYMAAQ----ENH-----LEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPL-YLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN-AEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKG---AKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEA-VTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDA--KAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVD-VAELLLERGAN------------PNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAA--RNGYTPLHIASKQNQVEVASSLLQYGASANA---ESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQ 696          

HSP 4 Score: 278.485 bits (711), Expect = 2.035e-75
Identity = 229/767 (29.86%), Postives = 374/767 (48.76%), Query Frame = 2
Query: 1775 AAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGA--QVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSI------------------------------------ICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            AA+SG+++     +  G ++N   ++    LH+A K G+  +V  L+  G   +   K G    + LH+AA     E+    L+  GANVN   + G + L++A++  +LE++K LL+ GA+ SI                                    I   G +PLHI   Y +  + Q L+   N+  +       VN     G T +H A         S   +  ++++LL+    +  +TK  E TPLH CA       ++EI+      IQ     + KNG SP+  A+   H + V  LL+ NA +D      +T LH+AA  GH  +A VLL   A  N ++  G TPLH+A +  +  +++ L+ ++ A+++A+T +  TPLH+A+  G   + + LL      A P A++ + +TPLH+A++  H +V    L+    +   A  D  T  H AA  G   ++K  +    +      N +T  G T LH+AA  GH + V++LLD  A   +    G T LH+AAKYG   + E+L  + +    + K+G+TPLHVA H+  +D V  +++      K   P +  +       +G TPLH+AS+     +   LL   G   N A +  G TPLH A+Q G  ++ S+L+ K +N +   +  G T LH  +  GH+ +A + + QGA + A+  MG+TPLH A   G +K+ K L+++ A+   +T     PL  AA   HT++++ LL++
Sbjct:   17 AARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKG---NTALHIAALAGQ-EQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLL---NRGAN-------VNFTPKNGITPLHIA---------SRRGNVIMVRLLLDRGATIDAKTK-DELTPLH-CAARNGHVRIIEILLDQGAPIQ----AKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLL-KHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKG---ASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAK-DDQTSLHCAARMGHKELVKLLLEHKAN-----PNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVS------KGGSPHSAAR-------NGYTPLHIASKQNQVEVASSLLQY-GASAN-AESLQGVTPLHLAAQEGRADMVSLLISKQAN-VNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKH 728          

HSP 5 Score: 232.261 bits (591), Expect = 5.128e-61
Identity = 207/695 (29.78%), Postives = 332/695 (47.77%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFG---------GSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLR 3001
            T L +A    +   V  L+  G N N  ++ G T L+ AA+    +VVK LL   A+ ++            ++   P++L+ + +  +   V S + AT          G   L  A    +++  + LL        N   K +G   +HIA R+ +V  +RLL D  A I+ K     T LH AA      I++ L    A +        S +HMAA+  H   V  L+ ++   +     +  T +HV +  GH      LL +G   +     G   LH A +  H+ V+  LL   A++ A T+   TPLH+A   G+  +V+ L+  GA  N    +  E+PLH+A+   + E  AE LL++ A V+   K+ +++LH A+R G+ E++K LL+  A+P+     G++PLHI  R  H   V+ L+   N  ++++           +G T +H AA+         +   D+ ++LLE   +     K    TPLH      N    L++VN L  K     +  A+NG++PL  AS     E+ S LL+  A  +     G+T LHLAA++G  ++ ++L+  +A VN  +K GLTPLHL AQ G+  + + L+ +  A+V A T    TPLH+A  YG  ++ + LL  +   A+       G TPLH AA+  H+D+V L L+
Sbjct:   78 TALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITAT----------GFTPLHIAAHYENLNVAQLLLNRGA--NVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLL-QYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPN-ASNVKVETPLHMASRAGHCE-VAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDM-NAQQTKM---------TKKGFTPLHVAAK---------YGKVDVAELLLERGANPNAAGK-NGLTPLHVAVHHNN----LDVVNLLVSKGG-SPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQG-ASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQ---ANVNGKTRAGYTPLHQAAQQGHTDIVTLLLK 727          

HSP 6 Score: 197.208 bits (500), Expect = 3.441e-50
Identity = 183/625 (29.28%), Postives = 289/625 (46.24%), Query Frame = 2
Query:  935 TDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTK--CLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGN---SDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKL 2785
            T  TPL +A     L     LL  G N N   K+G T LH A++     +V+LLL + A        TK    P+H A +R G     +I +L    +      K G   +  A +   +  +++LL+   E         +    +H+A         ++L D  A+ N +   G T LHIA + N   ++  L    A +  + +   + LH+A+  GH  IV++L+ K      +  K   T +H+ S +GH E    LL+   P+    K     LH AA+ GH  +VK LL+  AN N+ T   +TPLHIA + G+   V  L+   AQ     K G    +PLHVAA  K G+   AE+LL+ GAN N   KNG + LH+A    NL+++  L+ +G  P    ++G +PLHI  +     +   L+ +              N  + +G T +H AA+  + R        D++ +L+    +V +  K +  TPLH  A  G+   +D+L+        K    V    + G++PL  A H G+ ++V  LL+  A V+     G T LH AA++GH ++  +LL H A  N  +  G + L +A + GY  +++ L
Sbjct:  177 TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAT---IDAKTKDELTPLHCA-ARNGHVR--IIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLT---PLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKV-ETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGF---TPLHVAA--KYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGAS----------ANAESLQGVTPLHLAAQ--EGR-------ADMVSLLISKQANVNLGNK-SGLTPLHLVAQEGHVGIADILV--------KQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 311.227 bits (796), Expect = 3.366e-85
Identity = 253/816 (31.00%), Postives = 415/816 (50.86%), Query Frame = 2
Query: 1547 DMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGA--QVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETM-KNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            D + S L  A      K ++ L      N+   ++ G   +H+ S  GH E    LL+ G  +    K G+  LH A+ +G  +VV+ L+  GANVNA++++ +TPL++A +  +  VV  L+ +GA   +  + G    +PL V A  +  ++   +LL+     N+T  K    ALHIA+R  + +    LLQ   +  +  K G +PLHI   Y +  +   L++      + +D M   ++      T +H AA    KR +      +++K+LL+    +  +TK    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL+++  VD      +TALH+AA  GH  VA V++  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G + + + L +H    A P   + RG+T LH+AA+   +DVVR  L+   ++ I A  D  T  HIA+  G   +++  ++            ++G T LHLA   GH +   +LL+ GA+ +     G T LH+AAKYG     ++L  K +    + K+G+TPLHVAAHY     V  +L D  A+  +              ++G TPLH+A++     +   LL   G E N+ T   G +PLH A+Q G  ++ S+LL K++N +   +  G T LH A+    + +A + +  GA+++A    G+TPLH A   G +K+   L+E  A   ++T     PL  AA   HT +++ LL+++ S  +L  N
Sbjct:   42 DSNASYLRAARAGNLEKALDYLKTGVDINIC--NQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGF---TPLAV-ALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLN----RGAAVDFMARNDI------TPLHVAA----KRGNG-----NMVKLLLDRGAKIDAKTK-DGLTPLHCGARSGHE----QVVEMLLDRGAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL-KHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHG---ASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDD-QTALHIASRLGKAEIVQLLLQKGAWASAA---TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDN-QRVALLLLDHGASPHAA------------AKNGYTPLHIAAKKNQLEIGTTLLEF-GAETNAVT-RQGISPLHLAAQEGSVDLVSLLLTKNAN-VNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLN 797          

HSP 2 Score: 301.982 bits (772), Expect = 3.128e-82
Identity = 247/818 (30.20%), Postives = 394/818 (48.17%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLV-------------------NLPNNEGETAVHFAAE---------LVQKRKHSDF---------------EDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTD-------------VPANI--KSERPKTGEQM------KDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFL 3946
            +G+ E  +  L+ GV +++ N+ G   LH A++ GHV VV  LL  GA+V+A TK   T LHIA   G   VV  L+                                    +GANVN   +NG + L++A++  +LE+++ LL+ GA  SI  +DG +PL + ++  H  +V  L+    K K R+ A+ +                    ++ +  G T +H AA          L+ +    DF                + +++K+LL+    +  +TK    TPLH  A +G+     ++V  L  +   +++K  KNG SPL  A+   H   V +LL+++  VD      +TALH+AA  GH  VA V++  KA  NAK+  G TPLH+A +     ++E L+ ++ A++ A+T +  TP+H+AA  G + + + L +H    A P   + RG+T LH+AA+   +DVVR  L+   ++ I A  D  T  HIA+  G   +++  ++            ++G T LHLA   GH +   +LL+ GA+ +     G T LH+AAKYG     ++L  K +    + K+G+TPLHVAAHY     V  +L D              P +I  K  + + G  +       + +T  G++PLHLA+Q G  +LV LLL  +   VN   N NG TPLH A+Q     V  +LL   + ++      G T LH A  +G+++M +  +   A IN+    G+TPLH AA+ G+  +  +L++  AS    T +    L +A    +  V+  L
Sbjct:   53 AGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELV-----------------------------------TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTK-DGLTPLHCGARSGHE----QVVEMLLDRGAPILSK-TKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL-KHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHG---ASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDD-QTALHIASRLGKAEIVQLLLQKGAWASAA---TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDN-QRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKN-ANVNMG-NKNGLTPLHLAAQEDRVGVAEVLLNHGA-EVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 3 Score: 279.256 bits (713), Expect = 3.278e-75
Identity = 256/854 (29.98%), Postives = 397/854 (46.49%), Query Frame = 2
Query: 1208 KATKSARLQMDKEGA-ISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELV-----------------------SFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRF--KPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNN----NGTTPLHFASQNGHTNVTSILLGKSSNQIT 3673
            K  K +R Q  K  +  S + A  AG++    + LK   +   NI  + +G  A+H+A ++  VE +  L    A ++     G T LHIA+      +++ L +  A+VN       + L+MAA++ H ++V  L++      +  + +G T + V    GH +    LL          K     LH AA+         LL    N +  +K  +TPLHIA  YGN  V   L+  GA V+F     D +PLHVAA   NG    ++LL  GA ++   K+G + LH  +RSG+ ++++ LL  GA      K+G SPLH+  +  H   VQ L+                         Y   K  +D     N     G T +H A +  + +         ++++LL++   ++  T+ +  TP+H  A  G+ +++ ++ +          N     G + L  A+  G  ++V  LL+N A+VD+  +   TALH+A+  G   +  +LL   A+ +A +  G TPLHLA + G+++    L+ E+ A++ A T    TPLH+AA+YG+ E  + LL  +   A P  A   G TPLH+AA  D+  V  L L     P     A+ +G T  HIAA    L +    + F         N  T  G + LHLAA+ G   LV +LL   AN    N +G+T LHLAA+     + EVL    +      K+G TPLHVA HYG +  V  +L +  A I S+            T+SG TPLH A+Q GH +++ +LL       + A+ N    NG T L  A + G+ +V   L G +   +T
Sbjct:   29 KNRKHSREQKKKSDSNASYLRAARAGNLEKALDYLKTGVD--INICNQ-NGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARN-DITPLHVAAKRGNG-NMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVK---------VMELLLKHGASLQAVTE-SGLTPIHVAAFMGHENIVKQLTHH-----GASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLL-EHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR---AAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHA---AAKNGYTPLHIAAKKNQLEIGTTLLEFGAET-----NAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLEN-QAKINSK------------TKSGYTPLHQAAQQGHTHIINMLLQ------HRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLT 826          

HSP 4 Score: 243.047 bits (619), Expect = 4.619e-64
Identity = 222/743 (29.88%), Postives = 343/743 (46.16%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVP-----------LHMPNKTGSV----------------------CLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGA--QVNFKGGILDESPLHVAA--------------------TTKNGEKCAEM------------LLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAE---------LVQKRKHSD---------------FEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHK 2899
            L LA K+  +  V  LL++G + +   K G TALH A+     DVV+ L+   A+ N         P+++A          V+  L    +++    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D ++  LL   D NA +  K+G   T LHIAA   +  +   L +  A V+ +   D + LH+AA++G+  +V+LL+D+    +  + K+G T +H  + SGH +    LL RG P           LHM  +   +                       LH AA  GH  V K ++DK AN NA+  + +TPLHIA K     V+E L+ +GA  Q   + G+   +P+HVAA                    T   GE    M            LL++GA V+   K+ ++ALHIASR G  E+++ LLQ+GA  S     G +PLH+ VR  H    QE  S   +  + + A         +G T +H AA+         L+QKR   D               +++  +  +LL++        K    TPLH  A     ++   ++ F         N   + G SPL  A+  G  ++VS+LL  NA V++ +++G+T LHLAA++    VA VLL H A V+A +K G TPLH+A   G   +V  L+ EN+A +++ T +  TPLH AAQ G   +   LL H+
Sbjct:   80 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNA-QSQNGFTPLYMAAQENHLE---VVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL-------PALHIAARKDDTKSAALLLQNDHNADVESKSGF--TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDR-GAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGL---TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGH----QETASLLLEHGASLSAA------TKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAK-NGYTPLHIAAKKNQLEIGTTLLEFGAE-----TNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLL-ENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHR 788          

HSP 5 Score: 238.81 bits (608), Expect = 9.164e-63
Identity = 227/752 (30.19%), Postives = 341/752 (45.35%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGA--QVNFKGGILDESPLHVAA--------------------TTKNGEKCAEM------------LLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKP---ELLINASHDGMTCGHIAAANGSLAVI 3088
            TPL +A ++N L  V  LLE G + +   +DG T L  A +   + VV LLL      N   G  +   +H+A  +  T S  ++          LQ D                        A+ E +       SG   +HIA    ++    LL +  A ++       T LH+AA+  +  ++K L    A ++       + LH  A  GH ++VE+L+D+    +L++ K G + +H+ +   H      LL+  VP+          LH AA  GH  V K ++DK AN NA+  + +TPLHIA K     V+E L+ +GA  Q   + G+   +P+HVAA                    T   GE    M            LL++GA V+   K+ ++ALHIASR G  E+++ LLQ+GA  S     G +PLH+ VR  H    QE  S   +  + + A         +G T +H AA+  Q          +  K+LL+         K T  TPLH  A   N  V L +   L+H      +  AKNG++PL  A+     EI + LL+  A  +     G++ LHLAA++G  ++ ++LL   A VN  +K GLTPLHLAAQ     + E L+N   A VDA T    TPLH+A  YG  ++   LL ++   A   +    G TPLH AA+  H+ ++ + L+ +    EL +N    G T   IA   G ++V+
Sbjct:  144 TPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKSAALL----------LQNDH----------------------NADVESK-------SGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDR-GAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGL---TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGH----QETASLLLEHGASLSAA------TKKGFTPLHVAAKYGQ---------IEAAKLLLQKRAAPDTAGK-TGLTPLHVAAHYDNQRVALLL---LDHGAS--PHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHG-AEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQ---AKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLN----GNTALSIARRLGYISVV 814          

HSP 6 Score: 206.838 bits (525), Expect = 5.074e-53
Identity = 183/619 (29.56%), Postives = 278/619 (44.91%), Query Frame = 2
Query:  938 DETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCAT---AGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKL 2785
            D TPL +A K      V  LL+ G   +   KDG T LH  A+   E VV++LL + A P L        P+H+A   T       + LL         +  +   +L  A   G     K ++  +        K  +G   +HIAC+K  V+ + LL    A +      G T +H+AA    E I+K L    A  N  +    +ALHMAA  G   +V  L+      V  + K+  T +H+ S  G  E    LL++G        +G   LH A + GH      LL+ GA+++A TK  +TPLH+A KYG     + L+   A  +   G    +PLHVAA   N ++ A +LL  GA+ +   KNG + LHIA++   LE+  +LL+ GA+ + + + G SPLH+  +                                EG                      D++ +LL  + +V +  K    TPLH  A     G ++VLL       H  +  V+   K G++PL  A H G+ ++VS LL+N A+++   + G T LH AA++GH ++ N+LL H+A  N  +  G T L +A + GY  +V+ L
Sbjct:  270 DITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMA---TQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNA---KALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQN-GAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPD-TAGKTGLTPLHVAAHYDN-QRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQ--------------------------------EGSV--------------------DLVSLLLTKNANVNMGNK-NGLTPLHLAAQEDRVGVAEVLLN------HGAE--VDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 7 Score: 201.445 bits (511), Expect = 2.285e-51
Identity = 178/564 (31.56%), Postives = 263/564 (46.63%), Query Frame = 2
Query: 2513 KQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFK-------PELLINASHD---------------------GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTP---------------------------------LHVAAHYGQIDFVGEMLTDVPAN---------------IKSERPKTGEQM------KDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            K+  +  +  L A+  G+ E     LK    +++ +++G+ ALHLA+++GH  V   LL   A V+A +K G T LH+A+  G  D+V +L+  N A V+A + N  TPL++AAQ    EV R LL H    A    A   G TPL +A +  H  VV L L          P L I A  D                     G T  HIAA  G++ V    +    +V    +N     T LH+AA+ G+  +VK+LLD GA    +  DG+T LH  A+ GH  ++E+L  + +  +   K+G++P                                 LHVAAH G    V +++ D  AN                K  R K  E +         +TESGLTP+H+A+  GHEN+V+ L +  G   N+ TN  G T LH A++ G  +V   LL ++  ++  +    +TALH AS  G  E+  L + +GA  +A+   G+TPLH A + G+ +   LL+E GAS  A T     PL +AA +   E    LL+ +
Sbjct:   38 KKKSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVT-NGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHG---ASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARND---ITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYK-VAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTH-HGASPNT-TNVRGETALHMAARAGQADVVRYLL-QNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR 590          

HSP 8 Score: 135.961 bits (341), Expect = 2.764e-31
Identity = 121/396 (30.56%), Postives = 187/396 (47.22%), Query Frame = 2
Query:  932 ETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID-KFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSL 2116
            E+  TP+ +A        V +L   G +PN     G TALH AA+    DVV+ LL   A  ++     +   +H+A SR G +   ++ LL    +        G   L  A+  G   T   LL+         KK ++    +H+A +   +EA +LL    A  +     G T LH+AA  +++ +   L    A  +       + LH+AA+K   +I   L++   + N +TR  +G + +H+ +  G  +    LL +   ++M NK G   LH AAQ   V V + LL+ GA V+A TK  YTPLH+A  YGN  +V  L+   A++N K      +PLH AA  +       MLL+  A+ NE   NG +AL IA R G + ++ +L
Sbjct:  433 ESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTA-LHIA-SRLGKAE--IVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFT---PLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTR--QGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKS-GYTPLHQAA-QQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 9 Score: 120.168 bits (300), Expect = 1.429e-26
Identity = 99/312 (31.73%), Postives = 148/312 (47.44%), Query Frame = 2
Query: 3101 RFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLL-EVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL---------------------GKSSNQITRRDF-------KGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLL 3949
            R N+      K KS  + +   AA  G+ +     L  G +    N +G+  LHLA+K GH  ++ E+LK   S    + K G T LH+A+  GQ D V E++T+  AN+ ++            +++G TPL++A+Q  H  +VR LL     +  S    +G TPL  A Q GH  V S+LL                      KS+  + + D         G T LH A+ +G+I +A L + +GA ++       TPLH AAK G   + KLL++RGA  +A+T D   PL   A   H +V+  LL
Sbjct:   28 RKNRKHSREQKKKSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKK-GNTALHIASLAGQTDVVRELVTN-GANVNAQ------------SQNGFTPLYMAAQENHLEVVRFLLEHGASQ--SIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLL 323          

HSP 10 Score: 100.523 bits (249), Expect = 1.323e-20
Identity = 105/359 (29.25%), Postives = 154/359 (42.90%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRG-----------VPLHMP----------------------NKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIG 1918
            ET L +A +  +   V  LL+ G   +  AKD +TALH A++    ++V+LLL K A  +    ++   P+HLA       + +++    A+ SA     K+G   L  A + G I   K LL+      T  K   +G   +H+A    +     LL D  A  +     G T LHIAA+ N   I   L    A+ N +     S LH+AA++G   +V LL+ K   NV   +K G T +H+ +          LL  G            PLH+                        K+G   LH AAQ GH +++  LL   A+ N  T +  T L IA + G   VV+TL G
Sbjct:  469 ETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASA-ATTSGYTPLHLAVREGHQETASLLLEHGASLSA---ATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGK---TGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTK-NANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRG 819          

HSP 11 Score: 83.1889 bits (204), Expect = 2.552e-15
Identity = 76/262 (29.01%), Postives = 125/262 (47.71%), Query Frame = 2
Query: 3266 AAKYGHFH-LLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQ-ITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVE 4045
            AA+ G+    L+ LK  +   +  N++G+  LH+A+  G ++ V E+L            K G  + D  T+ G T LH+AS +G  ++VR L+  +G  VN A + NG TPL+ A+Q  H  V   LL   ++Q I   D  G T L  A   GH ++ +L +    + +    +    LH AA+    K   LL++   + + E+     PL +AAH+ +  V + LL    +   +  ND  +  L + +K  N   V+
Sbjct:   50 AARAGNLEKALDYLKTGVDINIC-NQNGLNALHLASKEGHVEVVAELL------------KLGASV-DAATKKGNTALHIASLAGQTDVVRELVT-NGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATED--GFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARND--ITPLHVAAKRGNGNMVK 287          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007334.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007334.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 404.445 bits (1038), Expect = 1.632e-123
Identity = 254/641 (39.63%), Postives = 362/641 (56.47%), Query Frame = 2
Query: 3476 ESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRR-DFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALA--AVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNW-KXXXXXXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYL--TFLLFYV-----PLLDAY--PCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVM--VQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILS-----GDYSNVPG----------VLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYR 5308
            +S LTPLHLA+Q+GHE+LVRLLLN    + +       TTPLH A Q GH  V  +LL +++  + R  D +G + LH A++ GH+E   L +GQGADINA+D  G TPLH AA++G L   + L+E GA   AE  D +  L  AA   H  V++ LLR  HST+       F++DLM+C +   F+ ++EF+LL+PAP E A KL+  F   + +EKERS DL   + HCQ + TDL +LA  +   GA  LL++VD  G+  LD+LIE  Q+ V +HP VQ +LSDVW G L WP+W    +    L+ P  W    LP+G +    P++KF+ +L SH++L   F+L  V     P+ + +  P + +   +T +  LLL  L             R  +A ++  +L     A++  +  L+F      + E +  RN LL+ A   C +  LDFLS HHLFGPW III DLM DL +F ++L IF ++F   L A  QP+       G+ S               L   V L+F+LFG      LPD   +P     L  A FG+ L++T+IVLINLLIAMM++TY+ IQA+SDT+WK+GR  L+R   + +  P+P N++TQL+    +   R
Sbjct:    1 QSSLTPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLR--HSTLTAQRLIHFVYDLMVCGRQCEFRVIDEFVLLAPAPLEAAVKLTRAFGAAALREKERSVDLDLAARHCQALATDLLSLAVGSQSAGAAALLQAVDERGLSLLDVLIECHQRAVAAHPAVQHHLSDVWRGGLRWPSWCPALLLLGFLVCPPLWVAFSLPLGHRFTRIPIIKFLCHLASHLFLLSLFVLTVVWPPITPIAEGHLLPSWNEWLLLTWLLGLLLAELRQGG--------SRFGLAWIRLLVLGLSGLALLCHLSALAFPAGSHALLECLCARNVLLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTALCQPVYPQGDPVGNSSTAAAAWDPSTAAQTTLDVTVLLFFSLFGMGDQNSLPDVSRSPSIVSTLVNATFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVLVREATRRTTPPAPLNVVTQLLWLLQRCACR 631          

HSP 2 Score: 79.337 bits (194), Expect = 5.672e-15
Identity = 64/211 (30.33%), Postives = 102/211 (48.34%), Query Frame = 2
Query: 1766 LHAAAQSGHVNVVKTLLDKGANVNARTKDLY------TPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE---SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKML 2371
            LH AAQ+GH ++V+ LL    N  +  +DL       TPLH+A + G+  V   L+   A    +   LD+   S LH+AAT  + E    +LL  GA++N T K+G + LH+A+R+G L  +++LL+ GA  S  C+DG + L       H  ++  L+     T  R+                +HF  +L+   +  +F   D   +L
Sbjct:    7 LHLAAQAGHESLVRLLL----NHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLR--TLDQRGHSCLHLAATAGHVET-LRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRL----------------IHFVYDLMVCGRQCEFRVIDEFVLL 194          

HSP 3 Score: 78.9518 bits (193), Expect = 6.178e-15
Identity = 62/165 (37.58%), Postives = 81/165 (49.09%), Query Frame = 2
Query: 2720 KGGLTPLHLAAQNGYKDLVEKLINENKATVD-ALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINAS-HDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLL 3208
            +  LTPLHLAAQ G++ LV  L+N      D        TPLHLA Q G   V   LL  +  P   +  D RG + LHLAA   H + +RL L    +  INA+   G T  H+AA  G L  ++  +   +S   G      G TAL  AA GGH  ++ +LL
Sbjct:    1 QSSLTPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVA-GLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGAD--INATDKSGCTPLHVAARAGRLPAVRALL---ESGAVGSAECRDGRTALEHAAGGGHRHVLALLL 159          

HSP 4 Score: 77.0258 bits (188), Expect = 3.003e-14
Identity = 45/126 (35.71%), Postives = 65/126 (51.59%), Query Frame = 2
Query: 1559 SALHMAAEKGHTKIVELLIDKFKCNV-LTRDKEGNTLMHVTSISGHPETTMSLLRRGVP--LHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGA 1927
            + LH+AA+ GH  +V LL++       L    +  T +H+    GH      LL R  P  L   ++ G  CLH AA +GHV  ++ LL +GA++NA  K   TPLH+A + G    V  L+  GA
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGA 130          

HSP 5 Score: 75.8702 bits (185), Expect = 6.705e-14
Identity = 49/156 (31.41%), Postives = 85/156 (54.49%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYL---QSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVL-TRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI 1915
            T LH+AA+   E++++ L    ST  D+        + LH+A + GH  +  LL+ +    +L T D+ G++ +H+ + +GH ET   LL +G  ++  +K+G   LH AA++G +  V+ LL+ GA  +A  +D  T L  A   G+  V+  L+
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQA-GPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLL 159          

HSP 6 Score: 72.0182 bits (175), Expect = 8.989e-13
Identity = 56/174 (32.18%), Postives = 84/174 (48.28%), Query Frame = 2
Query: 3239 NDGMTCLHLAAKYGHFHLLEVL--KPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGH-TNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFI 3751
               +T LHLAA+ GH  L+ +L   P     + +     TPLH+A   G     G +L+           +    +   L + G + LHLA+ +GH   +RLLL   G ++N AT+ +G TPLH A++ G    V ++L   +      RD  GRTAL  A+  GH  + AL +
Sbjct:    1 QSSLTPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLS-----------RAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLG-QGADIN-ATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRD--GRTALEHAAGGGHRHVLALLL 159          

HSP 7 Score: 71.2478 bits (173), Expect = 1.841e-12
Identity = 63/197 (31.98%), Postives = 94/197 (47.72%), Query Frame = 2
Query: 2534 SPLLFASHNGHHEIVSILLKNNARVDVFD--EHGMTALHLAAEKGHRNVANVLLLHKA--FVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSR-GQTPLHLAAKNDHSDVVRLFLR---FKPELLINASHDGMTCGHIAAANGSLAVIKEFM 3100
            +PL  A+  GH  +V +LL + +  +         T LHLA + GH  VA +LL   A   +    + G + LHLAA  G+ + +  L+ +  A ++A   +  TPLH+AA+ GR    R+LL          +A+ R G+T L  AA   H  V+ L LR      + LI+  +D M CG          VI EF+
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQG-ADINATDKSGCTPLHVAARAGRLPAVRALLESGAV----GSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRLIHFVYDLMVCGR----QCEFRVIDEFV 192          

HSP 8 Score: 70.4774 bits (171), Expect = 2.634e-12
Identity = 63/205 (30.73%), Postives = 86/205 (41.95%), Query Frame = 2
Query: 2942 TPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENND--GMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGE-QMKDVLTESGLTPLHLASQSGHENLVRLLLN 3547
            TPLHLAA+  H  +VRL L                                    + S    L+     +T LHLA +GGH  +  +LL   A P     D  G +CLHLAA  GH   L +L  + +    ++KSG TPLHVAA  G++  V  +L         E    G  + +D     G T L  A+  GH +++ LLL 
Sbjct:    5 TPLHLAAQAGHESLVRLLLN-----------------------------------HPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALL---------ESGAVGSAECRD-----GRTALEHAAGGGHRHVLALLLR 160          

HSP 9 Score: 65.0846 bits (157), Expect = 1.253e-10
Identity = 56/182 (30.77%), Postives = 92/182 (50.55%), Query Frame = 2
Query: 3152 TALHLAAEGGHHKLVKVLLDAGANPAEENN-----DGMTCLHLAAKYGHFHLLEVLKPKISFRVVS--NKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR 3676
            T LHLAA+ GH  LV++LL+   +P+ + +        T LHLA + GH  +  +L  + +  ++   ++ G + LH+AA  G ++ +  +L    A+I +              +SG TPLH+A+++G    VR LL      V SA   +G T L  A+  GH +V ++LL  S+    R
Sbjct:    5 TPLHLAAQAGHESLVRLLLN---HPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETL-RLLLGQGADINAT------------DKSGCTPLHVAARAGRLPAVRALLESGA--VGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQR 168          

HSP 10 Score: 62.7734 bits (151), Expect = 5.809e-10
Identity = 35/111 (31.53%), Postives = 62/111 (55.86%), Query Frame = 2
Query: 1859 TPLHIAVKYGNPGVVETLIGY-GAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETM-KNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVR 2185
            TPLH+A + G+  +V  L+ +   Q + + G    +PLH+A    +      +L ++   +  T+ + G S LH+A+ +G++E L+ LL +GAD +   K G +PLH+  R
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAAR 115          

HSP 11 Score: 52.7582 bits (125), Expect = 8.395e-7
Identity = 41/156 (26.28%), Postives = 69/156 (44.23%), Query Frame = 2
Query: 2354 DIIKMLLEYDGDVK-IQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDAL 2818
             ++++LL +    + +Q      TPLH     G++ V       L      ++    + G S L  A+  GH E + +LL   A ++  D+ G T LH+AA  G       LL   A  +A+ + G T L  AA  G++ ++  L+  +  T   L
Sbjct:   17 SLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAV---AGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRL 169          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007332.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 405.601 bits (1041), Expect = 1.746e-123
Identity = 267/723 (36.93%), Postives = 394/723 (54.50%), Query Frame = 2
Query: 3476 ESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRR-DFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALA--AVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNW-KXXXXXXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYL--TFLLFYV-----PLLDAY--PCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVM--VQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILS-----GDYSNVPG----------VLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIR----KRP----LYKEND--------------RKR----KFHIFENLLGDIAAL--KNEEDKLENVVNWNVIVRRYLSIRN 5470
            +S LTPLHLA+Q+GHE+LVRLLLN    + +       TTPLH A Q GH  V  +LL +++  + R  D +G + LH A++ GH+E   L +GQGADINA+D  G TPLH AA++G L   + L+E GA   AE  D +  L  AA   H  V++ LLR  HST+       F++DLM+C +   F+ ++EF+LL+PAP E A KL+  F   + +EKERS DL   + HCQ + TDL +LA  +   GA  LL++VD  G+  LD+LIE  Q+ V +HP VQ +LSDVW G L WP+W    +    L+ P  W    LP+G +    P++KF+ +L SH++L   F+L  V     P+ + +  P + +   +T +  LLL  L             R  +A ++  +L     A++  +  L+F      + E +  RN LL+ A   C +  LDFLS HHLFGPW III DLM DL +F ++L IF ++F   L A  QP+       G+ S               L   V L+F+LFG      LPD   +P     L  A FG+ L++T+IVLINLLIAMM++TY+ IQA+SDT+WK+GR  L+R   + +  P+P N++TQL+    +   R      ++P    L+K                 R+R     F I   +L +   +  + +  ++E+V++W  + +RY +++ 
Sbjct:    1 QSSLTPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLR--HSTLTAQRLIHFVYDLMVCGRQCEFRVIDEFVLLAPAPLEAAVKLTRAFGAAALREKERSVDLDLAARHCQALATDLLSLAVGSQSAGAAALLQAVDERGLSLLDVLIECHQRAVAAHPAVQHHLSDVWRGGLRWPSWCPALLLLGFLVCPPLWVAFSLPLGHRFTRIPIIKFLCHLASHLFLLSLFVLTVVWPPITPIAEGHLLPSWNEWLLLTWLLGLLLAELRQGG--------SRFGLAWIRLLVLGLSGLALLCHLSALAFPAGSHALLECLCARNVLLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTALCQPVYPQGDPVGNSSTAAAAWDPSTAAQTTLDVTVLLFFSLFGMGDQNSLPDVSRSPSIVSTLVNATFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVLVREATRRTTPPAPLNVVTQLLWLLQRCACRKACKKIQQPCSVTLFKVGQTITQGSSLDSAWISRERYNGVSFSIHLVVLAESQRVGERLQPCRIEDVLDWRAVAQRYRAMKG 713          

HSP 2 Score: 79.337 bits (194), Expect = 5.727e-15
Identity = 62/165 (37.58%), Postives = 81/165 (49.09%), Query Frame = 2
Query: 2720 KGGLTPLHLAAQNGYKDLVEKLINENKATVD-ALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINAS-HDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLL 3208
            +  LTPLHLAAQ G++ LV  L+N      D        TPLHLA Q G   V   LL  +  P   +  D RG + LHLAA   H + +RL L    +  INA+   G T  H+AA  G L  ++  +   +S   G      G TAL  AA GGH  ++ +LL
Sbjct:    1 QSSLTPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVA-GLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGAD--INATDKSGCTPLHVAARAGRLPAVRALL---ESGAVGSAECRDGRTALEHAAGGGHRHVLALLL 159          

HSP 3 Score: 78.9518 bits (193), Expect = 7.335e-15
Identity = 64/211 (30.33%), Postives = 102/211 (48.34%), Query Frame = 2
Query: 1766 LHAAAQSGHVNVVKTLLDKGANVNARTKDLY------TPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE---SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKML 2371
            LH AAQ+GH ++V+ LL    N  +  +DL       TPLH+A + G+  V   L+   A    +   LD+   S LH+AAT  + E    +LL  GA++N T K+G + LH+A+R+G L  +++LL+ GA  S  C+DG + L       H  ++  L+     T  R+                +HF  +L+   +  +F   D   +L
Sbjct:    7 LHLAAQAGHESLVRLLL----NHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLR--TLDQRGHSCLHLAATAGHVET-LRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRL----------------IHFVYDLMVCGRQCEFRVIDEFVLL 194          

HSP 4 Score: 77.0258 bits (188), Expect = 2.973e-14
Identity = 45/126 (35.71%), Postives = 65/126 (51.59%), Query Frame = 2
Query: 1559 SALHMAAEKGHTKIVELLIDKFKCNV-LTRDKEGNTLMHVTSISGHPETTMSLLRRGVP--LHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGA 1927
            + LH+AA+ GH  +V LL++       L    +  T +H+    GH      LL R  P  L   ++ G  CLH AA +GHV  ++ LL +GA++NA  K   TPLH+A + G    V  L+  GA
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGA 130          

HSP 5 Score: 75.485 bits (184), Expect = 7.469e-14
Identity = 49/156 (31.41%), Postives = 85/156 (54.49%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYL---QSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVL-TRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI 1915
            T LH+AA+   E++++ L    ST  D+        + LH+A + GH  +  LL+ +    +L T D+ G++ +H+ + +GH ET   LL +G  ++  +K+G   LH AA++G +  V+ LL+ GA  +A  +D  T L  A   G+  V+  L+
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQA-GPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLL 159          

HSP 6 Score: 72.4034 bits (176), Expect = 7.658e-13
Identity = 56/174 (32.18%), Postives = 84/174 (48.28%), Query Frame = 2
Query: 3239 NDGMTCLHLAAKYGHFHLLEVL--KPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGH-TNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFI 3751
               +T LHLAA+ GH  L+ +L   P     + +     TPLH+A   G     G +L+           +    +   L + G + LHLA+ +GH   +RLLL   G ++N AT+ +G TPLH A++ G    V ++L   +      RD  GRTAL  A+  GH  + AL +
Sbjct:    1 QSSLTPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLS-----------RAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLG-QGADIN-ATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRD--GRTALEHAAGGGHRHVLALLL 159          

HSP 7 Score: 71.2478 bits (173), Expect = 1.514e-12
Identity = 63/197 (31.98%), Postives = 94/197 (47.72%), Query Frame = 2
Query: 2534 SPLLFASHNGHHEIVSILLKNNARVDVFDE--HGMTALHLAAEKGHRNVANVLLLHKA--FVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSR-GQTPLHLAAKNDHSDVVRLFLR---FKPELLINASHDGMTCGHIAAANGSLAVIKEFM 3100
            +PL  A+  GH  +V +LL + +  +         T LHLA + GH  VA +LL   A   +    + G + LHLAA  G+ + +  L+ +  A ++A   +  TPLH+AA+ GR    R+LL          +A+ R G+T L  AA   H  V+ L LR      + LI+  +D M CG          VI EF+
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQG-ADINATDKSGCTPLHVAARAGRLPAVRALLESGAV----GSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRLIHFVYDLMVCGR----QCEFRVIDEFV 192          

HSP 8 Score: 70.8626 bits (172), Expect = 2.093e-12
Identity = 63/205 (30.73%), Postives = 86/205 (41.95%), Query Frame = 2
Query: 2942 TPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENND--GMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGE-QMKDVLTESGLTPLHLASQSGHENLVRLLLN 3547
            TPLHLAA+  H  +VRL L                                    + S    L+     +T LHLA +GGH  +  +LL   A P     D  G +CLHLAA  GH   L +L  + +    ++KSG TPLHVAA  G++  V  +L         E    G  + +D     G T L  A+  GH +++ LLL 
Sbjct:    5 TPLHLAAQAGHESLVRLLLN-----------------------------------HPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALL---------ESGAVGSAECRD-----GRTALEHAAGGGHRHVLALLLR 160          

HSP 9 Score: 65.4698 bits (158), Expect = 8.876e-11
Identity = 56/182 (30.77%), Postives = 92/182 (50.55%), Query Frame = 2
Query: 3152 TALHLAAEGGHHKLVKVLLDAGANPAEENN-----DGMTCLHLAAKYGHFHLLEVLKPKISFRVVS--NKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR 3676
            T LHLAA+ GH  LV++LL+   +P+ + +        T LHLA + GH  +  +L  + +  ++   ++ G + LH+AA  G ++ +  +L    A+I +              +SG TPLH+A+++G    VR LL      V SA   +G T L  A+  GH +V ++LL  S+    R
Sbjct:    5 TPLHLAAQAGHESLVRLLLN---HPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETL-RLLLGQGADINAT------------DKSGCTPLHVAARAGRLPAVRALLESGA--VGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQR 168          

HSP 10 Score: 63.1586 bits (152), Expect = 5.870e-10
Identity = 35/111 (31.53%), Postives = 62/111 (55.86%), Query Frame = 2
Query: 1859 TPLHIAVKYGNPGVVETLIGY-GAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETM-KNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVR 2185
            TPLH+A + G+  +V  L+ +   Q + + G    +PLH+A    +      +L ++   +  T+ + G S LH+A+ +G++E L+ LL +GAD +   K G +PLH+  R
Sbjct:    5 TPLHLAAQAGHESLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAAR 115          

HSP 11 Score: 52.373 bits (124), Expect = 9.727e-7
Identity = 41/156 (26.28%), Postives = 69/156 (44.23%), Query Frame = 2
Query: 2354 DIIKMLLEYDGDVK-IQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDAL 2818
             ++++LL +    + +Q      TPLH     G++ V       L      ++    + G S L  A+  GH E + +LL   A ++  D+ G T LH+AA  G       LL   A  +A+ + G T L  AA  G++ ++  L+  +  T   L
Sbjct:   17 SLVRLLLNHPSTQEDLQAGPQATTPLHLACQGGHAAV---AGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRL 169          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 295.819 bits (756), Expect = 1.420e-84
Identity = 237/785 (30.19%), Postives = 386/785 (49.17%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST---GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTD------------VPANIKSER----------PKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            +G+ E  M  L+ G+ ++  N+ G   LH A++ GHV+VV  LL + A ++  TK   T LHIA   G   +V  L+ +G                                   AN+N   +NG + L++A++  +LE++K LL  GA+ S+  +DG +PL + ++  H  +V  L+    K K R+ A+              H AA     RK    +DT+   +LL+++ +  + +K +  TPLH  A  GN +V   ++N     +   V+  A+NG +PL  A+  G++ +V +LL   A++D     G+T LH AA  GH  V  +LL   A + AK+K GL+PLH+A Q  +   V+ L+   +A VD +TL+  TPLH+AA  G   V + LL       +P A    G TPLH+A K +   V+ L L+    +    +  G+T  H+A+  G L V++  ++      +G  + +T   G T LH+A+  G  ++VK LL +GA    +  +  T LH+A++ G   ++++L  + S       SG TPL+ A+  G  D    +L +             P +I S+            K       V  ++GLTPLH+A+   H+ +  LLL+  G   +S T  NG TPLH A++     V  +LL  G  +N +T+   +G   LH A+  GH +M AL +G+ A I+ +   G T +H AA+   + V ++L +  A     T     PL +A+H+ + ++++FLLRN+
Sbjct:   21 NGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFG-----------------------------------ANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPAL--------------HIAA-----RK----DDTNAAALLLQHEHNADVTSK-SGFTPLHIAAHYGNMNVATLLLN-----LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGR-QAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRG---GEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTT-TESGLTPIHVASFMGHLNVVQLLLQ------NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLD-KGASPHS-TAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQ---QGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNR 725          

HSP 2 Score: 281.567 bits (719), Expect = 1.037e-79
Identity = 247/837 (29.51%), Postives = 399/837 (47.67%), Query Frame = 2
Query: 1433 INMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI-------------------------------GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            ++ ++    + L  A  GN E ++ +L+  + D+N  +    +ALH+A+++GH  +V  L+ K +  + T  K GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ +VK LLD GAN +  T+D +TPL +A++ G+  VV  L+                                + A V  K G    +PLH+AA   N    A +LL  GA V+ T +NG + LH+A++ GN  M+K LL  GA      +DG +PLH   R  H  +++ L+          DA +L    N  G + +H A +          E    +++LL     V  +   Y   TPLH  A  G+  V   +++          N +A NG++PL  A      +++ +LLK+ A +    E G+T +H+A+  GH NV  +LL + A  NA +  G TPLH+A++ G  ++V+ L+ ++ A V       +TPLH+A++ G+ E+ + LL      +DP A  + G TPL+ A++  H DV  L L    + +   +  G T  HIA+  G L V    +    S    +  ++ G T LH+A    H K+  +LLD GA+P     +G T LH+AAK     + +VL    +   +  + G+ PLH+AA  G  D V  +L    A+I             + T+ GLT +HLA+Q    N+  +L      +VN+ T     TPLH AS  G+  + + LL ++   +  +   G T LH A+  GH  +    +   A  N     G T L  A + GY+ V   L
Sbjct:    5 LSFQSDAATSFLRAARNGNLERLMDHLKGGM-DINTCNQNGLNALHLASKEGHVDVVTELL-KREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGF---TPLHIAAHYGN-MNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER--------DAPILAKTKN--GLSPLHMATQ---------GEHLACVQLLLGRQAPVDDVTLDYL--TPLHVAAHCGHYRVAKLLLDRGGEP-----NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL-QSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRG---SDPNAPTASGSTPLYFASREGHGDVASLLLENGAD-ISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQN-GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVA-LLLGRHASI------------SLATKGGLTAMHLAAQEDKVNVAEILTKHK-ADVNT-TTKLCYTPLHVASHYGNIKMVNFLL-RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 3 Score: 279.256 bits (713), Expect = 5.951e-79
Identity = 257/838 (30.67%), Postives = 386/838 (46.06%), Query Frame = 2
Query: 1229 LQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVL--------------------LEIVNFLEH--KIQLVVNKQAKN------GWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            L    + A S + A   G++  + + LK   +  T      +G  A+H+A ++  V+ +  L    A+I+    +G T LHIAA      I++ L    A++N       + L+MAA++ H +IV+ L+D    N     ++G T + V    GH +    LL          K     LH AA+    N    LL    N +  +K  +TPLHIA  YGN  V   L+  GA V+F  + GI   +PLHVAA   N     ++LL  GA ++   ++G + LH A+RSG+ ++++ LL+  A      K+G SPLH+  +  H   VQ L+      ++ +D + L  L      T +H AA     R         + K+LL+  G+   +      TPLH         V+                    + + +F+ H   +QL++   A +      G +PL  AS  G  E+V  LL++ ARV V      T LH+A+  G   +  +LL   +  NA +  G TPL+ A++ G+ D V  L+ EN A +  +T    TPLH+A++YGR EV  +LL  K   ADPK A   G TPLH+A   DH  V  L L  K     + + +G T  HIAA    L V K  +           N  T  G   LHLAA+ GH  +V +LL   A+ +     G+T +HLAA+    ++ E+L    +    + K   TPLHVA+HYG I  V  +L +               + +  T +G TPLH A+Q GH ++V  LL  +    N  T  NG T L  A + G+ +V   L
Sbjct:    5 LSFQSDAATSFLRAARNGNLERLMDHLKGGMDINTC---NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDN-GANQSVATEDGFTPLAVALQQGHEQVVGLLLESDT----KGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGI---TPLHVAAKRGN-NNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLG----RQAPVDDVTLDYL------TPLHVAAHCGHYR---------VAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGD-VASLLLENGADISPVTKKGFTPLHIASKYGRLEVA-TLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLD-KGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAET-----NMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRN-------------RALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE-ASPNELT-ANGNTALAIARRLGYISVVDTL 787          

HSP 4 Score: 252.292 bits (643), Expect = 5.830e-70
Identity = 241/793 (30.39%), Postives = 371/793 (46.78%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV-----------PLHMPNKTGSVC----------------------LHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQA-KNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVL 3205
            L LA K+  +  V  LL+     +   K G TALH AA     D+V++L+   A+ N         P+++A          ++  L    + +    ++G   L  A++ G    +  LL+++ + +  +        A+HIA RK D  A  LL   + NA +  K+G   T LHIAA   +  +   L +  A V+       + LH+AA++G+  +V+LL+D+    + T+ ++G T +H  + SGH +    LL R             PLHM  +   +                       LH AA  GH  V K LLD+G   NAR  + +TPLHIA K     V+E L+ +GA ++   + G+   +P+HVA+   +     ++LL++GA+ N T   GE+ LH+ASR+G LE++K+LLQ GA   +  ++  +PLHI  R     IVQ L+   +            N P   G T ++FA+    +  H      D+  +LLE   D+   TK    TPLH  +  G     LE+   L  K      K A +NG +PL  A+H  H ++  +LL   A      ++G T LH+AA+K    V  VLL   A  N  ++ G+ PLHLAAQ G+ D+V  L+  + A++   T    T +HLAAQ  +  V   L  HK   AD         TPLH+A+   +  +V   LR +   L+NA + +G T  H AA  G   V+   ++   S      N+ T  G+TAL +A   G+  +V  L
Sbjct:   48 LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANIN-AQSQNGFTPLYMAAQENHLE---IVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLP-------ALHIAARKDDTNAAALLLQHEHNADVTSKSGF--TPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDR-GAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGL---TPIHVASFMGH-LNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP----------NAPTASGSTPLYFAS----REGHG-----DVASLLLENGADISPVTK-KGFTPLHIASKYGR----LEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRH-ASISLATKGGLTAMHLAAQEDKVNVAEILTKHK---ADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA--LVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS-----PNELTANGNTALAIARRLGYISVVDTL 787          

HSP 5 Score: 143.665 bits (361), Expect = 8.294e-35
Identity = 131/474 (27.64%), Postives = 211/474 (44.51%), Query Frame = 2
Query:  902 EKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSR-----------------TGTSSG-------------TVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKF-KCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELV 2218
            E+  P     +   +PL +A +   L  V  LL      +DV  D  T LH AA      V KLLL +  +PN     G T   P+H+AC +                 T T SG              V+ LL    ++    +  G   L  A  AG +  +K LL++        ++  +    +HIA R    E ++LL    +  N     G T L+ A+      +   L    AD++ +     + LH+A++ G  ++  LL++K+   +     + G T +HV +   H +  + LL +G   H   K G   LH AA+   + V K LL+ GA  N  T+    PLH+A + G+  +V  L+G  A ++   KGG+   + +H+AA  ++    AE+L K  A+VN T K   + LH+AS  GN++M+  LL+  A  +   ++G +PLH   +  H  +V  L+
Sbjct:  292 ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFT---PLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQT---PLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGL---TAMHLAA-QEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 755          

HSP 6 Score: 127.872 bits (320), Expect = 5.991e-30
Identity = 124/396 (31.31%), Postives = 180/396 (45.45%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK--GGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSL 2116
            ETPL +A +  +L  V  LL+ G      A++ +T LH A++    ++V+LLL + +DPN     GST   P++ A SR G   G V SLL    +    + K+G   L  A + G +     LL+        +  + +G   +H+A      +   LL D  A  +     G T LHIAA+ N   + K L    A+ N+L     + LH+AA++GH  +V LL+ +                   SIS                 +  K G   +H AAQ   VNV + L    A+VN  TK  YTPLH+A  YGN  +V  L+   A VN K   G    +PLH AA  +        LL+  A+ NE   NG +AL IA R G + ++ +L
Sbjct:  437 ETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGST---PLYFA-SREG--HGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ-NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRH-----------------ASIS-----------------LATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGY---TPLHQAA-QQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 7 Score: 105.145 bits (261), Expect = 7.267e-23
Identity = 105/354 (29.66%), Postives = 162/354 (45.76%), Query Frame = 2
Query:  857 GEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKAD--PNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETL 1912
            G+   V+ LL+S ++     K R+   D+TPL +A +  +   V  LL+ G +PN     G T L++A++    DV  LLL   AD  P    G T   P+H+A S+ G      + L K   +      + G   L  A           LL       +  K  Y+    +HIA +K  +E  ++L +  A+ NM    G   LH+AA+     ++  L    A +++      +A+H+AA++    + E+L  K K +V T  K   T +HV S  G+ +    LLR    ++   + G   LH AAQ GH +VV  LL   A+ N  T +  T L IA + G   VV+TL
Sbjct:  447 GQLEVVKTLLQSGARVGV--KARE---DQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFT---PLHIA-SKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYT---PLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILT-KHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 294.278 bits (752), Expect = 1.254e-83
Identity = 239/783 (30.52%), Postives = 387/783 (49.43%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST---GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTD----VPANIKSERP-----KTGE-QMKDVLTE----------SGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            +G+ E  M  L+ G+ ++  N+ G   LH A++ GHV+VV  LL + A ++  TK   T LHIA   G   +V  L+ +G                                   AN+N   +NG + L++A++  +LE++K LL  GA+ S+  +DG +PL + ++  H  +V  L+    K K R+ A+ +    ++      + AA L+Q   ++D       KM+L        QT  +  TPLH  A  GN +V   ++N     +   V+  A+NG +PL  A+  G++ +V +LL   A++D     G+T LH AA  GH  V  +LL   A + AK+K GL+PLH+A Q  +   V+ L+   +A VD +TL+  TPLH+AA  G   V + LL       +P A    G TPLH+A K +   V+ L L+    +    +  G+T  H+A+  G L V++  ++      +G  + +T   G T LH+A+  G  ++VK LL +GA    +  +  T LH+A++ G   ++++L  + S       SG TPL+ A+  G  D    +L +     P   K   P     K G  ++  +L E          +GLTPLH+A+   H+ +  LLL+  G   +S T  NG TPLH A++     V  +LL  G  +N +T+   +G   LH A+  GH +M AL +G+ A I+ +   G T +H AA+   + V ++L +  A     T     PL +A+H+ + ++++FLLRN+
Sbjct:   20 NGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFG-----------------------------------ANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDD-----TNAAALLLQHEHNADVTS----KMMLN-------QTTESGFTPLHIAAHYGNMNVATLLLN-----LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGR-QAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRG---GEPNARALNGFTPLHIACKKNRIKVMELLLKHGASI-HTTTESGLTPIHVASFMGHLNVVQLLLQ------NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLD-KGASPHS-TAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQ---QGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNR 730          

HSP 2 Score: 277.715 bits (709), Expect = 4.811e-78
Identity = 250/840 (29.76%), Postives = 399/840 (47.50%), Query Frame = 2
Query: 1442 KNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI-------------------------------GYGAQVNFKGGILDE------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDV-KIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            K+    + L  A  GN E ++ +L+  + D+N  +    +ALH+A+++GH  +V  L+ K +  + T  K GNT +H+ +++G  +    L+  G  ++  ++ G   L+ AAQ  H+ +VK LLD GAN +  T+D +TPL +A++ G+  VV  L+                                + A V  K  +L++      +PLH+AA   N    A +LL  GA V+ T +NG + LH+A++ GN  M+K LL  GA      +DG +PLH   R  H  +++ L+          DA +L    N  G + +H A +          E    +++LL     V  +   Y   TPLH  A  G+  V   +++          N +A NG++PL  A      +++ +LLK+ A +    E G+T +H+A+  GH NV  +LL + A  NA +  G TPLH+A++ G  ++V+ L+ ++ A V       +TPLH+A++ G+ E+ + LL      +DP A  + G TPL+ A++  H DV  L L    + +   +  G T  HIA+  G L V    +    S     KN   G T LH+A    H K+  +LLD GA+P     +G T LH+AAK     + +VL    +   +  + G+ PLH+AA  G  D V  +L    A+I             + T+ GLT +HLA+Q    N+  +L      +VN+ T     TPLH AS  G+  + + LL ++   +  +   G T LH A+  GH  +    +   A  N     G T L  A + GY+ V   L
Sbjct:    7 KSDAATSFLRAARNGNLERLMDHLKGGM-DINTCNQNGLNALHLASKEGHVDVVTELL-KREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSK-MMLNQTTESGFTPLHIAAHYGN-MNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER--------DAPILAKTKN--GLSPLHMATQ---------GEHLACVQLLLGRQAPVDDVTLDYL--TPLHVAAHCGHYRVAKLLLDRGGEP-----NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL-QSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRG---SDPNAPTASGSTPLYFASREGHGDVASLLLENGAD-ISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKN---GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVA-LLLGRHASIS------------LATKGGLTAMHLAAQEDKVNVAEILTKHK-ADVNT-TTKLCYTPLHVASHYGNIKMVNFLL-RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 3 Score: 267.314 bits (682), Expect = 1.216e-74
Identity = 258/845 (30.53%), Postives = 389/845 (46.04%), Query Frame = 2
Query: 1235 MDK-EGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGAN--------VNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVL--------------------LEIVNFLEH--KIQLVVNKQAKN------GWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            +DK + A S + A   G++  + + LK   +  T      +G  A+H+A ++  V+ +  L    A+I+    +G T LHIAA      I++ L    A++N       + L+MAA++ H +IV+ L+D    N     ++G T + V    GH +    LL          K     LH AA+    N    LL    N        +N  T+  +TPLHIA  YGN  V   L+  GA V+F  + GI   +PLHVAA   N     ++LL  GA ++   ++G + LH A+RSG+ ++++ LL+  A      K+G SPLH+  +  H   VQ L+      ++ +D + L  L      T +H AA     R         + K+LL+  G+   +      TPLH         V+                    + + +F+ H   +QL++   A +      G +PL  AS  G  E+V  LL++ ARV V      T LH+A+  G   +  +LL   +  NA +  G TPL+ A++ G+ D V  L+ EN A +  +T    TPLH+A++YGR EV  +LL  K   ADPK  +  G TPLH+A   DH  V  L L  K     + + +G T  HIAA    L V K  +           N  T  G   LHLAA+ GH  +V +LL   A+ +     G+T +HLAA+    ++ E+L    +    + K   TPLHVA+HYG I  V  +L +               + +  T +G TPLH A+Q GH ++V  LL  +    N  T  NG T L  A + G+ +V   L
Sbjct:    5 LDKSDAATSFLRAARNGNLERLMDHLKGGMDINTC---NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDN-GANQSVATEDGFTPLAVALQQGHEQVVGLLLESDT----KGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGI---TPLHVAAKRGN-NNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLG----RQAPVDDVTLDYL------TPLHVAAHCGHYR---------VAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGD-VASLLLENGADISPVTKKGFTPLHIASKYGRLEVA-TLLLEKYASADPKGKN--GLTPLHVATHYDHQKVALLLLD-KGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAET-----NMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRN-------------RALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE-ASPNELT-ANGNTALAIARRLGYISVVDTL 792          

HSP 4 Score: 256.529 bits (654), Expect = 4.354e-71
Identity = 233/794 (29.35%), Postives = 391/794 (49.24%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLC--DANAQINMKNGMGQTV------LHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHD-GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL 3304
            L LA K+  +  V  LL+     +   K G TALH AA     D+V++L+   A+ N         P+++A          ++  L    + +    ++G   L  A++ G    +  LL+++ + +  +        A+HIA RK D  A  LL   + NA +  K  + QT       LHIAA   +  +   L +  A V+       + LH+AA++G+  +V+LL+D+    + T+ ++G T +H  + SGH +    LL R  P+    K G   LH A Q  H+  V+ LL + A V+  T D  TPLH+A   G+  V + L+  G + N +  +   +PLH+A   KN  K  E+LLK GA+++ T ++G + +H+AS  G+L +++ LLQ GA  +     G +PLH+  R     +V+ L+    ++ +R      V +   E +T +H A+ L +          +I+++LL+   D    T  +  TPL++ +  G+ DV       LE+     ++   K G++PL  AS  G  E+ ++LL+  A  D   ++G+T LH+A    H+ VA +LL   A  ++ +K G TPLH+AA+    + V K++ E  A  + LT     PLHLAAQ G  ++   LL      A    A   G T +HLAA+ D  +V  +  + K +  +N +     T  H+A+  G++ ++   +R N+++++       G T LH AA+ GH  +V  LL   A+P E   +G T L +A + G+  +++ L
Sbjct:   47 LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANIN-AQSQNGFTPLYMAAQENHLE---IVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLP-------ALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDR-GAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNAR-ALNGFTPLHIAC-KKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL----QSGAR------VGVKAREDQTPLHIASRLGK---------AEIVQLLLQRGSDPNAPTA-SGSTPLYFASREGHGDV---ASLLLENGAD--ISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLE-VGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRH---ASISLATKGGLTAMHLAAQEDKVNVAEILTKHKAD--VNTTTKLCYTPLHVASHYGNIKMVNFLLR-NRALVNA--KTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 5 Score: 255.758 bits (652), Expect = 8.194e-71
Identity = 233/759 (30.70%), Postives = 353/759 (46.51%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKST--GSTALHLAAEGGHHKLVKVL 3205
            TPL +A ++N L  V  LL+ G N +   +DG T L  A +   E VV LLL          G  +   +H+A  +                      D   A +L+   E  +  T K +L    E         SG   +HIA    ++    LL +  A ++     G T LH+AA+  +  ++K L    A ++       + LH AA  GH K++E+L+++    +L + K G + +H+ +   H      LL R  P+          LH AA  GH  V K LLD+G   NAR  + +TPLHIA K     V+E L+ +GA ++   + G+   +P+HVA+   +     ++LL++GA+ N T   GE+ LH+ASR+G LE++K+LLQ GA   +  ++  +PLHI  R     IVQ L+   +            N P   G T ++FA+    +  H      D+  +LLE   D+   TK    TPLH  +  G     LE+   L  K     + + KNG +PL  A+H  H ++  +LL   A      ++G T LH+AA+K    V  VLL   A  N  ++ G+ PLHLAAQ G+ D+V  L+  + A++   T    T +HLAAQ  +  V   L  HK   AD         TPLH+A+   +  +V   LR +   L+NA + +G T  H AA  G   V+   ++   S      N+ T  G+TAL +A   G+  +V  L
Sbjct:  111 TPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK-----GKVRLPALHIAARK----------------------DDTNAAALLLQHEHNADVTSKMMLNQTTE---------SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGL---TPIHVASFMGH-LNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP----------NAPTASGSTPLYFAS----REGHG-----DVASLLLENGADISPVTK-KGFTPLHIASKYGR----LEVATLLLEKYA-SADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRH-ASISLATKGGLTAMHLAAQEDKVNVAEILTKHK---ADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA--LVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS-----PNELTANGNTALAIARRLGYISVVDTL 792          

HSP 6 Score: 198.749 bits (504), Expect = 3.749e-52
Identity = 193/687 (28.09%), Postives = 323/687 (47.02%), Query Frame = 2
Query:  854 KGEWGNVEALLRSYSKEK-PLPKY----RDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCH----YLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSL 2887
            +G    V  LL S +K K  LP      R  +T+   L+L  + N  +    +L      N   + G T LH AA +   +V  LLL   A  + F       P+H+A  R    +  ++ LL    +      ++G   L  A  +G    I+ LL+ +      + K  +G + +H+A + + +  ++LL    A ++       T LH+AA      + K L     + N       + LH+A +K   K++ELL+ K   ++ T  + G T +HV S  GH      LL+ G   +  N  G   LH A+++G + VVKTLL  GA V  + ++  TPLHIA + G   +V+ L+  G+  N        +PL+ A+   +G+  A +LL++GA+++   K G + LHIAS+ G LE+   LL++ A      K+G +PLH+   Y H     L++ +  S ++  K+              G T +H AA+  Q          ++ K+LLE   +  + T+     PLH  A  G++D++  ++          ++   K G + +  A+      +  IL K+ A V+   +   T LH+A+  G+  + N LL ++A VNAK++ G TPLH AAQ G+  +V  L+ +++A+ + LT N  T L +A + G   V  +L
Sbjct:  152 QGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMML------NQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVD-FTARNGITPLHVAAKR---GNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI---LAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLL-KHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTAS-GSTPLYFASREGHGD-VASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKN--------------GYTPLHIAAKKNQ---------LEVGKVLLELGAETNMLTQQG-VAPLHLAAQEGHADMVALLLGR-----HASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL-QHEASPNELTANGNTALAIARRLGYISVVDTL 792          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 3.259e-74
Identity = 252/897 (28.09%), Postives = 397/897 (44.26%), Query Frame = 2
Query: 1367 IHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQV----------------NFKGGILDE----------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSR-IDAMMLVNLPNNEGETAVHFAAELVQKRKH---SDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKG----------------------HRNVANV------LLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKA-TVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIK---EFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR-RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLV 3850
            +H A    + E + LL  + A++N K+    T LH A     E  ++ L    ADVN  D   ++ LH+AA     K  E +I     + ++ D+ G T +H  + +GH E    L+ +G  ++  +K     +H AA  GH  VVK L+  GA+V  + K  Y+PLH A   G  GVV+ L+  G  +                N +  +++E                +PLH AA + +G  C E+L+ +GA+VN   K+G+S LH+ +  G     ++L+Q G +     +DGN+PLHI  RY H L++  L++    T  R I  M  ++L    G +       L   +K+   S F +  ++    E D   +        T LH  A+ GN    +E +N L       +NK+ +   + L +A+ N + + V  L+ + AR++  DE   T LH AA                         H   +        LL   A    + K G TP+H AA  G++  +E L+ +  A   D  + +  +PLHLAA +G       L+   +   D    +  G TPL LAA   H+D VR+ ++    +L+    D  T  H AA NG +  ++   E    N++V     N+    T + LA   GH     +LL  GA+   ++N G T LH  A  GH   +++L  +     +  + G  PLH+AA  G +  +  +   V A + S  P        +   +G TPLH A  +GH+  V LLL  D   V      N  +PLH A  N + +   +L+     +I    D KGR  LH A+   H+E   L +   A +N +D  G +PL  A ++G     ++LV
Sbjct:   43 LHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVS-DRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDC-CRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFG-----RTCLHAAASGGN----VECLNLLL-STGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLV---DLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANE---QTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSAL---VQAAMASGAPIP------LTDRNGYTPLHWACYNGHDGCVELLLELD---VFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLV 909          

HSP 2 Score: 256.914 bits (655), Expect = 3.345e-70
Identity = 252/926 (27.21%), Postives = 404/926 (43.63%), Query Frame = 2
Query: 1367 IHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSR-IDAMMLVNLPNNEGETAVHFAAELVQKRKHS---DFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKG----------------------HRNVANV------LLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKA-TVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIK---EFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNC---DGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQ-GADI-NASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSK 4021
            +H AC  +   A++ L   +A +N ++   QT LH+AA        + +   ++  NV D   R+ALH AA  GH+++V  L+ K   N+   DK+    +H  +  GH E    L+  G  +   +K G   LHAA+ SG + VVK LLD G +++       T LH+A   G   VV  LI  GA VN +      +PLH AA + +G  C E+L+ +GA+VN   K+G+S LH+ +  G     ++L+Q G +     +DGN+PLHI  RY H L++  L++    T  R I  M  ++L    G +       L   +K+S    F +  ++    E D   +        T LH  A+ GN    +E +N L       +NK+ +   + L +A+ N + + V  L+ + AR++  DE   T LH AA                         H   +        LL   A    + K G TP+H AA  G++  +E L+ +  A   D  + +  +PLHLAA +G       L+   +   D    +  G TPL LAA   H+D VR+ ++    +L+    D  T  H AA NG +  ++   E    N++V     N+ T    + LA   GH     +LL  GA+   ++N G T LH  A  GH   +++L                                +   V  +++  R              G  PLH+A+  GH  ++  L+      G  +   T+ NG TPLH+A  NGH     +LL    +   +++    + LH A  + +   A + I   GA I N  D  G  PLH AA + +++  +LL+   A         + PL++A        +  L+ +  + +KL + ++     + CS+
Sbjct:   76 LHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAK-GANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVN-QANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDC-CRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFG-----RTCLHAAASGGN----VECLNLLL-STGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLV---DLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQT---PVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLL--------------------------------LQRSVDVSLRERR--------------GRAPLHMAAACGHMGILSALVQAAMASGAPI-PLTDRNGYTPLHWACYNGHDGCVELLL--ELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSR 933          

HSP 3 Score: 254.988 bits (650), Expect = 1.363e-69
Identity = 277/1048 (26.43%), Postives = 449/1048 (42.84%), Query Frame = 2
Query:  875 EALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKI-VELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVS----FYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTD-----IIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAK-SKGGLTPLHLAAQNGYKDLVEKLIN--ENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDA----GANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSG--MTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMA---ALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEA-ETNDFQIPLILAAHFNHTEVMSFLL 3949
            EA +++  K       RD +  +TPL +A  +  +   + ++ M  + N   + GRTALH+AA     ++V  L+AK A+ N F                                     DK+   ++ +A   G    +K L+    + +   KK YS    +H A     +  ++LL D    I+  N  G T LH+A     + ++  L    A+VN  ++   + LH AA   H  + +ELL++    +V  + K+G + +H+T++ G    + +L++ G  +   ++ G+  LH AA+ GH  ++ TL+  GA+   R      PLH+A   G       L+  G + +      +E   HV              L +G  ++   + G + LH A+  GN+E L  LL  GAD +   +   + LH     C+   V  LV+       + + R   +      + +G T        +  + + D   T       ++ LL  D D  IQ K    TP+HY A  G+  V LE+   LE       + ++ +  SPL  A+++GHH  + +L+++   +DV + +G T L LAA +GH +   VL+ H A V  K      T LH AA NG+ + +  L+   ++   VDA   N +TP+ LA   G  + C SLL  K   A   A D++G T LH  A   H + V L L+                                    +SV   L+ +  G   LH+AA  GH  ++  L+ A    GA     + +G T LH A   GH   +E+L   +   V   + G   +PLH A      +   EML D            G ++ +     G  PLH A+ + H   ++LLL+ + + VN  T+  G +PL  A +NG      +L+  +   +  +D    TALH A S  H   A      +     INA++    TPLH AA+SG   V ++L+ +GAS  A + N +   L  A + +  E +S +L
Sbjct:   85 EAAVQTLLKHSADVNARD-KNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAF-------------------------------------DKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYS---PLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNN-GADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNE---HV--------------LSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQG-YTPVHYAAAYGHR-VCLEL--LLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTD-CASLLLSK--GASINAKDNKGCTALHRGAATGHEECVDLLLQ------------------------------------RSVDVSLRERR-GRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELL---LELDVFQKQEGNAFSPLHCAV-LNDNESCAEMLIDT----------FGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNAL-VN-VTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPALSCAPNKSVAECLSLIL 1013          

HSP 4 Score: 230.335 bits (586), Expect = 1.240e-61
Identity = 247/889 (27.78%), Postives = 378/889 (42.52%), Query Frame = 2
Query: 1682 ISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAE---------------------------------MLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKD--GNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTD-IIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIV--NFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKA-----------------TVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFN--------------------------KSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDG-----MTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLL-NCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVE----RGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKF------LFDLMICSKLNNFKSVEEFIL 4057
             +G P+   SL+ +   ++  +      LHAAA  G   +++ L+  GA VN++     TPLH A    +   V+TL+ + A VN +     ++PLHVAA  +   KCAE                                  L+  GAN+N   K    A+H A+  G+ E++K L+  GAD  + CKD  G SPLH         +V+ L          +D  + ++ PN+ G TA+H A           +   D ++  L++   +V  Q      TPLH+ A + +  + LE++  N  +      VN Q+K+G SPL   + +G       L++N   +D  D  G T LH+AA  GH  + N L+ + A    +   G+ PLHLAA +G+ D   KL++  +                   +D      +T LH AA  G  E C +LL      AD    D   +T LH AA N +   V   +     L            + AAA+G  + +  F  +N                          K    G+++K  G T +H AA  GH   +++LL+    P    +DG     ++ LHLAA +GH   LEVL   +    V   +G TPL +AA  G  D V  ++    + +  E P               T LH A+ +GH   +RLL+ N D  E   A++ N  TP+  A  NGHT+  S+LL K ++ I  +D KG TALH  ++ GH E   L + +  D++  +  G  PLH AA  G++ +   LV+     GA       +   PL  A +  H   +  LL          E D F       F  + C+ LN+ +S  E ++
Sbjct:   15 FNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNW-QTPLHVAAANR-AVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGAD--VRCKDKKGYSPLHAASSSGQIGVVKLL----------LDLGVDIDDPNSFGNTALHVAC----------YNGQDVVVNELIDCGANVN-QANERGFTPLHFAAASTHGALCLELLVNNGAD------VNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVE-CLNLLLST--GADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVS-FSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQ-GYTPVHYAAAYGHRVCLELLLE---QPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDR------------RTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGAS-INAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLL----------ELDVFQKQEGNAFSPLHCAVLNDNESCAEMLI 841          

HSP 5 Score: 152.14 bits (383), Expect = 3.369e-37
Identity = 153/544 (28.12%), Postives = 239/544 (43.93%), Query Frame = 2
Query: 2534 SPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVC------------------RSLLYHKIY-------------PADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHL-LEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSN-----------------QITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFN-HTEVMSFLLRNKHSTIKLIENDKFLFDLMIC 4015
            +PL+ A  NG  + V  L+     V+  D+   T LH AA  G   +  +L+L  A VN+K    LTPLH A  +  +  V+ L+ ++ A V+A   N +TPLH+AA   R   C                  R+ L+H  +              A+  A D + +  +H AA   H++VV++ +    ++       G +  H A+++G + V+K  +     +       S G+TALH+A   G   +V  L+D GAN  + N  G T LH AA   H  L LE+L    +   V +K G +PLH+ A +G+      ++            + G ++ D     G TPLH+A++ GHE L+  L+  +G +  +    +G  PLH A+ +G ++    LL                      +I   D  GRT LH A+S G++E   L +  GAD+N  D    T LHYAA +  ++    LV  GA    +      PL  AA  +     +SF + N  S    I+      +  IC
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLL-KHSADVNARDKNWQTPLHVAAA-NRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCK-DKKGYSPLHAASSSGQIGVVKLLLDLGVDID---DPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLI------------QNGGEI-DCEDRDGNTPLHIAARYGHELLINTLIT-NGADT-AKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQIC 530          

HSP 6 Score: 123.25 bits (308), Expect = 2.623e-28
Identity = 171/654 (26.15%), Postives = 266/654 (40.67%), Query Frame = 2
Query:  836 FMDLCFKG-EWGNVEALLRSYSKEKPLPKYRDPET-DE---TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVIS--------------------------LLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMD-RSALHMAAEKGHTKIVELLIDKFKCN-----------------------------------VLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLD----KGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKS-GAN-VNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAK------NGWSPLLFASHN 2560
            F D C K    G   +++ S+S E  L    + +T DE   T L  A     +  ++ LL  G + N   +  RTALHYAA       V  L+A  A  N      +C P+H A +  G  S    S                          LL+      +Q DK+G   + YA   G    ++ LL+     Q++ K  +   + +H+A       AL +L  +   ++++ G G T L +AA       ++ L    A V + +  D R+ALH AA  GH + + LL++    N                                   +  +D +G T +H  + +GH E    LL+R V + +  + G   LH AA  GH+ ++  L+      GA +    ++ YTPLH A   G+ G VE L+        +G     SPLH A    N E CAEML+ + GA  +N     G   LH A+ + ++E L+ LL   A  ++    G SPL +         V+ LV   N TK+ +       L +    TA+H A      R H   E   ++ +    D ++   T    +TPLH  A +G + V           +Q+++NK A       NG++P L  + N
Sbjct:  382 FSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLN-EQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQ-DKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHP-ISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAF--SPLHCAVLNDN-ESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLV---NSTKTDL------KLQDANRNTALHLAC----SRSH---ETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATV-----------VQVLLNKGASILAVDHNGYTPALSCAPN 1002          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 68.1662 bits (165), Expect = 1.048e-11
Identity = 77/300 (25.67%), Postives = 126/300 (42.00%), Query Frame = 2
Query: 2765 KDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSN 3664
            K+ V+KL+N       A  ++ + PLH AA+ G+ E   SLL   +   D    DS  +TPL LA  N+H DVVR               D +T G    AN S  + K  + ++K+VI   K        L++A +  +H   K+LL+  +    +N    +  HL                  F+   N +G+  LH+ A  G    + ++L            + G    ++   +  TP+  A +SGH  ++  LL  +        ++NG +PL +A    H +V + LL +  N
Sbjct:  410 KETVQKLLN-------AQDIHSRVPLHYAAELGKLEFVHSLLITNLL-EDVDPIDSDSKTPLVLAITNNHIDVVR---------------DLLTIG---GANAS-PIEKPILDYSKNVISSTK---VQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPL--------------FK--KNSTGLCTLHIVAKIGGDPQLIQLLI-----------RYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARL--DIEDDNGHSPLFYALWESHVDVLNALLQRPLN 650          

HSP 2 Score: 67.3958 bits (163), Expect = 1.909e-11
Identity = 68/225 (30.22%), Postives = 103/225 (45.78%), Query Frame = 2
Query: 2069 LHIASRSGNLEMLKSLL----QEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCAT--AGNSDVL--LEIVNFL---EHKIQLVVNKQAK-------NGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLL 2689
            LH A+  G LE + SLL     E  DP  I  D  +PL + +   H  +V++L++      S I+  +L    N    T V F    V  +    F + D  K+LLE            + +  H C      NS  L  L IV  +      IQL++   A        N W+P+ +A  +GH E+++ LLK+NAR+D+ D++G + L  A  + H +V N LL
Sbjct:  428 LHYAAELGKLEFVHSLLITNLLEDVDP--IDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACK----FNNHDAAKLLLEIRSKQNADNAKNKSSQ-HLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALL 645          

HSP 3 Score: 57.7658 bits (138), Expect = 1.814e-8
Identity = 63/233 (27.04%), Postives = 103/233 (44.21%), Query Frame = 2
Query: 3350 TPLHVAAHYGQIDFVGEML-TDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVE--------VNSATNNNGTT-----PLHFASQNGHTNVTSILL------------GKSSNQITRRDFK----GRTALHF-ASSHGHIEMAALFIGQGADINASDNMG-FTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLR 3952
             PLH AA  G+++FV  +L T++  ++            D +     TPL LA  + H ++VR LL   G          ++ + N   +T     PL+ A +  + +   +LL             KSS  + +  FK    G   LH  A   G  ++  L I  GAD N  D    +TP+ YA +SG+ +V   L++  A  + E ++   PL  A   +H +V++ LL+
Sbjct:  426 VPLHYAAELGKLEFVHSLLITNLLEDV------------DPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQ 646          

HSP 4 Score: 55.0694 bits (131), Expect = 1.059e-7
Identity = 73/316 (23.10%), Postives = 122/316 (38.61%), Query Frame = 2
Query: 1358 DAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIAD-----------VNVLDDMDRSALHMAAEKGHTKIV-ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN----------------FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMK-NGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELV 2218
            D ++HI  +          CD + Q+  +    + V H AA   +++ L  L   +             +N  D   R  LH AAE G  + V  LLI     +V   D +  T + +   + H +    LL  G     P                  + K +LD   NV + TK  + PL++A K+ N    + L+   ++ N                FK        LH+ A      +  ++L++ GA+ NE    N  + +  A RSG+ E++  LL+  A   I   +G+SPL   +   H  ++  L+
Sbjct:  352 DNSLHIFYKSNQDHIDLSYCDEDDQVFSR----KNVFHEAASCPEKSRLFILDEALTTSKLSKETVQKLLNAQDIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASP------------------IEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALL 645          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 66.2402 bits (160), Expect = 2.006e-11
Identity = 50/171 (29.24%), Postives = 78/171 (45.61%), Query Frame = 2
Query: 2462 LLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLK----NNARVDVFDEHGMTALHLAAEKGHRNVANVLLLH-KAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLA 2959
            LL +   L     L+ N  ++NGWS L +AS++G + I   L++     +  +  F   G T +HLA  KGH    ++LL     F+N + + G  P+H+A  N Y   +  LI    A +  +  N  TPLH+  +YG     + LL       D    D     P+ +A
Sbjct:   18 LLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFK--GNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVG-ADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVA 185          

HSP 2 Score: 56.6102 bits (135), Expect = 1.988e-8
Identity = 38/134 (28.36%), Postives = 60/134 (44.78%), Query Frame = 2
Query: 3458 MKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERG 3859
            + ++ +E+G + LH AS  G   +   L+     +        G T +H A   GH     +LL +    I  R   GR  +H A  + + +  +L IG GAD+   D  G TPLH   + G +   K+L+  G
Sbjct:   32 LTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 63.929 bits (154), Expect = 2.103e-11
Identity = 53/194 (27.32%), Postives = 83/194 (42.78%), Query Frame = 2
Query: 1148 PIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDA--NAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRR 1723
            P+H AC         V  LL +  S  LQ D++G I L +++   +      LL        +     SG    HIAC   ++E ++ L D      +N     G T LH+A       + ++L    A V + D  ++  LH AA  G  K++ELL    K  V  +DK+G T +      GH +  + L+ +
Sbjct:    5 PLHQACMEN--EFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 2 Score: 62.3882 bits (150), Expect = 7.444e-11
Identity = 59/217 (27.19%), Postives = 86/217 (39.63%), Query Frame = 2
Query: 3353 PLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLA-SQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL----LGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASC-EAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            PLH A    +   V E+L   P+ +  +             + G  PLH + S   HE    LL   + V ++   +++G TP H A   G+  V   L    L    N+IT +   G T LH A      E++   I  GA +   D     PLH AA  G LK+ +LL   G S    +      PL  A    H +    L+    +   L++N
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQK------------DQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQ---GVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDN 206          

HSP 3 Score: 58.9214 bits (141), Expect = 9.982e-10
Identity = 56/214 (26.17%), Postives = 88/214 (41.12%), Query Frame = 2
Query: 2945 PLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPA--EENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATN 3580
            PLH A   +    V+  L  KP LL+    DG    H + +  +  +    +   ++V        +G T  H+A   G+ ++VK L D    P   +  N G+TCLHLA     F + + L    +   + +K    PLH AA  G +  + E+L  +           G+   +   + G TPL  A   GH +   LL+   G E +   N
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLI-ELLCGL-----------GKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDN 206          

HSP 4 Score: 56.6102 bits (135), Expect = 6.070e-9
Identity = 59/247 (23.89%), Postives = 93/247 (37.65%), Query Frame = 2
Query:  947 PLMLACKDNRLLAVDRLLEMGVNPN---DVAKDGRTALHYAAKFATEDVVKLLLAKKADPNL--FGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKEL----LKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQST-IADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEG 1657
            PL  AC +N    V  LL     P+      +DGR  LH++  F   ++   LL+K  + NL  +   +   P H+ACS                                     G++  +K L    LK +  + TN      G   +H+A  KK  E  + L +  A + +K+   Q  LH AA      +++ L     + VN  D    + L  A  +GH     LL++K+       D +G
Sbjct:    5 PLHQACMENEFFKVQELLHS--KPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACS------------------------------------VGNLEVVKSLYDRPLKPDLNKITN-----QGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKG 208          

HSP 5 Score: 55.0694 bits (131), Expect = 1.883e-8
Identity = 57/195 (29.23%), Postives = 86/195 (44.10%), Query Frame = 2
Query: 2366 MLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVV--NKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDV--FDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRG 2938
            +LL+ D D +I        PLH+  +        EI +FL  K++ V   +    +GW+P   A   G+ E+V  L     + D+      G+T LHLA  K    V+  L+ + A V  K K    PLH AA  G   L+E L    K+ V+       TPL  A   G  +   ++L  + Y A+    D++G
Sbjct:   28 LLLQKDQDGRI--------PLHWSVSFQAH----EITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDA--AVLLVEKYGAEYDLVDNKG 208          

HSP 6 Score: 50.447 bits (119), Expect = 7.440e-7
Identity = 59/218 (27.06%), Postives = 90/218 (41.28%), Query Frame = 2
Query: 1451 MGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMD-RSALHMAAEKGHTKIVELLIDKFKCNVLTR--DKEGNTLMHVTSISGHPETTMSLLRRGVP--LHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYG-AQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIA 2080
            M    LH A   N+   ++ L  +   + +  D D R  LH +      +I   L+ K +   L    D  G T  H+    G+ E   SL  R +   L+     G  CLH A       V + L++ GA+V  + K    PLH A   G+  ++E L G G + VN+  K G    +PL  A    +G+    ++ K GA  +     G  A  +A
Sbjct:    1 MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGW---TPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVA 215          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 64.3142 bits (155), Expect = 1.882e-10
Identity = 92/325 (28.31%), Postives = 135/325 (41.54%), Query Frame = 2
Query: 2927 DSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHF------HLLEVLKPKISF--RVVSNKSGM----TPLHVAAH-YGQIDF------VGEMLTDVP---ANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLH--FAS-QNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKS 3820
            DS G+T L +A      DVV+  +      + +  + G T  H AA  G + ++ E +  N + ++    +  G T L  A+  GH  +VK LL  GA+P   N  G+T          F       +L  +K ++S   +  +N++G+    +     AH   Q  F        E   D P   +NI  + P+      DV + +G   L  AS+ GH              V +   N G   L   F S + GH ++TSI L  G   NQ T RD K  +AL  A   GH+    L +  GAD    D  G T L+YA  S
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIV-ELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFESVDDESEFDDEEDQKILREIKKRLSIAAKKWTNRAGIHNDKSKNGNNAHTIDQPPFDNTTKAKNEKAADSPSMASNIDEKAPEEEFYWTDVTSRAGKEKLFKASKEGHLPY-----------VGTYVENGGKIDLRSFFESVKCGHEDITSIFLAFGFPVNQ-TSRDNKT-SALMVAVGRGHLGTVKLLLEAGADPTKRDKKGRTALYYAKNS 637          

HSP 2 Score: 63.5438 bits (153), Expect = 3.152e-10
Identity = 36/96 (37.50%), Postives = 53/96 (55.21%), Query Frame = 2
Query: 3677 RDFKGRTALHFASSHGHIEMAALFIGQGA-DINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDF--QIPLILAAHFNHTEVMSFLLRN 3955
            RD  GRT L  A   G  ++    I +G  DIN  DN G T LH AA  G++++ +LL+E GA    ++ +     PLI A+   H +V+ +LL+N
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKN 421          

HSP 3 Score: 60.8474 bits (146), Expect = 2.165e-9
Identity = 36/94 (38.30%), Postives = 51/94 (54.26%), Query Frame = 2
Query: 3587 GTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADIN--ASDNMGFTPLHYAAKSGYLKVCKLLVERGA 3862
            G T L  A   G  +V   ++ +    I  +D  G TALH A+  GHIE+  L I  GAD+N  + +  G TPL  A+ +G+L V K L++ GA
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGA 423          

HSP 4 Score: 56.9954 bits (136), Expect = 2.707e-8
Identity = 84/349 (24.07%), Postives = 143/349 (40.97%), Query Frame = 2
Query: 2714 KSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTC------GHIAAANGSLAVIKEFMR---------FNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGAN-PAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFA 3712
            +  GG T L +A   G  D+V+K+I E    ++       T LH AA  G  E+   LL       + K+ +  G TPL  A+ N H DVV+  L+   +  I  +  G+T                  +++E  +          N++ IH  K+K+ G+ A H   +       K   +  A+ P+  +N     +   A    F+  +          V++++G   L  A+  G + +VG  +            + G ++        L     + + GHE++  + L   G  VN  + +N T+ L  A   GH     +LL   ++  T+RD KGRTAL++A
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIV-ELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAK-GLTAFESVDDESEFDDEEDQKILREIKKRLSIAAKKWTNRAGIHNDKSKN-GNNA-HTIDQPPFDNTTKAKNEKAADSPSMASN-----IDEKAPEEEFYWTD----------VTSRAGKEKLFKASKEGHLPYVGTYV------------ENGGKI-------DLRSFFESVKCGHEDITSIFLAF-GFPVNQTSRDNKTSALMVAVGRGHLGTVKLLLEAGADP-TKRDKKGRTALYYA 634          

HSP 5 Score: 51.2174 bits (121), Expect = 1.787e-6
Identity = 30/98 (30.61%), Postives = 54/98 (55.10%), Query Frame = 2
Query: 1556 RSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKT--GSVCLHAAAQSGHVNVVKTLLDKGANVNAR 1843
            R+ L +A +KG   +V+ +I++   ++  +D  GNT +H  ++ GH E    L+  G  +++ +    G   L  A+ +GH++VVK LL  GA+   R
Sbjct:  331 RTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIR 428          

HSP 6 Score: 50.8322 bits (120), Expect = 2.134e-6
Identity = 37/124 (29.84%), Postives = 63/124 (50.81%), Query Frame = 2
Query: 3431 SERPKTGEQMKDVLTESG-LTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSN-QITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFT 3796
            S+RPK   Q K +  +SG  T L +A   G  ++V+ ++   G ++N   +N G T LH A+  GH  +  +L+   ++  I   +  G T L  AS++GH+++    +  GAD    +  G T
Sbjct:  315 SKRPK---QKKGIYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQ-DNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLT 434          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 62.003 bits (149), Expect = 9.786e-10
Identity = 54/213 (25.35%), Postives = 92/213 (43.19%), Query Frame = 2
Query: 3230 EENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTES----GLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVER 3856
            + +N   T LH + +YG   L EV K  I      N     P+   + +G      E LT +   +    PKT E +   L  +      + LHLA++  +  L+ +LL+    ++N   N    TPL+ A +         LL   ++   R    G TA+  A++ G  ++  L I   A+ +  D  G+TP+ +A   G+L +  ++  R
Sbjct:  423 QHDNYKRTPLHYSCQYG---LSEVTKLIIKLMKEWNIWNEIPIDDVSAFGD----AESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIR 628          

HSP 2 Score: 51.2174 bits (121), Expect = 1.588e-6
Identity = 31/113 (27.43%), Postives = 53/113 (46.90%), Query Frame = 2
Query: 2387 DVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVN------KQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFV 2707
            D+  Q     ETPL+              +NF E  + L+ N      ++   GW+ +  A+  G  +IV +L+ NNA  D+ DE G T +  A  +GH ++A+++ +    V
Sbjct:  530 DINYQDNELHETPLYLACR----------LNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIRDELV 632          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 107.071 bits (266), Expect = 6.255e-24
Identity = 125/497 (25.15%), Postives = 195/497 (39.24%), Query Frame = 2
Query: 2522 KNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGL---------------TPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEV--------------CRS-----------------LLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLV-------KVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVE 3853
            K   +PL  A  +G   +   L++  A +   DE  MT LH A  +G+  VA +L     FV A+ +GG                T LHLA + G+ DL  KL  E  A V+A+  ++    H      R+ +              C+S                 + Y   + A  +  D    TPL +AA+ +H D VR  L+   ++     +D  +    AAA G +  ++  +   K V     +             GG +KL+       ++LLD GA    +N++ +T                                 P+H AA +G++  V  +L   PA I  E   +             TPLHLA+  GH  +V+ LL   G     A N    TPL  A+  G   V +ILL + +  +   D    T LH AS  GH+EM  L + + A+I  +D+ G   L  A +S + +V   +++
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLL-----FVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLA-KLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFR-AAAEGCMETLEAALEHQKPVWTICDDVCLNGLV------GGSNKLILVLRISSQLLLDNGACIDSKNDEDIT---------------------------------PIHYAAKFGRVRTVCALLKRDPAIINDEDGASN------------TPLHLAALHGHAAVVKELLYRGGA--IDARNATLWTPLDCAAARGMVEVANILLDEDA-PVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 2 Score: 94.7449 bits (234), Expect = 6.951e-20
Identity = 128/524 (24.43%), Postives = 210/524 (40.08%), Query Frame = 2
Query: 1748 KTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLH---IGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKM-LLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSK--------GGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGH 3283
            KT    LH A   G + V K L++ GA++ +  ++  TPLH A   GN GV + L                    VAA  + G      +      V +  +  ++ALH+A   G+ ++ K  L++GA+ + + +  N   H   +  R C +++++                                    V K K+  F  ++ IK  +L Y  DV I   Y                    I+ F     +  +  + K+  +PL+ A+   H + V  LL++ A +   D +   ++  AA +G        L H+  V             GG   L L  +     +  +L+ +N A +D+      TP+H AA++GR     +LL  K  PA     D    TPLHLAA + H+ VV+  L ++   +   +    T    AAA G + V    +  +  V    K K+T    LHLA+  GH ++VK+LL   AN    ++ G  CL +A +  H
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF-------------------VAAELRGGWSTVSKM------VTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIK------------------------------------VSKLKYLSFCKSEKIKREILLYFFDVVIIICY--------------------IIRF-----RACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLR-----ISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALL--KRDPAIINDEDGASNTPLHLAALHGHAAVVKELL-YRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTT---PLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSH 428          

HSP 3 Score: 87.8113 bits (216), Expect = 1.134e-17
Identity = 109/433 (25.17%), Postives = 164/433 (37.88%), Query Frame = 2
Query: 2834 TPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGAN--PAEENND---------GMTCLHLAAKYGHFHLLEVLKPK--------------------ISFRVV---SNKSGMTPLHVAAHYGQIDFVGEML---TDVPANIKSERPKTG---------------EQMKDVLTESGLTPLH-LASQSGHENLV-----RLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            TPLH+A  +G   V + L+      AD ++ D    TPLH A    +  V +L      EL                  G  + + + +                 TALHLA EGGH  L K+ L+ GAN    +E+ +            C+ +  K      L   K +                    I FR      +K   TPL +AA    +D V  +L    D+ A   ++R                   E  K V T      L+ L   S    LV     +LLL+ +G  ++S  N+   TP+H+A++ G       LL +    I   D    T LH A+ HGH  +    + +G  I+A +   +TPL  AA  G ++V  +L++  A  +        PL LA+   H E++  LL  K
Sbjct:    6 TPLHVACSHGCIPVAKCLVE---AGADLRSLDEEQMTPLHFACMEGNLGVAKLLF-VAAEL-----------------RGGWSTVSKMVT---------DQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLD-NGACIDS-KNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRK 406          

HSP 4 Score: 85.8853 bits (211), Expect = 4.957e-17
Identity = 115/495 (23.23%), Postives = 196/495 (39.60%), Query Frame = 2
Query: 1439 MKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEG-NTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGV------------------------------VETLIGYGAQVNFKGGIL-----DESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKD--------GNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLIN 2791
            MK  M  T LH+A       + K L    AD+  LD+   + LH A  +G+  + +LL       V    + G +T+  + +     E T                    LH A + GH ++ K  L+KGANVNA  +      H  +      +                              V  +I Y   + F+  I       ++PL +AA  KN       LL+ GA++     N  +++  A+  G +E L++ L+       IC D        G++ L + +R    L+              +D    ++  N+E  T +H+AA+  + R          +  LL+ D  +         TPLH  A  G++ V+ E++          ++ +    W+PL  A+  G  E+ +ILL  +A VD  D+   T LHLA+ +GH  +  +LL  KA +      G   L +A ++ +K++   +I+
Sbjct:    1 MKTQM--TPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF------VAAELRGGWSTVSKMVTDQDREEQTA-------------------LHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICY--IIRFRACIECRDKDKDTPLMIAAE-KNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLL--------------LDNGACIDSKNDEDITPIHYAAKFGRVRT---------VCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYR-----GGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 5 Score: 68.5514 bits (166), Expect = 1.243e-11
Identity = 100/389 (25.71%), Postives = 151/389 (38.82%), Query Frame = 2
Query:  932 ETDETPLMLACKDN-----RLLAVDRLLEMGVNP-----NDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGS-TKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAIS---LMYAIEAGSISTIKELLKA--ECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQ-TVLHIAAEGNDETILKYLQS-----TIAD-------------------------------VNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF 1939
            E   TPL  AC +      +LL V   L  G +       D  ++ +TALH A +    D+ KL L K A+ N    S  K     +  +R       +  ++K +K   L   K   I    L+Y  +   I       +A  EC  +         D  + IA  K  V+ +R L    A I  K+   + +V   AAEG  ET+   L+      TI D                               ++  +D D + +H AA+ G  + V  L+ +    +   D   NT +H+ ++ GH      LL RG  +   N T    L  AA  G V V   LLD+ A V+   K   TPLH+A + G+  +V+ L+   A +  
Sbjct:   35 EEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARE-----CIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDK-------DTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITL 411          

HSP 6 Score: 64.6994 bits (156), Expect = 2.367e-10
Identity = 108/456 (23.68%), Postives = 185/456 (40.57%), Query Frame = 2
Query: 2357 IIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDV--LLEIVNFLE---HKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALH------------------------LAAEKGHRNVA----NVLLL------HKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLIN-------ASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTES-GLTPLHLASQSGHENLVRLLLNCDGVEVNSATNN 3583
            + K L+E   D++      + TPLH+    GN  V  LL +   L      +  +V  Q +   + L  A   GH ++  + L+  A V+   E      H                          +EK  R +     +V+++       +A +  + K   TPL +AA+  + D V  L+ ++ A + A  +N +  +  AA  G  E   + L H+  P      D      + L      S+ + L LR   +LL++        + + +T  H AA  G +  +   ++ + ++I+     S  +T LHLAA  GH  +VK LL  G      N    T L  AA  G   +  +L  + +    ++K+  TPLH+A+  G ++ V ++L    ANI              LT+S G   L +A +S H+ +   ++  D V+   A  N
Sbjct:   19 VAKCLVEAGADLR-SLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLL-QHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQ-KPVWTICDD------VCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGAS--NTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMV-KLLLSRKANI-------------TLTDSAGRNCLDIAIESSHKEVAVAII--DHVDWKQAMRN 447          

HSP 7 Score: 59.3066 bits (142), Expect = 1.078e-8
Identity = 55/203 (27.09%), Postives = 86/203 (42.36%), Query Frame = 2
Query: 3476 ESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL-------GKS--SNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINA---SDNMGFTPLHYAAKSG-----------YLKVCK--------------------LLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            ++ +TPLH+A   G   + + L+   G ++ S  +    TPLHFA   G+  V  +L        G S  S  +T +D + +TALH A   GH ++A L + +GA++NA   S N  F      A+             YL  CK                     ++   A  E    D   PL++AA  NH + +  LL++
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEA-GADLRS-LDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQH 202          

HSP 8 Score: 58.5362 bits (140), Expect = 1.872e-8
Identity = 55/195 (28.21%), Postives = 90/195 (46.15%), Query Frame = 2
Query: 1406 RLLCDANAQINMKNGMGQTVLHIAAE-GNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATT 1987
            +LL D  A I+ KN    T +H AA+ G   T+   L+   A +N  D    + LH+AA  GH  +V+ L+ +    +  R+    T +   +  G  E    LL    P+   +K  +  LH A++ GHV +VK LL + AN+          L IA++  +  V   +I +   V++K  + +   L  A T+
Sbjct:  267 QLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGG-AIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH---VDWKQAMRNRCKLGNAITS 457          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO29974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T238])

HSP 1 Score: 105.531 bits (262), Expect = 9.454e-23
Identity = 189/782 (24.17%), Postives = 311/782 (39.77%), Query Frame = 2
Query: 1832 VNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVA--ATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGN-LEMLKSLLQEGADPSIICKDGNSPLHIGVRYCH--YLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTD---IIKMLLEYDGD--------VKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNN--ARVDV-----------FDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKL--INENKATVDALTLNRK---------------TPLHLAAQYG------RKEVCRSLLYHKIYP--ADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMT---CGHIAAANGSLAVIKEFMRFNKS-------VIHGLKNKS----TGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL------KPKISFRVVS------NKSGMTPLHVAAHYGQI--DFVGEMLTDVPANIKSERPKTGE-----QMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNN----NGTTPLHFASQNGHTNVTSILL-----------GKSSNQITRRDFKGRTALHFA------SSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVE 3853
            +N+R +   TPL +AVK+ N   VE L+  G  +N K    DE     A      N  +  + L++  A+VN T K   +AL  A  S     M++SLL+ GA  +       +PLH  V      +  + E      K    I A  +      +G   +H+A   V+ +KH+D   +D   I  +LLE   +        +    K+  +TPLH  A  G +   L   N L+   +  ++    +G +P   A+ +GHH    + ++ N  AR DV           +++   +A+ +  E  + +    +++  AF +    G     HL       D +  L  + E +    A TL RK               + LHL A++         +V  ++L +++      P A DSRG  PLH AA N +  +  L LR+ P  L  A  +GMT   C     +N  LA   E ++   S       + + +          +T L  AA  G+  +VK  LD  A+      +G T L    +     + +VL      + K +    S      +K G T +H      ++  D    ML        S +P+T +        D       TPL  A+  G+EN+V+  L+      N+A+ N    NG T L    +    ++  +LL             +S  ++ +D  G T +H         S  ++ M  L     + + A DN G +PL+YA + G  ++  +L E
Sbjct:   34 INSRDRHGRTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFGTALIMACDNKLQVVKALIEGKADVNLTDKQNRTALSYAVSSNTATPMVQSLLEAGAHVNTADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDI------KGRIPLHYA--FVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFG-QTPLHRAAIRGATICCL---NLLQRGAR--IDAIDNDGNTPFSLAARHGHHSCAMMFIQMNAPARCDVITPVTPEQRNKYEKQRRSAMWVWQETVNLHPPTPVIV-SAFRSVVEHGWQGVAHLMLDTAGLDFMVALRAVFEARKMDLAWTLLRKQRKDSSIQETDSNGLSLLHLLAEFATTFGDVENKVTIAILEYQLEERGVSPSALDSRGALPLHYAAINGNKGLCELLLRYNPSTLNVADPNGMTPLACAFETTSN--LATRFELIKMLVSAKPRTLDICYQIGKDDDPDHDSTTPLIQAALHGNENIVKTFLDNNASVNFPKANGRTALMEVIRANEEDMAKVLLYGTIDRAKWTGASTSVDMSAKDKDGWTVVHHCVQNREVRPDPYERMLV-------SAKPRTLDICYQIGKDDDPDHDSTTPLIQAALHGNENIVKTFLD------NNASVNFPKANGRTALMEVIRANEEDMAKVLLYGTIDRAKWTGASTSVDMSAKDKDGWTVVHHCVQNREYGSSENVSMLRLLAKFNSPLTAPDNTGHSPLYYAERQGSGRMEAVLRE 785          

HSP 2 Score: 85.1149 bits (209), Expect = 1.767e-16
Identity = 177/806 (21.96%), Postives = 305/806 (37.84%), Query Frame = 2
Query: 1238 DKEGAISLMYAIEAGSISTIKELLKAECE---QQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDET-ILKYLQSTIADVNVLDDMDRSALHMAAEK---GHTKIVEL--LIDKFKCNVLTRDKEGNTLMHVTSIS---------GHPETTMSLLRRGVPLH---------MPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQK-RKHSDFEDTD-----IIKMLLEYD---GDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNN-ARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSK----------------GGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPA---------DPKAADSRGQTPLHLAAKNDH---SDVVRLFLRFKPELL---------INASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAE------------ENNDGMTCLHLAAK---YGHFHLLEVLKPKISFR---VVSNKSGMTPLHVAAHYG 3379
            D+ G   L  A++  ++  ++ L+KA      +  N  + + G A I +AC  K ++ ++ L +  A +N+ +   +T L  A   N  T +++ L    A VN  D   R+ LH A      G   + E   L+ K   ++  +D +G   +H   +            P +  SLL   +  H           +K G   LH AA  G       LL +GA ++A   D  TP  +A ++G+       I   A                        +C  +   +    N+  K   SA+ +   + NL            P I+    +   H      H ++    + F    ++  +A  +              A  L++K RK S  ++TD     ++ +L E+    GDV+                   + V + I+ +   +  +  +     G  PL +A+ NG+  +  +LL+ N + ++V D +GMT L  A E    N+A    L K  V+AK +                   TPL  AA +G +++V+  + +N A+V+    N +T L    +   +++ + LLY  I  A         D  A D  G T +H   +N         R+ +  KP  L          +  HD  T    AA +G+  ++K F+  N SV      K+ G TAL          + KVLL    + A+            ++ DG T +H   +   YG    + +L+    F       + +G +PL+ A   G
Sbjct:   38 DRHGRTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFGTALI-MACDNK-LQVVKALIEGKADVNLTDKQNRTALSYAVSSNTATPMVQSLLEAGAHVNTADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYAFVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAIDNDGNTPFSLAARHGHHSCAMMFIQMNAPA----------------------RCDVITPVTPEQRNKYEKQRRSAMWVWQETVNL--------HPPTPVIVSAFRSVVEHGWQGVAHLMLDTAGLDFMVALRAVFEARKM------------DLAWTLLRKQRKDSSIQETDSNGLSLLHLLAEFATTFGDVE-------------------NKVTIAILEYQLEERGVSPSALDSRGALPLHYAAINGNKGLCELLLRYNPSTLNVADPNGMTPLACAFETT-SNLATRFELIKMLVSAKPRTLDICYQIGKDDDPDHDSTTPLIQAALHGNENIVKTFL-DNNASVNFPKANGRTALMEVIRANEEDMAKVLLYGTIDRAKWTGASTSVDMSAKDKDGWTVVHHCVQNREVRPDPYERMLVSAKPRTLDICYQIGKDDDPDHDSTTPLIQAALHGNENIVKTFLDNNASVNFP---KANGRTALMEVIRANEEDMAKVLLYGTIDRAKWTGASTSVDMSAKDKDGWTVVHHCVQNREYGSSENVSMLRLLAKFNSPLTAPDNTGHSPLYYAERQG 775          

HSP 3 Score: 68.1662 bits (165), Expect = 2.814e-11
Identity = 82/272 (30.15%), Postives = 118/272 (43.38%), Query Frame = 2
Query: 3245 GMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDV-LTE-SGLTPLHLASQSGHEN-LVRLLLNCDGVEVNSATNNNGTTPLHFA---SQNGHTNVTSI--LLGKSSNQITRRDFKGRTALHFA----------SSHGHIEMAALFIGQGAD--------INASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAA-HFNHTEVMSFLLRNKHSTIKLI 3979
            G T L LA K+ + H +E L           K+G+  L++ +H    DF G  L     N         E   DV LT+    T L  A  S     +V+ LL   G  VN+A +++  TPLH+A   +  G  ++T    L+ K    I  +D KGR  LH+A          S    + + +L +   A+        +N  D  G TPLH AA  G    C  L++RGA  +A  ND   P  LAA H +H+  M F+  N  +   +I
Sbjct:   41 GRTPLQLAVKWNNLHAVEALV----------KAGVN-LNLKSHNADEDFFGTALIMACDNKLQVVKALIEGKADVNLTDKQNRTALSYAVSSNTATPMVQSLLEA-GAHVNTA-DSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYAFVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAIDNDGNTPFSLAARHGHHSCAMMFIQMNAPARCDVI 299          

HSP 4 Score: 65.855 bits (159), Expect = 1.414e-10
Identity = 185/769 (24.06%), Postives = 297/769 (38.62%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATED----VVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEA--GSISTIKELLKAECEQQTNI-KKKYSGDAAIHIACRK----------KDVEALRLLCDANAQ--------INMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID---KFKCNVLT---------RDKEGNTLMHV--TSISGHPET--TMSLLR-------RGVPLHMPNKTG---SVCLHAAAQSGHVNVVKTLL---DKGANVNARTKDLYTPLHIAVKYGNP-GVVE---TLIGYGAQVNFKG---GILDES---PLHVAATTKNGEKCAEMLLKSGANVNETMKNG--------ESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLL-------EYDG---DVKIQTKYTE-ETPLHYCATAGNSDVLLE-----IVNFLEHKIQLVV-----NKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAK 2965
             TPL LA K N L AV+ L++ GVN N  + +        A     D    VVK L+  KAD NL     +    +   S T T    V SLL+A        D      L YA+ A  G   ++ E      +   +I  +   G   +H A  K            V    LL +A A+        +N  +  GQT LH AA  G     L  LQ   A ++ +D+   +   +AA  GH     + I      +C+V+T          +K+  + M V   +++ HP T   +S  R       +GV   M +  G    V L A  ++  +++  TLL    K +++     +  + LH+  ++    G VE   T+     Q+  +G     LD     PLH AA   N   C  +L  + + +N    NG        E+  ++A+R   ++ML S      D        + P H        LI   L    N  K+ +D    VN P   G TA+    E+++  +       D+ K+LL       ++ G    V +  K  +  T +H+C    N +V  +     +V+     + +       +    +  +PL+ A+ +G+  IV   L NNA V+    +G TAL         ++A V LL+     AK  G  T + ++A++           +    V     NR        +YG  E    L     + +   A D+ G +PL+ A +
Sbjct:   42 RTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFGTALIMACDNKLQVVKALIEGKADVNLTDKQNRTALSYAVSSNTATP--MVQSLLEAGAHVN-TADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYAFVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRG-ARIDAIDNDGNTPFSLAARHGHHSCAMMFIQMNAPARCDVITPVTPEQRNKYEKQRRSAMWVWQETVNLHPPTPVIVSAFRSVVEHGWQGVAHLMLDTAGLDFMVALRAVFEARKMDLAWTLLRKQRKDSSIQETDSNGLSLLHLLAEFATTFGDVENKVTIAILEYQLEERGVSPSALDSRGALPLHYAAINGNKGLCELLLRYNPSTLNVADPNGMTPLACAFETTSNLATRFELIKMLVSAKPRTLDICYQIGKDDDPDHDSTT---PLIQAALHGNENIVKTFLDNNASVNFPKANGRTAL---MEVIRANEE------DMAKVLLYGTIDRAKWTGASTSVDMSAKDKDGWTVVHHCVQ--NREVRPDPYERMLVSAKPRTLDICYQIGKDDDPDHDSTTPLIQAALHGNENIVKTFLDNNASVNFPKANGRTALMEVIRANEEDMAKV-LLYGTIDRAKWTGASTSVDMSAKD----------KDGWTVVHHCVQNR--------EYGSSENVSMLRLLAKFNSPLTAPDNTGHSPLYYAER 773          

HSP 5 Score: 50.8322 bits (120), Expect = 5.292e-6
Identity = 115/482 (23.86%), Postives = 183/482 (37.97%), Query Frame = 2
Query: 2504 VVNKQAKNGWSPLLFASHNGHHEIVSILLK---------NNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLA-AQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQY---GRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKN--KSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAH--YGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALH----FASSHGHIE----MAAL---FIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGAS 3865
            V+N + ++G +PL  A    +   V  L+K         +NA  D F     TAL +A +     V   L+  KA VN   K   T L  A + N    +V+ L+ E  A V+    + +TPLH A      G + +  +      +  D  A D +G+ PLH A           F++ K     + S     C          +++ E M  +   +  L N     G T LH AA  G       LL  GA     +NDG T   LAA++GH     +    I     +    +TP+       Y +       +     N+    P      + V+            + G + +  L+L+  G++   A          F ++      T +   +  + I   D  G + LH    FA++ G +E    +A L      +G   +A D+ G  PLHYAA +G   +C+LL+    S
Sbjct:   33 VINSRDRHGRTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFG----TALIMACDN-KLQVVKALIEGKADVNLTDKQNRTALSYAVSSNTATPMVQSLL-EAGAHVNTADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYA-----------FVKLKKHTDASLSDPVSIC----------SLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAIDNDGNTPFSLAARHGHHSCAMMF---IQMNAPARCDVITPVTPEQRNKYEKQRRSAMWVWQETVNLHPPTPVIVSAFRSVV------------EHGWQGVAHLMLDTAGLDFMVALR------AVFEARKMDLAWTLLRKQRKDSSIQETDSNGLSLLHLLAEFATTFGDVENKVTIAILEYQLEERGVSPSALDSRGALPLHYAAINGNKGLCELLLRYNPS 466          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 88.9669 bits (219), Expect = 1.502e-19
Identity = 67/234 (28.63%), Postives = 109/234 (46.58%), Query Frame = 2
Query: 1232 QMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQV 1933
            +MD  G  +L +A     +  + EL++    +  +          +H+AC+K  +E  RLL +  A ++ KN  G+T LH+AA       LK+L S    ++  D   R+    A   G T+   LL++K        D+   + +H+   +G      +L R G+  +  ++ G   LH AA SG   VV  LL  GA++NAR  + +TPL  A K G+      L+  GA +
Sbjct:    3 KMDDTGFSALHHATRYNRVEAMAELIRNGSIEDLSTP--------LHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK--------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 79.337 bits (194), Expect = 3.155e-16
Identity = 71/235 (30.21%), Postives = 108/235 (45.96%), Query Frame = 2
Query: 3236 NNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQ------------------ITR-------RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGAS 3865
            ++ G + LH A +Y     +  L    S   +S     TPLHVA   G ++ VG +L +  A +            D   + G TPLH+A+  G  + ++ LL+  GV ++   + +  TP   A   G T    +LL K  NQ                  +TR       RD +G++ALH A+  G  ++    +  GADINA D+  +TPL  AAK+G +K C  L++ GAS
Sbjct:    5 DDTGFSALHHATRYNRVEAMAELIRNGSIEDLS-----TPLHVACKKGSME-VGRLLVEKGAAL------------DKKNDKGETPLHMAACIGSFDALKFLLS-KGVAIDE-RDFSHRTPFLSAVAAGRTENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGAS 219          

HSP 3 Score: 69.3218 bits (168), Expect = 7.627e-13
Identity = 68/231 (29.44%), Postives = 98/231 (42.42%), Query Frame = 2
Query: 1532 VNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGN--SPLHIGVRYCHYLIVQELV 2218
            +N +DD   SALH A      + +  LI       L+      T +HV    G  E    L+ +G  L   N  G   LH AA  G  + +K LL KG  ++ R     TP   AV  G       L+              +SPLH+A          E L ++G + NE  + G+SALH+A+ SG  +++  LL+ GAD  I  +D N  +PL    +        EL+
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDLS------TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDEN--------QKSPLHLACAAGRALH-VEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGAD--INARDSNRWTPLMCAAKTGSVKTCMELL 214          

HSP 4 Score: 64.3142 bits (155), Expect = 3.471e-11
Identity = 66/242 (27.27%), Postives = 105/242 (43.39%), Query Frame = 2
Query: 2036 VNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNG 2761
            +N+    G SALH A+R   +E +  L++ G+      +D ++PLH+  +     + + LV          +    ++  N++GET +H AA +        F   D +K LL   G    +  ++  TP      AG ++              L++ K  +N  SPL  A   G    V  L +     +  DE G +ALH+AA  G R V   LL + A +NA+     TPL  AA+ G
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGS-----IEDLSTPLHVACKKGSMEVGRLLV----------EKGAALDKKNDKGETPLHMAACI------GSF---DALKFLLS-KGVAIDERDFSHRTPFLSAVAAGRTE-----------NAMLLLEKD-ENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTG 205          

HSP 5 Score: 63.5438 bits (153), Expect = 7.296e-11
Identity = 68/240 (28.33%), Postives = 109/240 (45.42%), Query Frame = 2
Query: 2507 VNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGAN 3223
            +NK    G+S L  A+     E ++ L++N +  D+      T LH+A +KG   V  +L+   A ++ K+  G TPLH+AA  G  D ++ L+++  A +D    + +TP   A   GR E    LL            D   ++PLHLA     +  V    R    L  N    +G +  H+AA +G   V+ + +R+   +     N+    T L  AA+ G  K    LL +GA+
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDL-----STPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVA-IDERDFSHRTPFLSAVAAGRTENAMLLLEK----------DENQKSPLHLACAAGRALHVEALTR--AGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNR---WTPLMCAAKTGSVKTCMELLQSGAS 219          

HSP 6 Score: 58.151 bits (139), Expect = 5.236e-9
Identity = 57/215 (26.51%), Postives = 95/215 (44.19%), Query Frame = 2
Query: 2477 NFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSV 3118
            N +E   +L+ N   ++  +PL  A   G  E+  +L++  A +D  ++ G T LH+AA  G  +    LL     ++ +     TP   A   G  +    L+ +++        N+K+PLHLA   GR     +L    +   +    D  GQ+ LH+AA +    VV   LR+  +  INA   +  T    AA  GS+    E ++   S+
Sbjct:   19 NRVEAMAELIRNGSIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDE--------NQKSPLHLACAAGRALHVEALTRAGLSTNER---DEEGQSALHMAALSGFRKVVTQLLRYGAD--INARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 7 Score: 53.5286 bits (127), Expect = 1.872e-7
Identity = 32/94 (34.04%), Postives = 52/94 (55.32%), Query Frame = 2
Query: 3668 ITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLL 3949
            + + D  G +ALH A+ +  +E  A  I  G+  + S     TPLH A K G ++V +LLVE+GA+ + + +  + PL +AA     + + FLL
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDLS-----TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLL 89          

HSP 8 Score: 50.8322 bits (120), Expect = 1.323e-6
Identity = 62/235 (26.38%), Postives = 100/235 (42.55%), Query Frame = 2
Query: 2705 VNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPEL-LINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEML 3406
            +N     G + LH A +    + + +LI     +++ L+    TPLH+A + G  EV R LL  K    D K  + +G+TPLH+AA     D ++  L     +   + SH       +AA     A++             L+      + LHLA   G    V+ L  AG +  E + +G + LH+AA  G   ++  L    +     + +  TPL  AA  G +    E+L
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIR--NGSIEDLS----TPLHVACKKGSMEVGR-LLVEKGAALDKK--NDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLL------------LEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELL 214          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 86.2705 bits (212), Expect = 4.425e-18
Identity = 71/236 (30.08%), Postives = 108/236 (45.76%), Query Frame = 2
Query: 3167 AAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEA 3874
            A   G    VK LL  GA+   +N DG+T LH A    +F L++VL  K +   V +  G T LH AA  G ++ + + L +  A++ +            +   G  PL LA +   E+L+   +   G++V+ A        L+ A    + N  +            +D    +ALH ASS G++++  L +  G +INA D   +TPLH AA  G    C+LL E GA   A
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVE-IAKYLIENGADVAA------------VNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCIN----------ESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNA 268          

HSP 2 Score: 81.2629 bits (199), Expect = 2.313e-16
Identity = 65/250 (26.00%), Postives = 112/250 (44.80%), Query Frame = 2
Query: 1208 KATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTM-----SLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK 1942
            ++ K  ++Q +    I  + A+ +G +  +K+LL    +      +   G  A+H AC  ++ + +++L D  A +++++  G T LH AA      I KYL    ADV  +++     L +A E+    + +LL D+ +          N  + V       E  M     S L +       +KT +  LH A+  G++ V+  LL  G  +NA+  D +TPLH A  +G     E L   GA  N +
Sbjct:   38 RSRKKPKIQFNS--GIVFLSAVSSGDVDEVKKLLAKGADINY---QNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE---DMEDLLTDEIE----------NQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNAR 269          

HSP 3 Score: 64.3142 bits (155), Expect = 9.264e-11
Identity = 54/180 (30.00%), Postives = 83/180 (46.11%), Query Frame = 2
Query: 3146 GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQM---------KDVLTESG----LTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            G TALH A    +  LVKVL+D GA+    +N+G T LH AA  G   + + L    +     N  G  PL +A      D + + + +   ++   R    + M         K+ + ES      + LH+AS  G+  ++ LLL   GVE+N+   +N  TPLH A+  G  +   +L
Sbjct:   82 GLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQL-GVEINAKDADN-WTPLHAAAHWGQKDACELL 259          

HSP 4 Score: 63.929 bits (154), Expect = 1.397e-10
Identity = 51/165 (30.91%), Postives = 82/165 (49.70%), Query Frame = 2
Query: 3581 NNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPA 4075
            N+G   L   S +G  +    LL K ++ I  ++  G TALH A    + ++  + + +GA ++  DN G+T LH AA  G +++ K L+E GA   A  N+ ++PL LA      E M  LL ++      IEN     D        + ++VEE I+L+ A +
Sbjct:   48 NSGIVFLSAVS-SGDVDEVKKLLAKGAD-INYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLA----EEEDMEDLLTDE------IENQGIDVD--------DARAVEEKIMLNDAQS 192          

HSP 5 Score: 63.1586 bits (152), Expect = 2.550e-10
Identity = 53/196 (27.04%), Postives = 85/196 (43.37%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQ---VNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETM-------------------------KNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRY 2188
            SG  +    LL +G  ++  N  G   LH A    + ++VK L+DKGA+++ R  + +T LH A   G+  + + LI  GA    VN +G    E PL +A      +   + +   G +V++                           K   SALH+AS  G L+++  LLQ G + +    D  +PLH    +
Sbjct:   59 SGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEG----ELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHW 250          

HSP 6 Score: 55.8398 bits (133), Expect = 5.362e-8
Identity = 65/255 (25.49%), Postives = 108/255 (42.35%), Query Frame = 2
Query: 2540 LLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL 3304
             L A  +G  + V  LL   A ++  +  G+TALH A    + ++  VL+   A ++ +   G T LH AA  G  ++ + LI EN A V A+    + PL LA     +E    LL  +I        D+R                       + ++++N +   +                     NK+ I+  K+K T ++ALH+A+  G+ K++ +LL  G     ++ D  T LH AA +G     E+L
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLI-ENGADVAAVNNEGELPLDLA----EEEDMEDLLTDEIENQGIDVDDARA---------------------VEEKIMLNDAQSWL---------------------NKNCINESKDK-TEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELL 259          

HSP 7 Score: 54.6842 bits (130), Expect = 1.431e-7
Identity = 73/256 (28.52%), Postives = 105/256 (41.02%), Query Frame = 2
Query: 2078 ASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLL-EIVN---------FLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDA 2815
            A  SG+++ +K LL +GAD +    DG + LH      ++ +V+ LV          D    +++ +NEG T++H AA              +I K L+E   DV        E PL         D+L  EI N          +E KI L         W                  L  N   +  D+   +ALH+A+ KG+  V  +LL     +NAK     TPLH AA  G KD  E L++EN A  +A
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLV----------DKGASMDVRDNEGWTSLHAAASCGS---------VEIAKYLIENGADVAA-VNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIML----NDAQSW------------------LNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACE-LLSENGADFNA 268          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 82.8037 bits (203), Expect = 1.923e-17
Identity = 60/198 (30.30%), Postives = 98/198 (49.49%), Query Frame = 2
Query: 1667 MHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGN---SPLHIGVRYCHYLIVQELVSFYNKTKSRID 2251
            +H+  + G  E    LL  GV ++  +      LH AA SG+VN ++ L+ +  + N   K    PLH A  + N   V +L+  G+ VN K      +PLH AA +    KC E LL++  N ++  K G SA+H AS +G+   ++ LL   A+  +    G+   +PLH+   + H   ++ L+  +N  + R D
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVN-KPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDD 200          

HSP 2 Score: 80.4925 bits (197), Expect = 1.168e-16
Identity = 72/248 (29.03%), Postives = 117/248 (47.18%), Query Frame = 2
Query: 1964 PLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGW-SPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAF 2704
            PLH+A      E C + LL  G +VN    N  + LH A+ SGN+  L+ L+ +  D + I K G +PLH    + ++  V  LV+          A   VN P+ +  T +H+AA        SD  D   ++ LL   G+   + K    + +HY +  G+    L I   L+     ++N+ + +   +PL  A+ +GH   + +L+K+   ++V D+ G T L LA+ +GH      LL H A 
Sbjct:    3 PLHLACLGGFTE-CCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVT----------AGSNVNKPDTKACTPLHYAAA-------SDL-DAKCVEHLLRNRGNASKRDK-QGYSAVHYASANGHK---LAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNAM 227          

HSP 3 Score: 80.1073 bits (196), Expect = 1.740e-16
Identity = 73/238 (30.67%), Postives = 106/238 (44.54%), Query Frame = 2
Query: 3158 LHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHE-NLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGR--TALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGA 3862
            LHLA  GG  +  K LL  G +   ++N+  T LH AA  G+ + LE+L  +       +K G  PLH AA +     V  ++T   A     +P T             TPLH A+ S  +   V  LL   G    S  +  G + +H+AS NGH     +LL  S+N +  R       T LH A+ HGH     + I    D+   D+ G TPL  A+  G+++  + L+   A
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVT---AGSNVNKPDT----------KACTPLHYAAASDLDAKCVEHLLRNRGNA--SKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          

HSP 4 Score: 77.7962 bits (190), Expect = 1.251e-15
Identity = 72/229 (31.44%), Postives = 107/229 (46.72%), Query Frame = 2
Query: 1466 LHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDK---FKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSG-HVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQ--VNFKGGILDESPLHVAATTKNGEKCA-EMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGA 2131
            LH+A  G      K L     DVN  D+ DR+ LH AA  G+   +ELL+ +   F C     DK G   +H  +   +    MSL+  G  ++ P+      LH AA S      V+ LL    N + R K  Y+ +H A   G+   +E L+   A   +N   G    +PLH+AA   +G K A E+L+KS  ++      G + L +AS  G++E ++ LL   A
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNC----IDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAF--HGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          

HSP 5 Score: 72.7886 bits (177), Expect = 6.647e-14
Identity = 76/234 (32.48%), Postives = 111/234 (47.44%), Query Frame = 2
Query: 2630 MTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINE--NKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKND-HSDVVRLFLRFKPELLINASH---DGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGS---TALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL 3304
            M  LHLA   G       LL +   VNAK     TPLH AA +G  + +E L+++  +   +D L  N   PLH AA +       SL+      ++    D++  TPLH AA +D  +  V   LR +     NAS     G +  H A+ANG    I+  +  + +    L N+S+GS   T LHLAA  GH   ++VL+ +  +    ++ G T L LA+  GH   +E L
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRN---PLHYAAGHTNFRCVMSLV---TAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRG----NASKRDKQGYSAVHYASANGHKLAIEMLLDVSAN---DLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECL 221          

HSP 6 Score: 67.781 bits (164), Expect = 3.051e-12
Identity = 70/225 (31.11%), Postives = 103/225 (45.78%), Query Frame = 2
Query: 2351 TDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLV--VNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKG-HRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRK------TPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFL 2998
            T+  K LL Y  DV  +    + TPLH  A +GN       VN LE  +      N   K G +PL +A+ + +   V  L+   + V+  D    T LH AA           LL ++   + + K G + +H A+ NG+K  +E L++ +   +    LNR       TPLHLAA +G K     L+  K +  D +  D RG+TPL LA+   H + V   L
Sbjct:   13 TECCKKLLFYGVDVNAKDN-NDRTPLHCAACSGN-------VNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDL----LNRSSGSPCVTPLHLAAFHGHKPALEVLI--KSF-NDLEVRDDRGRTPLDLASFQGHVECVECLL 222          

HSP 7 Score: 65.4698 bits (158), Expect = 1.672e-11
Identity = 64/228 (28.07%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  947 PLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAG-SISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQ---TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID 1618
            PL LAC         +LL  GV+ N    + RT LH AA     + ++LL+++  D N      +  P+H A   T      V+SL+ A  +   + D +    L YA  +      ++ LL+         K+ YS   A+H A       A+ +L D +A   +    G    T LH+AA    +  L+ L  +  D+ V DD  R+ L +A+ +GH + VE L++
Sbjct:    3 PLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGR-NPLHYAAGHTNFR--CVMSLVTAGSNVN-KPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYS---AVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLN 223          

HSP 8 Score: 54.6842 bits (130), Expect = 7.279e-8
Identity = 39/127 (30.71%), Postives = 55/127 (43.31%), Query Frame = 2
Query: 3596 PLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFN-HTEVMSFLLRNKHSTIK 3973
            PLH A   G T     LL    + +  +D   RT LH A+  G++    L + Q  D N  D +G  PLHYAA     +    LV  G++          PL  AA  +   + +  LLRN+ +  K
Sbjct:    3 PLHLACLGGFTECCKKLLFYGVD-VNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASK 128          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 340.117 bits (871), Expect = 5.316e-94
Identity = 260/848 (30.66%), Postives = 428/848 (50.47%), Query Frame = 2
Query: 1412 LCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
             C+ +    M +    + L  A  GN + +L+YL+  + D++  +    +ALH+AA++GH  +V+ L+D+    V +  K+GNT +H++S++G  E   +L++RG  ++  ++ G   L+ AAQ  H++VV+ LL+ G N +  T+D +TPL IA++ G+  VV  L+      N   G +    LH+AA  K+  K A +LL++  N +   K+G + LHIA+  GN+ +   LL  GA      ++G +PLH+                                                     S   +T+++++LL+    +  +T+    TPLH CA     +  +E+   LE    L+   + KNG SPL  A+   H E V  LL++ A VD      +TALH+AA  GH  V  +LL  +A  NA++  G TPLH+A +     ++E L+    A++ A+T +  TP+H+AA  G   +   LL +    A P  ++ RG+T LH+AA+   ++VVR  LR    +   A  D  T  HIA+  G   +++  ++    + H     + G T LH++A  G  +   VLL+AGA+ +     G T LH+ +KYG   + ++L  + +    + K+G+TPLHVAAHY     V  +L D     K   P T         ++G TPLH+A++    ++  +LL   G E N+ T   G TPLH ASQ GH ++ ++L+ K + QI      G TALH A+    + +A + +  GA+++    +G+TPL  A   G  K+   L++ GAS  A+T +   PL  AA   +T +++ LL++
Sbjct:   34 FCEEHVPAEMLSDSNTSFLRAARAGNIDKVLEYLKGGV-DISTCNQNGLNALHLAAKEGHMDLVQELLDR-GAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL-----ENDTKGKVRLPALHIAAR-KDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVA----------------------------------------------------SKRGNTNMVRLLLDRGSQIDAKTR-DGLTPLH-CAARSGHEASVEV--LLEKGAPLLA--RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYG-ASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNG---ASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARARED-QTPLHIASRLGKTEIVQLLLQH---MAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDN-QKVALLLLD-----KGASPHT-------TAKNGYTPLHIAAKKNQMDIATVLLQY-GAETNALTKQ-GVTPLHLASQEGHADMAALLMSKGA-QINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQH 791          

HSP 2 Score: 299.671 bits (766), Expect = 2.185e-81
Identity = 257/878 (29.27%), Postives = 431/878 (49.09%), Query Frame = 2
Query: 1319 CEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRF--KPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFL 3946
            CE+    +     + +   A R  +++ +         I+  N  G   L                                 H+AA++GH  +V+ L+D+    V +  K+GNT +H++S++G  E   +L++RG  ++  ++ G   L+ AAQ  H++VV+ LL+ G N +  T+D +TPL IA++ G+  VV  L+      N   G +    LH+AA  K+  K A +LL++  N +   K+G + LHIA+  GN+ +   LL  GA      ++G +PLH+  +  +  +V+ L+       S+IDA         +G T +H AA        S  E +  +++LLE    +  +TK    +PLH  A   + +    + + L+HK    V+    +  + L  A+H GH+ +  +LL   A  +    +G T LH+A +K    V  +L+ + A + A ++ GLTP+H+AA  G+ ++V  L+ +N A+ D   +  +T LH+AA+ G+ EV R LL +     D +A +   QTPLH+A++   +++V+L L+    P+    A+ +G T  HI+A  G L      +    S  H L  K  G T LH+ ++ G   + K+LL   A P     +G+T LH+AA Y +  +  +L  K +    + K+G TPLH+AA   Q+D    +L            + G +  + LT+ G+TPLHLASQ GH ++  LL++  G ++N  T  +G T LH A+Q     V  IL+   +N +  +   G T L  A  +G+ +M +  +  GA +NA    G+TPLH AA+ G   +  +L++ GA   A T +    L +A    +  V+  L
Sbjct:   35 CEEHVPAEMLSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNAL---------------------------------HLAAKEGHMDLVQELLDR-GAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL-----ENDTKGKVRLPALHIAA-RKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLD----RGSQIDAK------TRDGLTPLHCAAR-------SGHEAS--VEVLLEKGAPLLARTK-NGLSPLHMAAQGDHVEC---VKHLLQHKAP--VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAM-VDARARED--QTPLHIASRLGKTEIVQLLLQHMAHPDA---ATTNGYTPLHISAREGQLETASVLLEAGAS--HSLATKK-GFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLL------------QYGAET-NALTKQGVTPLHLASQEGHADMAALLMS-KGAQINVPT-KSGLTALHLAAQEDRVAVAEILVRNGAN-LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 3 Score: 287.345 bits (734), Expect = 1.265e-77
Identity = 263/841 (31.27%), Postives = 410/841 (48.75%), Query Frame = 2
Query: 1232 QMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFK--PELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEM 3736
            +M  +   S + A  AG+I  + E LK   +  T      +G  A+H+A ++  ++ ++ L D  A ++     G T LHI++      ++K L    AD+N       + L+MAA++ H  +V  L++    N  T  ++G T + +    GH +    LL          K     LH AA+         LL    N + ++K  +TPLHIA  YGN  V   L+  GA V+F  + GI   +PLHVA+   N      +LL  G+ ++   ++G + LH A+RSG+   ++ LL++GA      K+G SPLH+  +  H   V+ L+    + K+ +D + L  L      TA+H AA     R         + K+LL+   +   +      TPLH  A   N   ++E++      IQ V     ++G +P+  A+  GH  IV +LL+N A  DV +  G T+LH+AA  G   V   LL + A V+A+++   TPLH+A++ G  ++V+ L+ ++ A  DA T N  TPLH++A+ G+ E    LL      A    A  +G TPLH+ +K    DV +L L+ +  P+   +A  +G+T  H+AA   +  V    +    S     KN   G T LH+AA+     +  VLL  GA        G+T LHLA++ GH  +  +L  K +   V  KSG+T LH+AA   ++  V E+L    AN+            D  T+ G TPL +A   G+  +V  LL  +G  VN+ T  NG TPLH A+Q G+T++ ++LL  G   N +T     G TAL  A   G+I +
Sbjct:   42 EMLSDSNTSFLRAARAGNIDKVLEYLKGGVDISTC---NQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLEN-GGNQSTATEDGFTPLAIALQQGHNQVVSILLENDT----KGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI---TPLHVASKRGN-TNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLL----QHKAPVDDVTLDYL------TALHVAAHCGHYR---------VTKLLLDKRANPNARA-LNGFTPLHI-ACKKNRVKVMELLVKYGASIQAVT----ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQLETASVLLEAG---ASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPD---SAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN---GYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRV-AVAEILVRNGANL------------DHQTKLGYTPLIVACHYGNAKMVSFLLQ-NGASVNAKT-KNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVT---VNGNTALGIARRLGYISV 817          

HSP 4 Score: 254.603 bits (649), Expect = 1.407e-67
Identity = 241/793 (30.39%), Postives = 379/793 (47.79%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVE--ALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDG--DVKIQTKYTEETPLHYCATAGN---SDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+ G   +   K G TALH ++     +VVK L+ + AD N         P+++A          V+  L      +    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +  AL L  D NA +  K+G   T LHIAA   +  +   L +  A V+       + LH+A+++G+T +V LL+D+    +  + ++G T +H  + SGH  +   LL +G PL    K G   LH AAQ  HV  VK LL   A V+  T D  T LH+A   G+  V + L+   A  N +  +   +PLH+A   KN  K  E+L+K GA++    ++G + +H+A+  G+L ++  LLQ GA P +    G + LH+  R     +V+ L+        R  AM  V+    E +T +H A+ L +         T+I+++LL++    D      Y   TPLH  A  G    + VLLE      H +        K G++PL   S  G  ++  +LL+  A  D   ++G+T LH+AA   ++ VA +LL   A  +  +K G TPLH+AA+    D+   L+ +  A  +ALT    TPLHLA+Q G  ++  +LL  K   A        G T LHLAA+ D   V  + +R     L + +  G T   +A   G+  ++   ++   SV    KN   G T LH AA+ G+  ++ VLL  GA P     +G T L +A + G+  +++ L+
Sbjct:   84 LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINA-QSQNGFTPLYMAAQENHLD---VVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL-------PALHIAARKDDTKSAALLLQNDHNADVQSKSGF--TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDR-GSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNAR-ALNGFTPLHIAC-KKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLL--------RNGAM--VDARAREDQTPLHIASRLGK---------TEIVQLLLQHMAHPDAATTNGY---TPLHISAREGQLETASVLLEA--GASHSL------ATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLL-QYGAETNALTKQGVTPLHLASQEGHADMA-ALLMSK--GAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGAN-LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKN---GYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLR 822          

HSP 5 Score: 214.542 bits (545), Expect = 2.653e-55
Identity = 182/564 (32.27%), Postives = 287/564 (50.89%), Query Frame = 2
Query: 2276 NNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEK--LINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINA-SHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            N  G  A+H AA    K  H      D+++ LL+    V   TK    T LH  + AG ++V+  +V     K    +N Q++NG++PL  A+   H ++V  LL+N        E G T L +A ++GH  V ++LL +    + K K  L  LH+AA+   KD  +   L+ +N    D  + +  TPLH+AA YG   V  +LL ++    D  A +  G TPLH+A+K  ++++VRL L    +  I+A + DG+T  H AA +G  A ++  +     ++   KN   G + LH+AA+G H + VK LL   A   +   D +T LH+AA  GH+ + ++L  K +       +G TPLH+A    ++  V E+L    A+I++            +TESGLTP+H+A+  GH N+V LLL  +G   +  +N  G T LH A++ G   V   LL ++   +  R  + +T LH AS  G  E+  L +   A  +A+   G+TPLH +A+ G L+   +L+E GAS    T     PL + + +   +V   LL+ +
Sbjct:   77 NQNGLNALHLAA----KEGH-----MDLVQELLDRGAPVDSSTKKGN-TALHISSLAGQAEVVKTLV-----KRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAAR---KDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVA-TLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVRLLLDRGSQ--IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKN---GLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVK-VMELLVKYGASIQA------------VTESGLTPIHVAAFMGHLNIVLLLLQ-NGASPD-VSNIRGETSLHMAARAGQAEVVRCLL-RNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQ 594          

HSP 6 Score: 159.458 bits (402), Expect = 1.936e-38
Identity = 151/513 (29.43%), Postives = 242/513 (47.17%), Query Frame = 2
Query:  857 GEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLK-AECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEY 2380
            G   +VE LL     EK  P     +   +PL +A + + +  V  LL+     +DV  D  TALH AA      V KLLL K+A+PN     G T   P+H+AC +       V+ LL    ++   + + G   +  A   G ++ +  LL+       +NI+    G+ ++H+A R    E +R L    A ++ +    QT LHIA+      I++ L   +A  +       + LH++A +G  +   +L++    + L   K+G T +HV S  G  +    LL+R  P     K G   LH AA   +  V   LLDKGA+ +   K+ YTPLHIA K     +   L+ YGA+ N   K G+   +PLH+A+   + +  A +L+  GA +N   K+G +ALH+A++   + + + L++ GA+     K G +PL +    CHY   + +VSF  +  +       VN     G T +H AA+           +T II +LL++
Sbjct:  318 GHEASVEVLL-----EKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFT---PLHIACKKNRVK---VMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR----GETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLA-TKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGV---TPLHLASQEGHADMAA-LLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVA---CHYGNAK-MVSFLLQNGAS------VNAKTKNGYTPLHQAAQQ---------GNTHIINVLLQH 791          

HSP 7 Score: 152.525 bits (384), Expect = 2.029e-36
Identity = 130/428 (30.37%), Postives = 205/428 (47.90%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNL--FGGSTKCLPIHLACSRTGTSSGTVISLLK--ATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQEL 2215
            TPL +ACK NR+  ++ L++ G +   V + G T +H AA     ++V LLL   A P++    G T    +H+A +R G +   V  LL+  A   AR + D+     L  A   G    ++ LL+            Y+    +HI+ R+  +E   +L +A A  ++    G T LH+ ++     + K L    A  +       + LH+AA   + K+  LL+DK   +  T  K G T +H+ +     +    LL+ G   +   K G   LH A+Q GH ++   L+ KGA +N  TK   T LH+A +     V E L+  GA ++ +   L  +PL VA    N  K    LL++GA+VN   KNG + LH A++ GN  ++  LLQ GA P+ +  +GN+ L I  R  +  +V  L
Sbjct:  408 TPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS---LHMA-ARAGQAE-VVRCLLRNGAMVDARAREDQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYT---PLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDK-GASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTK-LGYTPLIVACHYGNA-KMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 8 Score: 131.339 bits (329), Expect = 7.358e-30
Identity = 104/330 (31.52%), Postives = 158/330 (47.88%), Query Frame = 2
Query: 3059 AAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGV---------------EVNSAT------------NNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGR---TALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            AA  G++  + E+++    +    +N   G  ALHLAA+ GH  LV+ LLD GA        G T LH+++  G   +++ L  + +     +++G TPL++AA    +D V  +L +            G Q     TE G TPL +A Q GH  +V +LL  D                 +  SA             + +G TPLH A+  G+ NV ++LL    N+    DF  R   T LH AS  G+  M  L + +G+ I+A    G TPLH AA+SG+    ++L+E+GA   A T +   PL +AA  +H E +  LL++K
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQN---GLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLEN-----------GGNQ--STATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLL----NRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 363          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 328.176 bits (840), Expect = 2.111e-90
Identity = 258/828 (31.16%), Postives = 413/828 (49.88%), Query Frame = 2
Query: 1460 TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIV-ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK---------------GGILDE-------------SPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGN---SDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLL 3847
            + L  A  GN +  L ++++ I ++N+ +    + LH+A+++GH K+V ELL    +    T  K+GNT +H+ +++G  +    L+  G  ++  +  G   L+ AAQ  H+ VVK LL+ GAN +  T+D +TPL +A++ G+  VV  LI YG +   +                 +L +             +PLH+AA  +N    A++LL  GANVN T KNG + LHIASR GN+ M++ LL  GA      KD  +PLH   R  H  I++ L+      +++             G + +H AA+          +  D ++ LL+Y+ ++   T     TPLH  A  G+   + VLL+             N +A NG++PL  A    H   + +LLK++A ++   E G+T LH+AA  GH N+   LL   A  NA +    TPLH+A++ G+ ++ + L+ +N A VDA   + +TPLH AA+ G KE+ + LL HK   A+P +A + G TPLH+AA+  H   +R+ L    +  +  +  G T  H+A+  G + V +  +    +     KN   G T LH+A    +  +VK+L+  G +      +G T LH+AAK     +  VL    +     +  G+TPLH+A+  G+ D V  ML    AN+            ++  ++GLTPLHL +Q GH  +   L+   G  V +A+   G TPLH A   G+  +   LL + ++ +  +   G T LH A+  GH ++  L +  GA  N   + G +PL  A + GY+ V  +L
Sbjct:   13 SFLRAARSGNLDKALDHIKNGI-NINIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATT--KKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN-MSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAK----------TKNGLSPIHMAAQ---------GDHMDCVRQLLQYNAEIDDIT-LDHLTPLHVAAHCGHHRMAKVLLD--------KGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLL-QNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHK---ANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQ-QVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKN---GLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVA-MLISKQANV------------NLGNKNGLTPLHLVAQEGHVGIADTLVK-QGASVYAAS-RMGYTPLHVACHYGNIKMVKFLLQQQAH-VNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 2 Score: 322.398 bits (825), Expect = 1.344e-88
Identity = 257/818 (31.42%), Postives = 395/818 (48.29%), Query Frame = 2
Query: 1685 SGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSV----------IHG-------------LKNKST-------GSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDG---------------------VEV------NSATNN----NGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRN 3955
            SG+ +  +  ++ G+ +++ N+ G   LH A++ GHV +V  LL  G  + A TK   T LHIA   G   VV  L+ Y                                   GANVN     G S L++A++  +LE++K LL+ GA+ S+  +DG +PL + ++  H  +V  L+++  K K R+ A+              H AA           +DT    +LL+ D +  + +K T  TPLH  A   N  V   ++N   +     VN   KNG +PL  AS  G+  +V +LL   A++D   +  +T LH AA  GH  +  +LL H A + AK+K GL+P+H+AAQ  + D V +L+  N A +D +TL+  TPLH+AA  G   + + LL  K   A+ +A +  G TPLH+A K +H   + L L+    L    +  G+T  H+AA  G L ++K  ++   S           +H              L+N +          T LH AA  GH +LVK+LLD  ANP      G T LH+AA+ GH H + +L    + +V   K G TPLHVA+ YG++D V E+L +  AN             +   ++GLTPLH+A    + ++V+LL++  G                     +EV      N A+ N     G TPLH ASQ G  ++ ++L+ K +N +   +  G T LH  +  GH+ +A   + QGA + A+  MG+TPLH A   G +K+ K L+++ A   A+T     PL  AA   HT++++ LL++
Sbjct:   20 SGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNY-----------------------------------GANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPAL--------------HIAAR---------NDDTRTAAVLLQNDPNPDVLSK-TGFTPLHIAAHYENMSVAQLLLNRGAN-----VNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN-AEIDDITLDHLTPLHVAAHCGHHRMAKVLL-DKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVD-VAELLLERGAN------------PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQAN-VNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKH 754          

HSP 3 Score: 288.5 bits (737), Expect = 4.657e-78
Identity = 259/840 (30.83%), Postives = 414/840 (49.29%), Query Frame = 2
Query: 1229 LQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGV-------PLHM-----------------PN-----KTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDE-SPLHVAATTKNGE-KCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKN--GWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSV-IHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSIL 3646
            L +  + A S + A  +G++    + +K       NI  + +G   +H+A ++  V+ +  L  +  ++      G T LHIAA    E ++  L +  A+VN       S L+MAA++ H ++V+ L++      L  + +G T + V    GH      L+  G         LH+                 PN     KTG   LH AA   +++V + LL++GANVN   K+  TPLHIA + GN  +V  L+  GAQ++ +    DE +PLH AA  +NG  +  E+LL+ GA +    KNG S +H+A++  +++ ++ LLQ  A+   I  D  +PLH+     H+ + + L+    K  +R      +N     G T +H A     K+ H    D     +LL++   ++  T+ +  TPLH  A  G+       +N +++ +Q   +  A N    +PL  AS  GH E+   LL+N A+VD   +   T LH AA  GH+ +  +LL HKA  ++ +  G TPLH+AA+ G+   +  L++     V  +T    TPLH+A++YG+ +V   LL      A+P AA   G TPLH+A  +++ DVV+L +  K     + + +G T  HIAA    + V    ++   S     L+    G T LHLA++ G   +V +L+   AN    N +G+T LHL A+ GH  + + L  + +    +++ G TPLHVA HYG I  V + L    A++ ++            T  G TPLH A+Q GH ++V LLL   G   N  T +NGT+PL  A + G+ +V  +L
Sbjct:    4 LFLQADAATSFLRAARSGNLDKALDHIKNGI--NINIANQ-NGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQ--TKDELTPLHCAA--RNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARA-----LN-----GFTPLHIAC----KKNHMRSMD-----LLLKHSASLEAVTE-SGLTPLHVAAFMGH-------LNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVK-MTKKGFTPLHVASKYGKVDVAELLLERG---ANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQ----GITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMV-KFLLQQQAHVNAK------------TRMGYTPLHQAAQQGHTDIVTLLLK-HGALPNEIT-SNGTSPLGIAKRLGYISVIDVL 784          

HSP 4 Score: 238.81 bits (608), Expect = 1.007e-62
Identity = 215/793 (27.11%), Postives = 371/793 (46.78%), Query Frame = 2
Query: 1007 GVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDA--------------------------AIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            G+N N   ++G   LH A+K   E  VK++L           +TK     L  +        V  L+    +   Q  K G   L  A +   +  +K LL+    Q    +  ++  A                          A+HIA R  D     +L   +   ++ +  G T LHIAA   + ++ + L +  A+VN       + LH+A+ +G+  +V LL+D+    +  + K+  T +H  + +GH      LL  G P+    K G   +H AAQ  H++ V+ LL   A ++  T D  TPLH+A   G+  + + L+  GA+ N +  +   +PLH+A   KN  +  ++LLK  A++    ++G + LH+A+  G+L ++K+LLQ GA P+       +PLH+  R  H     E+  F  +  +++DA         + +T +H AA +  K         +++K+LL++  +    T     TPLH  A  G+   +  I   L+   Q V  K  K G++PL  AS  G  ++  +LL+  A  +   ++G+T LH+A    + +V  +L+      ++ ++ G TPLH+AA+    ++   L+ +N A+ +  +L   TPLHLA+Q GR ++   L+  +   A+    +  G TPLHL A+  H  +    ++ +   +  AS  G T  H+A   G++ ++K  +   +   H       G T LH AA+ GH  +V +LL  GA P E  ++G + L +A + G+  +++VLK
Sbjct:   33 GININIANQNGLNGLHLASK---EGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHK-GFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDR-GAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANAR-ALNGFTPLHIAC-KKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHC----EVAQFLLQNAAQVDARA------KDDQTPLHCAARMGHK---------ELVKLLLDHKANPDSATT-AGHTPLHIAAREGH---IHTIRILLDAGAQQV--KMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLL-QNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQ---ANVNLGNKNGLTPLHLVAQEGHVGIADTLVK-QGASVYAASRMGYTPLHVACHYGNIKMVKFLL---QQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLK 785          

HSP 5 Score: 228.794 bits (582), Expect = 1.177e-59
Identity = 204/725 (28.14%), Postives = 325/725 (44.83%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVK---------------------------------YGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNK------QAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLR 3001
            +PL +A ++N L  V  LLE G N +   +DG T L  A +   E+VV LL+          G  +   +H+A     T +  V+          LQ D                               ++  K +G   +HIA   +++   +LL +  A +N     G T LHIA+   +  +++ L    A ++     + + LH AA  GH +I+E+L++     +  + K G + +H+ +   H +    LL+    +          LH AA  GH  + K LLDKGA  NAR  + +TPLHIA K                                  G+  +V+ L+  GA  N    +  E+PLH+A+   + E  A+ LL++ A V+   K+ ++ LH A+R G+ E++K LL   A+P      G++PLHI  R  H   ++ L          +DA         +G T +H A         S +   D+ ++LLE   +     K    TPLH      N DV           ++L+V+K       A+NG++PL  A+     E+ S+LL+N A  +     G+T LHLA+++G  ++  +L+  +A VN  +K GLTPLHL AQ G+  + + L+ +  A+V A +    TPLH+A  YG  ++ + LL  +   A   A    G TPLH AA+  H+D+V L L+
Sbjct:  111 SPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVL----------LQNDP----------------------------NPDVLSK-TGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLE-HGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPN-ASNVKVETPLHMASRAGHCE-VAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRIL----------LDAGAQQVKMTKKGFTPLHVA---------SKYGKVDVAELLLERGANPNAAGK-NGLTPLHVAVHHNNLDV-----------VKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQG-ASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQ---AHVNAKTRMGYTPLHQAAQQGHTDIVTLLLK 753          

HSP 6 Score: 203.756 bits (517), Expect = 5.004e-52
Identity = 163/508 (32.09%), Postives = 259/508 (50.98%), Query Frame = 2
Query: 2438 ATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTP-LHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNK 3958
            A +GN D  L+ +     K  + +N   +NG + L  AS  GH ++V  LL +   ++   + G TALH+AA  G   V   L+ + A VNA+S  G +PL++AAQ  + ++V K + EN A     T +  TPL +A Q G + V   L+ +            + + P LH+AA+ND +    + L+  P   +  S  G T  HIAA   +++V +  +    +V    KN   G T LH+A+  G+  +V++LLD GA    +  D +T LH AA+ GH  ++E+L    +      K+G++P+H+AA    +D V ++L            +   ++ D+ T   LTPLH+A+  GH  + ++LL+  G + N A   NG TPLH A +  H     +LL K S  +      G T LH A+  GH+ +    + +GA  NAS+    TPLH A+++G+ +V + L++  A  +A   D Q PL  AA   H E++  LL +K
Sbjct:   18 ARSGNLDKALDHI-----KNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVV-KFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINY--------GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDV-LSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKN---GITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLL------------QYNAEIDDI-TLDHLTPLHVAAHCGHHRMAKVLLD-KGAKAN-ARALNGFTPLHIACKKNHMRSMDLLL-KHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHK 491          

HSP 7 Score: 191.43 bits (485), Expect = 2.603e-48
Identity = 176/590 (29.83%), Postives = 268/590 (45.42%), Query Frame = 2
Query:  929 PETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKG--GILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLL 2692
            P+   TPL +A +   ++ V  LL+ G   +   KD  T LH AA+     ++++LL   A P          PIH+A    G     V  LL+        +  +    L  A   G     K LL    +      +  +G   +HIAC+K  + ++ LL   +A +      G T LH+AA      I+K L    A  N  +    + LHMA+  GH ++ + L+      V  R K+  T +H  +  GH E    LL            G   LH AA+ GH++ ++ LLD GA     TK  +TPLH+A KYG   V E L+  GA  N  G  G+   +PLHVA    N +   ++L+  G + + T +NG + LHIA++   +E+   LLQ GA P+     G +PLH+  +     +V  L+S              VNL N  G T +H    LV +  H    DT     L++    V   ++    TPLH     GN    +++V FL  + Q  VN + + G++PL  A+  GH +IV++LLK+ A  +    +G + L +A   G+ +V +VL L
Sbjct:  234 PKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGA-PIQAKTKNGLSPIHMAAQ--GDHMDCVRQLLQYNAEID-DITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANA---RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQN-AAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGL---TPLHVAVHHNNLD-VVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQAN----------VNLGNKNGLTPLH----LVAQEGHVGIADT-----LVKQGASVYAASRMGY-TPLHVACHYGN----IKMVKFLLQQ-QAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKL 786          

HSP 8 Score: 137.887 bits (346), Expect = 6.608e-32
Identity = 114/383 (29.77%), Postives = 185/383 (48.30%), Query Frame = 2
Query: 2924 ADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVL-----KPKISFRV------------------------VSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIEN 3985
            A+  G   LHLA+K  H  +V   L    EL    +  G T  HIAA  G   V+ E + +  +V         G + L++AA+  H ++VK LL+ GAN +    DG T L +A + GH +++ +L     K K+                            V +K+G TPLH+AAHY  +  V ++L +  AN+            +   ++G+TPLH+AS+ G+  +VRLLL+  G ++++ T +   TPLH A++NGH  +  ILL +    I  +   G + +H A+   H++     +   A+I+       TPLH AA  G+ ++ K+L+++GA   A   +   PL +A   NH   M  LL++  S   + E+
Sbjct:   39 ANQNGLNGLHLASKEGHVKMVLELLHSGIELEAT-TKKGNTALHIAALAGQEKVVAELVNYGANVN---AQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMS-VAQLLLNRGANV------------NFTPKNGITPLHIASRRGNVMMVRLLLD-RGAQIDAQTKDE-LTPLHCAARNGHVRIIEILL-EHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTES 401          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 325.479 bits (833), Expect = 2.179e-89
Identity = 263/871 (30.20%), Postives = 428/871 (49.14%), Query Frame = 2
Query: 1445 NGMGQ------------TVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTD-------------VPANIKSERPKTGEQMK------------DVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFL 3946
            NG+GQ            + L  A  GN + +L+YL+  + D++  +    +ALH+AA++GH  +V+ L+D+    V +  K+GNT +H++S++G  E   +L++RG  ++  ++ G   L+ AAQ  H++VV+ LL+ G N +  T+D +TPL IA++ G+  VV  L+      N   G +    LH+AA  K+  K A +LL++  N +   K+G + LHIA+  GN+ +   LL  GA      ++G +PLH+                                                     S   +T+++++LL+    +  +T+    TPLH CA     +  +E+   LE    L+   + KNG SPL  A+   H E V  LL++ A VD      +TALH+AA  GH  V  +LL  +A  NA++  G TPLH+A +     ++E L+    A++ A+T +  TP+H+AA  G   +   LL +    A P  ++ RG+T LH+AA+   ++VVR  LR    +   A  D  T  HIA+  G   +++  ++    + H     + G T LH++A  G  +   VLL+AGA+ +     G T LH+ +KYG   + ++L  + +    + K+G+TPLHVAAHY     V  +L D              P +I +++     QM             + LT+ G+TPLHLASQ GH ++  LL++  G ++N  T + G T LH A+Q     V  IL+   +N +  +   G T L  A  +G+ +M +  +  GA +NA    G+TPLH AA+ G   +  +L++ GA   A T +    L +A    +  V+  L
Sbjct:   18 NGLGQRRKRPKKSDSNTSFLRAARAGNIDKVLEYLKGGV-DISTCNQNGLNALHLAAKEGHMDLVQELLDR-GAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL-----ENDTKGKVRLPALHIAAR-KDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVA----------------------------------------------------SKRGNTNMVRLLLDRGSQIDAKTR-DGLTPLH-CAARSGHEASVEV--LLEKGAPLLA--RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYG-ASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNG---ASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARARED-QTPLHIASRLGKTEIVQLLLQH---MAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDN-QKVALLLLDKGASPHTTAKNGYTPLHIAAKK----NQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMS-KGAQINVPTKS-GLTALHLAAQEDRVAVAEILVRNGAN-LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 2 Score: 318.931 bits (816), Expect = 2.216e-87
Identity = 255/808 (31.56%), Postives = 405/808 (50.12%), Query Frame = 2
Query: 1643 RDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPE--------------------------LLIN-ASHD-----GMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHS 3964
            +  + NT     + +G+ +  +  L+ GV +   N+ G   LH AA+ GH+++V+ LLD+GA V++ TK   T LHI+   G   VV+TL+                                   K GA++N   +NG + L++A++  +L++++ LL+ G + S   +DG +PL I ++  H  +V  L+   N TK +      V LP      A+H AA     RK    +DT    +LL+ D +  +Q+K +  TPLH  A  GN +V   ++N         V+  A+NG +PL  AS  G+  +V +LL   +++D     G+T LH AA  GH     VLL   A + A++K GL+PLH+AAQ  + + V+ L+ ++KA VD +TL+  T LH+AA  G   V + LL  +   A+P A    G TPLH+A K +   V+ L +++                             LL N AS D     G T  H+AA  G   V++  +R N +++     +    T LH+A+  G  ++V++LL   A+P     +G T LH++A+ G      VL    +   ++ K G TPLHV + YG +D V ++L      ++ + P       D   ++GLTPLH+A+   ++ +  LLL  D       T  NG TPLH A++    ++ ++LL  G  +N +T+   +G T LH AS  GH +MAAL + +GA IN     G T LH AA+   + V ++LV  GA+ + +T     PLI+A H+ + +++SFLL+N  S
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLV-----------------------------------KRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE--NDTKGK------VRLP------ALHIAA-----RK----DDTKSAALLLQNDHNADVQSK-SGFTPLHIAAHYGNVNVATLLLNR-----GAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKR---ANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLR-NGAMVDARARED--QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLD-VAKLL------LQRQAP------PDSAGKNGLTPLHVAAHYDNQKVALLLL--DKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTK---QGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGAS 746          

HSP 3 Score: 286.189 bits (731), Expect = 2.896e-77
Identity = 262/833 (31.45%), Postives = 406/833 (48.74%), Query Frame = 2
Query: 1256 SLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFK--PELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILL--GKSSNQITRRDFKGRTALHFASSHGHIEM 3736
            S + A  AG+I  + E LK   +  T      +G  A+H+A ++  ++ ++ L D  A ++     G T LHI++      ++K L    AD+N       + L+MAA++ H  +V  L++    N  T  ++G T + +    GH +    LL          K     LH AA+         LL    N + ++K  +TPLHIA  YGN  V   L+  GA V+F  + GI   +PLHVA+   N      +LL  G+ ++   ++G + LH A+RSG+   ++ LL++GA      K+G SPLH+  +  H   V+ L+      K+ +D + L  L      TA+H AA     R         + K+LL+   +   +      TPLH  A   N   ++E++      IQ V     ++G +P+  A+  GH  IV +LL+N A  DV +  G T+LH+AA  G   V   LL + A V+A+++   TPLH+A++ G  ++V+ L+ ++ A  DA T N  TPLH++A+ G+ E    LL      A    A  +G TPLH+ +K    DV +L L+ +  P+   +A  +G+T  H+AA   +  V    +    S     KN   G T LH+AA+     +  VLL  GA        G+T LHLA++ GH  +  +L  K +   V  KSG+T LH+AA   ++  V E+L    AN+            D  T+ G TPL +A   G+  +V  LL  +G  VN+ T  NG TPLH A+Q G+T++ ++LL  G   N +T     G TAL  A   G+I +
Sbjct:   35 SFLRAARAGNIDKVLEYLKGGVDISTC---NQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLEN-GGNQSTATEDGFTPLAIALQQGHNQVVSILLENDT----KGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI---TPLHVASKRGN-TNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQH----KAPVDDVTLDYL------TALHVAAHCGHYR---------VTKLLLDKRANPNARA-LNGFTPLH-IACKKNRVKVMELLVKYGASIQAVT----ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQLETASVLLE---AGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPD---SAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN---GYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRV-AVAEILVRNGANL------------DHQTKLGYTPLIVACHYGNAKMVSFLLQ-NGASVNAKT-KNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVT---VNGNTALGIARRLGYISV 802          

HSP 4 Score: 254.218 bits (648), Expect = 1.969e-67
Identity = 241/793 (30.39%), Postives = 379/793 (47.79%), Query Frame = 2
Query:  950 LMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVE--ALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDG--DVKIQTKYTEETPLHYCATAGN---SDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLK 3307
            L LA K+  +  V  LL+ G   +   K G TALH ++     +VVK L+ + AD N         P+++A          V+  L      +    ++G   L  A++ G    +  LL+ + + +  +        A+HIA RK D +  AL L  D NA +  K+G   T LHIAA   +  +   L +  A V+       + LH+A+++G+T +V LL+D+    +  + ++G T +H  + SGH  +   LL +G PL    K G   LH AAQ  HV  VK LL   A V+  T D  T LH+A   G+  V + L+   A  N +  +   +PLH+A   KN  K  E+L+K GA++    ++G + +H+A+  G+L ++  LLQ GA P +    G + LH+  R     +V+ L+        R  AM  V+    E +T +H A+ L +         T+I+++LL++    D      Y   TPLH  A  G    + VLLE      H +        K G++PL   S  G  ++  +LL+  A  D   ++G+T LH+AA   ++ VA +LL   A  +  +K G TPLH+AA+    D+   L+ +  A  +ALT    TPLHLA+Q G  ++  +LL  K   A        G T LHLAA+ D   V  + +R     L + +  G T   +A   G+  ++   ++   SV    KN   G T LH AA+ G+  ++ VLL  GA P     +G T L +A + G+  +++ L+
Sbjct:   69 LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINA-QSQNGFTPLYMAAQENHLD---VVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL-------PALHIAARKDDTKSAALLLQNDHNADVQSKSGF--TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDR-GSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNAR-ALNGFTPLHIAC-KKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLL--------RNGAM--VDARAREDQTPLHIASRLGK---------TEIVQLLLQHMAHPDAATTNGY---TPLHISAREGQLETASVLLEA--GASHSL------ATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLL-QYGAETNALTKQGVTPLHLASQEGHADMA-ALLMSK--GAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGAN-LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKN---GYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLR 807          

HSP 5 Score: 159.073 bits (401), Expect = 2.320e-38
Identity = 151/513 (29.43%), Postives = 242/513 (47.17%), Query Frame = 2
Query:  857 GEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPN--LFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLK-AECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVN--FKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEY 2380
            G   +VE LL     EK  P     +   +PL +A + + +  V  LL+     +DV  D  TALH AA      V KLLL K+A+PN     G T   P+H+AC +       V+ LL    ++   + + G   +  A   G ++ +  LL+       +NI+    G+ ++H+A R    E +R L    A ++ +    QT LHIA+      I++ L   +A  +       + LH++A +G  +   +L++    + L   K+G T +HV S  G  +    LL+R  P     K G   LH AA   +  V   LLDKGA+ +   K+ YTPLHIA K     +   L+ YGA+ N   K G+   +PLH+A+   + +  A +L+  GA +N   K+G +ALH+A++   + + + L++ GA+     K G +PL +    CHY   + +VSF  +  +       VN     G T +H AA+           +T II +LL++
Sbjct:  303 GHEASVEVLL-----EKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFT---PLHIACKKNRVK---VMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR----GETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLA-TKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGV---TPLHLASQEGHADMAA-LLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVA---CHYGNAK-MVSFLLQNGAS------VNAKTKNGYTPLHQAAQQ---------GNTHIINVLLQH 776          

HSP 6 Score: 152.525 bits (384), Expect = 2.580e-36
Identity = 130/428 (30.37%), Postives = 205/428 (47.90%), Query Frame = 2
Query:  944 TPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNL--FGGSTKCLPIHLACSRTGTSSGTVISLLK--ATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQEL 2215
            TPL +ACK NR+  ++ L++ G +   V + G T +H AA     ++V LLL   A P++    G T    +H+A +R G +   V  LL+  A   AR + D+     L  A   G    ++ LL+            Y+    +HI+ R+  +E   +L +A A  ++    G T LH+ ++     + K L    A  +       + LH+AA   + K+  LL+DK   +  T  K G T +H+ +     +    LL+ G   +   K G   LH A+Q GH ++   L+ KGA +N  TK   T LH+A +     V E L+  GA ++ +   L  +PL VA    N  K    LL++GA+VN   KNG + LH A++ GN  ++  LLQ GA P+ +  +GN+ L I  R  +  +V  L
Sbjct:  393 TPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS---LHMA-ARAGQAE-VVRCLLRNGAMVDARAREDQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYT---PLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDK-GASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTK-LGYTPLIVACHYGNA-KMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 310.457 bits (794), Expect = 1.206e-87
Identity = 287/950 (30.21%), Postives = 427/950 (44.95%), Query Frame = 2
Query: 1322 EQQTNIKKKYSGDAA-IHIACRKKD----VEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQV---NFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVH--FAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYT-EETPLHYCATAGNSD-VLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAA-----------------------EKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVD-ALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR-RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTE--VMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFI 4054
            +Q   I+  +SGD   I +   K +    ++A+++L   +A +N ++   QT LH+AA  N     + +   +  VNV D   R+ALH AA  GHT++V LL+ K   N+   DK+    +H  +  GH +    L+  G  +   +K G   LHAAA SG + VVK LL     ++       T LH+A   G   VV  LI YGA V   N KG     +PLH AA + +G  C E L+ +GA++N   ++G+S LH+ +  G     ++L+Q G + + + KDGN+PLH+  RY H L++  L++       R                 VH  F   L     HSD       + LL      +I T  +   T LH  A  GN D V L + +  EH      N+  K G +PL +A+ + H+  +  L+     ++  D+ G +ALH AA                       EK        LL   A    K K G +P+H AA  G++  +E L++ +    + A   N ++PLHLAA +G  +  + LL       D +  D  G+TPL LAA   H+D V   L      L      G T  H+A  NG    ++  +               G T L LA  GGH   V +LL+  AN    +  G+  LHLA        ++ L  + +  +  +  G TP+H+AA  G   ++ E+LT   +   S  P     +KD    SG TPLH A   G +  V +LL   G       + N  TPLH A  NGH +  ++LL    + IT  RD KGRT LH A+  G  E   L +   A ++ +D+ G TPL  AA  G +   + L++ GA       D   PL +A   N TE  V+  L R   +T+    N      L + ++    K+V+E +
Sbjct:    8 DQPALIQAIFSGDPEEIRMLIYKSEDINVLDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGA-NINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKG----FTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARR----------------GVHGMFPLHLAALNAHSD-----CCRKLLS--SGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEH------NRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGG-REVDER--DQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPP-----LKD---GSGYTPLHWACFYGQDGCVEVLLEQRGCRC---IDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVAC-SNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELL 908          

HSP 2 Score: 106.301 bits (264), Expect = 1.603e-22
Identity = 132/561 (23.53%), Postives = 224/561 (39.93%), Query Frame = 2
Query:  872 VEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAA--IHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID-----------------------------------KFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDL-----YTPLHIAVKYGNPGVVETLI---------------------------------GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHI----GVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAE 2314
            V+ LL+S  +       R  +   TPL  A        ++ L+  G + N   + GR+ALHYAA    +   ++ L    +P+  G         +   +   ++  +  LL++  +A L+ DK+G   + YA   G    ++ LL     +Q   ++   G+A   +H+A      +AL++L     +++ ++  G+T L +AA  G+ + +   L    + ++      R+ +H+A   GHT  V LL+D                                   + + NV T DK+G   +H+  +    E    LL +   L   +  G   +H AA  GH + +  LL    + ++    L     YTPLH A  YG  G VE L+                                   G+ +         +PLH AA     E C ++LL   A V+    +G + L  A+  G +  L++LL  GA  S+I +DGN+PLH+    G      +I+Q           R+    L+N  N   +T +H AA+
Sbjct:  371 VQLLLKSGGEHN-----RTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVAL----EPDSEG---------VQAEKEKEAAQCLEFLLQSGAAAALK-DKQGYSPVHYAAAFGHRHCLELLLDTHDGRQ---EEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTE-CIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQ-----------RLSDATLINATNAAMQTPLHMAAQ 897          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 302.368 bits (773), Expect = 1.168e-84
Identity = 295/1001 (29.47%), Postives = 435/1001 (43.46%), Query Frame = 2
Query: 1256 SLMYAIEAGSISTIKELL-KAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGM---------------------------------GQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQV---NFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVH--FAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYT-EETPLHYCATAGNSD-VLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAA-----------------------EKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATV-DALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITR-RDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTE--VMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFI 4054
            +L+ AI +G    I+ L+ K+E     + +K+      +H A    D E   LL  + A++N K+ M                                  QT LH+AA  N     + +   +  VNV D   R+ALH AA  GHT++V LL+ K   N+   DK+    +H  +  GH +    L+  G  +   +K G   LHAAA SG + VVK LL     ++       T LH+A   G   VV  LI YGA V   N KG     +PLH AA + +G  C E L+ +GA++N   ++G+S LH+ +  G     ++L+Q G + + + KDGN+PLH+  RY H L++  L++       R                 VH  F   L     HS     D  + LL      +I T  +   T LH  A  GN D V L + +  EH      N+  K G +PL +A+ + H+  +  L+     ++  D+ G +ALH AA                       EK        LL   A    K K G +P+H AA  G++  +E L++ +     +A   N ++PLHLAA +G  +  + LL       D +  D  G+TPL LAA   H+D V   L      L      G T  H+A  NG    ++  +               G T L LA  GGH   V +LL+  AN    +  G+  LHLA        ++ L  + +  +  +  G TP+H+AA  G   ++ E+LT   +   S  P     +KD    SG TPLH A   G +  V +LL   G       + N  TPLH A  NGH +  ++LL    + IT  RD KGRT LH A+  G  E   L +   A ++ +D+ G TPL  AA  G +   + L++ GA       D   PL +A   N TE  V+  L R   +T+    N      L + ++    K+V+E +
Sbjct:   11 ALIQAIFSGDPEEIRMLIYKSEDINVLDAEKRTP----LHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAK-GANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKG----FTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARR----------------GVHGMFPLHLAALNAHS-----DCCRKLLS--SGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEH------NRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGG-REVDER--DQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPP-----LKD---GSGYTPLHWACFYGQDGCVEVLLEQRGCRC---IDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVAC-SNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELL 958          

HSP 2 Score: 296.204 bits (757), Expect = 1.346e-82
Identity = 266/936 (28.42%), Postives = 415/936 (44.34%), Query Frame = 2
Query: 1367 IHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQV---NFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSR-----------------------IDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATA----------------------GNSDVLLEIVNFLEHK-----------IQLVVNKQA------------------KNGWSPLLFASHNGHHEIVSILLK-NNARVDVFD-EHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLL-----DAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGAD---INASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAA 3913
            +H A   +  +A+++L   +A +N ++   QT LH+AA  N     + +   +  VNV D   R+ALH AA  GHT++V LL+ K   N+   DK+    +H  +  GH +    L+  G  +   +K G   LHAAA SG + VVK LL     ++       T LH+A   G   VV  LI YGA V   N KG     +PLH AA + +G  C E L+ +GA++N   ++G+S LH+ +  G     ++L+Q G + + + KDGN+PLH+  RY H L++  L++       R                       + +   ++ P++ G T +H AA            + D +++LL+  G+   +T     TPLHY A +                      G S +     + L+ +           +Q    K+A                  K G+SP+ +A+  GH   + +LL  ++ R +  D  +  + LHLAA  GH     VLL     V+ + + G TPL LAA  G+ D V  L+++  + +    L  +TP+HLA   G     R LL           AD +G+TPL LA    H D V L L  +  +   A   G+   H+A        ++  +  +  ++ G    S G T +HLAA  GH   +  LL     ++ + P  ++  G T LH A  YG    +EVL  +   R +      TPLH A   G       +L  + ++I   R   G            TPLH A+ +G    ++LLL+ D   V+ A +++G TPL  A+  G       LL   +  ++  D  G T LH A S+G  +   + + + +D   INA++    TPLH AA+ G  K  + L+ RGAS +    D   P +  A
Sbjct:   78 LHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAK-GANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKG----FTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAA---------GGNVDCVQLLLKSGGEHN-RTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANV-NTADKKGLMALHLALLCAQDECVQCLLEQDACLLQG---DSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNP-FTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGR-----------TPLHAAAFAGQTECIQLLLSHD-APVDPA-DDHGRTPLMTAAAKGRVGALEALLDAGAG-LSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTPALACA 979          

HSP 3 Score: 242.662 bits (618), Expect = 3.809e-65
Identity = 255/875 (29.14%), Postives = 383/875 (43.77%), Query Frame = 2
Query: 1538 VLDDMDRSALHMAAEKGHTKIVELLIDKFK-CNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNF--KGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTD-IIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHD-GMTCGHIAAANG----------------------SLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDG--MTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLN-CDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQ-----IPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFIL 4057
            VL   D+ AL  A   G  + + +LI K +  NVL  D E  T +H  +  G  E T  L+  G  ++  +      LH A  S   + V+ L+   A+VNAR K+  TPLH+A         E +I     VN   +GG    + LH AA   + E    +LL  GAN+N   K    ALH A+  G+L+++  L+  GA+ S   K G +PLH         +V+ L+S   +          ++ PN  G TA+H A           F   D ++  L++Y  +V  Q      TPLH+ A + +  + LE   FL +     +N Q+++G SPL   + +G       L++N   ++  D+ G T LH+AA  GH  + N L+   A    +   G+ PLHLAA N + D   KL++         +L R T LH AA  G  +  + LL       +    D  G+TPLH AA + H   +   +    +  INA+   G +  H AAA+                         A   EF+         LK+K  G + +H AA  GH   +++LLD      EE + G   + LHLAA +GH   L+VL          +++G TPL +AA  G  D V  +L+      +   P + +Q+       G TP+HLA  +GH   VRLLL+  DG EV    +  G TPL  A   GH +  S+LL + +N +   D KG  ALH A      E     + Q A +   D+ G TP+H AA  G+      L+    S  +     +      PL  A  +     +  LL  +    + I+ + F    + C+ +N  +S    +L
Sbjct:    3 VLKLADQPALIQAIFSGDPEEIRMLIYKSEDINVL--DAEKRTPLHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGG---RTALHHAALNGHTEM-VNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVE----------IDEPNAFGNTALHLAC----------FNGQDAVVSELIDYGANVS-QPNNKGFTPLHFAAASTHGALCLE---FLVNN-GADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGR-TCLHAAAAGGNVDCVQLLLKSG---GEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTD--INATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFL-LQSGAAAALKDKQ-GYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLS------QGASPLSTDQLY------GRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREAN-VNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQR--GCRCIDGNPFTP--LHCAVVNGHESCAALLL 821          

HSP 4 Score: 228.024 bits (580), Expect = 2.326e-60
Identity = 261/950 (27.47%), Postives = 391/950 (41.16%), Query Frame = 2
Query:  941 ETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETI-LKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLL-------RRGV----PLHM----------------------PNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATT----------------------KNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLL--QEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLI----NENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLL--DAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTP 3598
            +TPL +A  +N L   + ++ +  + N   + GRTALH+AA     ++V LLLAK A+ N F        +H A          V+S+L +  +     DK G   L  A  +G I+ +K LL    E     +    G+ A+H+AC       +  L D  A ++  N  G T LH AA      + L++L +  AD+N+     +S LHM A  G     + LI      + + DK+GNT +HV +  GH     +L+       RRGV    PLH+                      P+  G  CLHAAA  G+V+ V+ LL  G   N   K   TPLH A    +   +ETL+  G  +N        S LH AA +                      K   +C E LL+SGA      K G S +H A+  G+   L+ LL   +G      C +  SPLH+   + H   +Q L+    +   R          +  G T +  AA     R H+     D +  LL          +    TP+H     G++  +  +++  E     V++     G +PL+ A   GH + VS+LL+  A V+  D+ G+ ALHLA           LL   A +      G TP+HLAA  G+   + +L+    +E+ +       +  TPLH A  YG+      LL  +      +  D    TPLH A  N H     L L            D M                       S I G ++ + G T LH AA  G  + +++LL  DA  +PA+++  G T L  AA  G    LE L    +   + ++ G TPLHVA   G  D V  +L  +          +   + +    +  TPLH+A+Q G +  V+ LL+  G    +  + +G TP
Sbjct:  108 QTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDG-RALHWAAFMGHLD---VVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEID---EPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGG-EINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQ-WGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDER----------DQAGRTPLALAA----LRGHA-----DCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLD--EPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQR----GCRCIDGNPFTPLHCAVVNGHESCAALLL------------DAM----------------------GSDITGCRD-AKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDH--GRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRL----------SDATLINATNAAMQTPLHMAAQRGLKKAVQELLS-RGASTQT-VDEDGLTP 974          

HSP 5 Score: 107.071 bits (266), Expect = 1.134e-22
Identity = 132/561 (23.53%), Postives = 224/561 (39.93%), Query Frame = 2
Query:  872 VEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDA--AIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAA-EGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLID-----------------------------------KFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDL-----YTPLHIAVKYGNPGVVETLI---------------------------------GYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHI----GVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAE 2314
            V+ LL+S  +       R  +   TPL  A        ++ L+  G + N   + GR+ALHYAA    +   ++ L    +P+  G         +   +   ++  +  LL++  +A L+ DK+G   + YA   G    ++ LL     +Q   ++   G+A   +H+A      +AL++L     +++ ++  G+T L +AA  G+ + +   L    + ++      R+ +H+A   GHT  V LL+D                                   + + NV T DK+G   +H+  +    E    LL +   L   +  G   +H AA  GH + +  LL    + ++    L     YTPLH A  YG  G VE L+                                   G+ +         +PLH AA     E C ++LL   A V+    +G + L  A+  G +  L++LL  GA  S+I +DGN+PLH+    G      +I+Q           R+    L+N  N   +T +H AA+
Sbjct:  421 VQLLLKSGGEHN-----RTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVAL----EPDSEG---------VQAEKEKEAAQCLEFLLQSGAAAALK-DKQGYSPVHYAAAFGHRHCLELLLDTHDGRQ---EEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTE-CIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQ-----------RLSDATLINATNAAMQTPLHMAAQ 947          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 3418.25 bits (8862), Expect = 0.000e+0
Identity = 1781/1824 (97.64%), Postives = 1785/1824 (97.86%), Query Frame = 2
Query:   62 MNKIPTINYEALIETTDIXXXXXXXXXXXXXXXXXXXXXDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESXXXXXXXXXXXXXXXEISQXXXXXXXXXXXXXXXXXXXXXXQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLSIRNVEGNSDLTVDDFPE*KT*FSF 5533
            MNKIPTINYEALIETTDIENSKTQSSEETSESSSTNLNNDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESPVKKKTPVKKHPVKKEISQSNINIILEEPIEIIEPKSLEEIQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKY+QSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGH+NVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAKLSNEFEELSKKEKERSKDLITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKLFIFYLILIFPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTF  F                 TG+    L           INPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLS+RNVEGNSDLTVDDFP  K  F F
Sbjct:    1 MNKIPTINYEALIETTDIENSKTQSSEETSESSSTNLNNDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESPVKKKTPVKKHPVKKEISQSNINIILEEPIEIIEPKSLEEIQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYIQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAKLSNEFEELSKKEKERSKDLITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKLFIFYLILIFPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFFYF-----------------TGLLVSEL-----------INPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLSVRNVEGNSDLTVDDFPNKKHNFPF 1796          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 3246.45 bits (8416), Expect = 0.000e+0
Identity = 1710/1824 (93.75%), Postives = 1724/1824 (94.52%), Query Frame = 2
Query:   62 MNKIPTINYEALIETTDIXXXXXXXXXXXXXXXXXXXXXDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESXXXXXXXXXXXXXXXEISQXXXXXXXXXXXXXXXXXXXXXXQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLSIRNVEGNSDLTVDDFPE*KT*FSF 5533
            MNKIPTINYEALIETTDIENSKTQSSEETSESSSTNLNNDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESPVKKKTPVKKHPVKKEISQSNINIILEEPIEIIEPKSLEEIQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKY+QSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGH+NVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAKLSNEFEELSKKEKERSKDLITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKLFIFYLILIFPLSWFIILLPVGKKIFTAPL   + +    V +  L F +P+                                  PI    +  ++  +L +  F   + TL F                                LSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLS+RNVEGNSDLTVDDFP  K  F F
Sbjct:    1 MNKIPTINYEALIETTDIENSKTQSSEETSESSSTNLNNDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESPVKKKTPVKKHPVKKEISQSNINIILEEPIEIIEPKSLEEIQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYIQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAKLSNEFEELSKKEKERSKDLITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKLFIFYLILIFPLSWFIILLPVGKKIFTAPLYGILFFGFFAVMVQTLSF-MPM----------------------------------PILIPELIYIRNQLLSYATFMCAIVTLDF--------------------------------LSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGDYSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLIIYSTKIYYRIRKRPLYKENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLSVRNVEGNSDLTVDDFPNKKHNFPF 1757          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 2816.95 bits (7301), Expect = 0.000e+0
Identity = 1480/1484 (99.73%), Postives = 1482/1484 (99.87%), Query Frame = 2
Query:   62 MNKIPTINYEALIETTDIXXXXXXXXXXXXXXXXXXXXXDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESXXXXXXXXXXXXXXXEISQXXXXXXXXXXXXXXXXXXXXXXQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLF 4513
            MNKIPTINYEALIETTDIENSKTQSSEETSESSSTNLNNDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESPVKKKTPVKKHPVKKEISQSNINIILEEPIEIIEPKSLEEIQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKY+QSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGH+NVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAKLSNEFEELSKKEKERSKDLITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKLFIFYLILIFPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTF  F
Sbjct:    1 MNKIPTINYEALIETTDIENSKTQSSEETSESSSTNLNNDKEFIIKEKKKSNYAPSEYSKFESGESKCKNDFILKVKSNRDDLFSSTKAFKDFENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEFERLPIVITKESPVKKKTPVKKHPVKKEISQSNINIILEEPIEIIEPKSLEEIQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYIQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAKLSNEFEELSKKEKERSKDLITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKLFIFYLILIFPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFFYF 1484          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 1874.37 bits (4854), Expect = 0.000e+0
Identity = 982/1732 (56.70%), Postives = 1254/1732 (72.40%), Query Frame = 2
Query:  338 FENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEF-ERLPIVITKESXXXXXXXXXXXXXXXEISQXXXXXXXXXXXXXXXXXXXXXXQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGD-YSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLII-YSTKIYYRIRKRPLYK---------ENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLSIRNVEG---NSD 5488
            +  P   NV D L+ + T  E  +     SK    I D I  +P N+  +    F      R  IDP  Y K++  +EP+PL+I P  TP        H+    +  D F E  P V             +K   ++ +S +  +   E  ++  E  +  + +   FM+LC K +W   E LLR++ KE  L  Y++ ET ETPLM AC++NRL+ V+RLL++ VN N  + DGR ALHYAAK++  ++VKLLL+KKAD N+F  + K LP+HLAC+RT   SG + +LLK T++ RLQ DK G+I LM+A+E G I TIKELL+ + + Q N+K+K SGD A+HIACRK D+E+ RLLC+A A IN +N +GQT LHI AE N E +LKYL +  A+ N+LD+ DR A++MAA KG+TK+VE LIDK+K N+LTRDK+GNTLMH+TS+ G  ETTMS LRRGVPLHMPNK GSVCLH AAQ GH+NVV+ LL+KGANVNARTKDLYTPLHIAVKYG+PGVVE LIGYGA+ N KGG+ DE PLH+AA +K+G+ C EMLLKSGANVN  MK GE+ LH+ S+ GNLEM+KSL  EGA P I C +GNS  H+ V+ CH+ +V+E V F NK  +R D   ++N  N  GET++HFA +L +   HS+ ED DIIK+LLE  GD+KI     +E+PLHYCA AGNSD+L EIV F  +++   VNKQ KNGWSPLLFAS NGHH+ V ILL+N++RVD+FDE+GMTALHLAAEKGH  VA +LL +K+FVNAKSK GLTPLH+AAQNG+K+LVE LI +  A VD  TLN KTPLH+AA+ G+ +VC+SLL+ K    DP A+D++GQTP+HLAAKNDH +VV+LFLR+KPELL+  + +GM C H+AA+ GSL+V+KEFMRFNK +IH ++NKS+GST LHLA EGGH K+VK LLDAGANP +ENN+GMT LH+AAKYGH  LLE LK K++    S K+GMT LH+A+HYGQIDFV E+L +VPA+IKS+ PK+    +   T+SGLT LHLASQSGHENLVRLLLN  GVEV+SAT++NGT PLH A  NGH +VTS+LL KS+ Q+T++D KGRTALH  SSHGH+E+  L IGQGADIN  DN+GFTPLHYAAKSGYLKVCKLLVE GA C A+TNDF +PLI AA  NHTEV+S+LL N HST KL+ ++KFL+D+MICSK+NNFK++EEFILLSPAPAEIAAKLS  F  LS+KEKERSKDL  +SE+C++MCTDL ALAA E GADKLLKS D +GVQFLDILIETEQKEVISHP V +Y+S+VW GD+ WP WK  +  + L FPLSW   +LP  K +F  P++KF++YL SH+YL  LL YV +    P  R       +E +LLI L+GL +SEL+NP+DR SIA L+  +L F   A++V   S       +PE+IYIRNQ+L  ATF+C +VTLDFLS HHLFGPWT+IIRDL+ DL +F+V   +FL +FAC+L   FQ +   +    +P ++  ++ LYF LFG  +P D+PDP L+P Y   L++ VFG AL++ IIVLINLLIAMM++TY+ IQ +SD EWKYGRAKLIRNMK T+PI SPF +++Q II  +T +YY+I+++P+ +         E+  +R+  +  NLL   +  K   DK+E VVNW  I R+YL IR +     NSD
Sbjct:   86 YPKPNQFNVADGLEKLITYPEAKEKIFNPSK----IMDSIQCQPLNMQIINLQEFPDNIETREVIDPLDYTKIQVKEEPKPLLITPYFTP-------CHENNPNDDFDYFSEHRPFV-------------EKCADEQSVSYNIPDRSSEILLKTDEIPNEYKSEENYFMELCMKNQWVTCEQLLRTFKKESCLTNYKNHETGETPLMFACRENRLVIVERLLDIEVNVNAKSMDGRNALHYAAKYSNYEIVKLLLSKKADANIFENTNKYLPLHLACNRTVVPSGLISNLLKVTRNGRLQKDKNGSIPLMFAVENGLIMTIKELLEKDVDAQINMKRKESGDNALHIACRKNDLESARLLCEAGAAINAQNNLGQTPLHICAEENSELVLKYLYNNKANANILDNKDRGAIYMAAVKGNTKLVEFLIDKYKSNILTRDKDGNTLMHITSMCGFEETTMSFLRRGVPLHMPNKNGSVCLHTAAQQGHINVVRALLEKGANVNARTKDLYTPLHIAVKYGHPGVVEILIGYGAEANCKGGLFDEFPLHIAAVSKSGDNCFEMLLKSGANVNAVMKTGETVLHVVSKMGNLEMVKSLFNEGACPIIQCNEGNSSFHVAVKNCHFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDNDESPLHYCAAAGNSDILTEIVQFYGNEMHNFVNKQTKNGWSPLLFASDNGHHKSVEILLQNDSRVDLFDEYGMTALHLAAEKGHSEVAEILLTNKSFVNAKSKHGLTPLHMAAQNGHKNLVELLIRKYNAAVDLKTLNGKTPLHMAAEQGQIDVCKSLLFDKYCCPDPSASDTKGQTPMHLAAKNDHPEVVKLFLRYKPELLMVNNLEGMNCVHLAASKGSLSVVKEFMRFNKFIIHEVRNKSSGSTPLHLAIEGGHLKVVKTLLDAGANPCDENNEGMTGLHIAAKYGHILLLEYLKSKVNLMFESKKTGMTALHIASHYGQIDFVRELLVEVPAHIKSKLPKSKNN-ESQFTDSGLTALHLASQSGHENLVRLLLNYSGVEVDSATDSNGTIPLHLAVLNGHISVTSLLLSKSATQLTKKDRKGRTALHLVSSHGHLEITVLLIGQGADINDKDNLGFTPLHYAAKSGYLKVCKLLVESGAKCNAQTNDFNVPLIYAAKCNHTEVVSYLLHNNHSTEKLMADNKFLYDIMICSKINNFKTIEEFILLSPAPAEIAAKLSKLFIYLSEKEKERSKDLTVISEYCENMCTDLVALAAYEKGADKLLKSYDRHGVQFLDILIETEQKEVISHPSVHQYMSNVWRGDIKWPIWKFLLLMIFLSFPLSWLTAMLPKTKNLFKLPVIKFIVYLFSHIYLMGLLVYVTI--EKPAERSEVLPNYLEWILLIWLAGLFISELVNPVDRSSIAVLRIFVLVFSCVAILVHVSSCFINESYLPEMIYIRNQILGAATFLCFVVTLDFLSFHHLFGPWTVIIRDLIGDLVRFLVFFIVFLFAFACMLAGTFQSVKQPEPEDVIPDIIDVIILLYFCLFGLVSPEDMPDPNLSPPYGNKLSKFVFGFALLMMIIVLINLLIAMMSDTYQRIQDQSDVEWKYGRAKLIRNMKNTTPIASPFIIISQFIILVTTGLYYKIKRKPITQISDDEKDEIESRLRRRSELNPNLLESSSLFKFGPDKVEEVVNWPDIARKYLEIRGISNIIINSD 1790          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 1873.98 bits (4853), Expect = 0.000e+0
Identity = 982/1732 (56.70%), Postives = 1254/1732 (72.40%), Query Frame = 2
Query:  338 FENPQVLNVNDALKIIETNVEDADIASTLSKSSKAIDDLIDFKPPNLPKMMKPGFSPITFRRAAIDPFQYEKMKEIKEPEPLVIIPELTPYKTAEDLAHKEQNKNKIDEF-ERLPIVITKESXXXXXXXXXXXXXXXEISQXXXXXXXXXXXXXXXXXXXXXXQRAKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYLQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAATTKNGEKCAEMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAKNGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHRNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQTPLHLAAKNDHSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPKISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDGVEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVERGASCEAETNDFQIPLILAAHFNHTEVMSFLLRNKHSTIKLIENDKFLFDLMICSKLNNFKSVEEFILLSPAPAEIAAXXXXXXXXXXXXXXXXXXXXITVSEHCQDMCTDLTALAAVENGADKLLKSVDYYGVQFLDILIETEQKEVISHPLVQRYLSDVWNGDLNWPNWKXXXXXXXXXXPLSWFIILLPVGKKIFTAPLVKFMLYLISHVYLTFLLFYVPLLDAYPCYRQTATVTGMXXXXXXXXXXXXXXXXINPIDRKSIASLKYGILFFGFFAVMVQTLSFMPMPILIPELIYIRNQLLSYATFMCAIVTLDFLSIHHLFGPWTIIIRDLMTDLFKFVVILAIFLLSFACILVAAFQPILSGD-YSNVPGVLSKVVFLYFALFGQATPVDLPDPGLTPGYAVYLARAVFGIALMITIIVLINLLIAMMANTYEEIQAESDTEWKYGRAKLIRNMKKTSPIPSPFNLLTQLII-YSTKIYYRIRKRPLYK---------ENDRKRKFHIFENLLGDIAALKNEEDKLENVVNWNVIVRRYLSIRNVEG---NSD 5488
            +  P   NV D L+ + T  E  +     SK    I D I  +P N+  +    F      R  IDP  Y K++  +EP+PL+I P  TP        H+    +  D F E  P V             +K   ++ +S +  +   E  ++  E  +  + +   FM+LC K +W   E LLR++ KE  L  Y++ ET ETPLM AC++NRL+ V+RLL++ VN N  + DGR ALHYAAK++  ++VKLLL+KKAD N+F  + K LP+HLAC+RT   SG + +LLK T++ RLQ DK G+I LM+A+E G I TIKELL+ + + Q N+K+K SGD A+HIACRK D+E+ RLLC+A A IN +N +GQT LHI AE N E +LKYL +  A+ N+LD+ DR A++MAA KG+TK+VE LIDK+K N+LTRDK+GNTLMH+TS+ G  ETTMS LRRGVPLHMPNK GSVCLH AAQ GH+NVV+ LL+KGANVNARTKDLYTPLHIAVKYG+PGVVE LIGYGA+ N KGG+ DE PLH+AA +K+G+ C EMLLKSGANVN  MK GE+ LH+ S+ GNLEM+KSL  EGA P I C +GNS  H+ V+ CH+ +V+E V F NK  +R D   ++N  N  GET++HFA +L +   HS+ ED DIIK+LLE  GD+KI     +E+PLHYCA AGNSD+L EIV F  +++   VNKQ KNGWSPLLFAS NGHH+ V ILL+N++RVD+FDE+GMTALHLAAEKGH  VA +LL +K+FVNAKSK GLTPLH+AAQNG+K+LVE LI +  A VD  TLN KTPLH+AA+ G+ +VC+SLL+ K    DP A+D++GQTP+HLAAKNDH +VV+LFLR+KPELL+  + +GM C H+AA+ GSL+V+KEFMRFNK +IH ++NKS+GST LHLA EGGH K+VK LLDAGANP +ENN+GMT LH+AAKYGH  LLE LK K++    S K+GMT LH+A+HYGQIDFV E+L +VPA+IKS+ PK+    +   T+SGLT LHLASQSGHENLVRLLLN  GVEV+SAT++NGT PLH A  NGH +VTS+LL KS+ Q+T++D KGRTALH  SSHGH+E+  L IGQGADIN  DN+GFTPLHYAAKSGYLKVCKLLVE GA C A+TNDF +PLI AA  NHTEV+S+LL N HST KL+ ++KFL+D+MICSK+NNFK++EEFILLSPAPAEIAAKLS  F  LS+KEKERSKDL  +SE+C++MCTDL ALAA E GADKLLKS D +GVQFLDILIETEQKEVISHP V +Y+S+VW GD+ WP WK  +  + L FPLSW   +LP  K +F  P++KF++YL SH+YL  LL YV +    P  R       +E +LLI L+GL +SEL+NP+DR SIA L+  +L F   A++V   S       +PE+IYIRNQ+L  ATF+C +VTLDFLS HHLFGPWT+IIRDL+ DL +F+V   +FL +FAC+L   FQ +   +    +P ++  ++ LYF LFG  +P D+PDP L+P Y   L++ VFG AL++ IIVLINLLIAMM++TY+ IQ +SD EWKYGRAKLIRNMK T+PI SPF +++Q II  +T +YY+I+++P+ +         E+  +R+  +  NLL   +  K   DK+E VVNW  I R+YL IR +     NSD
Sbjct:   59 YPKPNQFNVADGLEKLITYPEAKEKIFNPSK----IMDSIQCQPLNMQIINLQEFPDNIETREVIDPLDYTKIQVKEEPKPLLITPYFTP-------CHENNPNDDFDYFSEHRPFV-------------EKCADEQSVSYNIPDRSSEILLKTDEIPNEYKSEENYFMELCMKNQWVTCEQLLRTFKKESCLTNYKNHETGETPLMFACRENRLVIVERLLDIEVNVNAKSMDGRNALHYAAKYSNYEIVKLLLSKKADANIFENTNKYLPLHLACNRTVVPSGLISNLLKVTRNGRLQKDKNGSIPLMFAVENGLIMTIKELLEKDVDAQINMKRKESGDNALHIACRKNDLESARLLCEAGAAINAQNNLGQTPLHICAEENSELVLKYLYNNKANANILDNKDRGAIYMAAVKGNTKLVEFLIDKYKSNILTRDKDGNTLMHITSMCGFEETTMSFLRRGVPLHMPNKNGSVCLHTAAQQGHINVVRALLEKGANVNARTKDLYTPLHIAVKYGHPGVVEILIGYGAEANCKGGLFDEFPLHIAAVSKSGDNCFEMLLKSGANVNAVMKTGETVLHVVSKMGNLEMVKSLFNEGACPIIQCNEGNSSFHVAVKNCHFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDNDESPLHYCAAAGNSDILTEIVQFYGNEMHNFVNKQTKNGWSPLLFASDNGHHKSVEILLQNDSRVDLFDEYGMTALHLAAEKGHSEVAEILLTNKSFVNAKSKHGLTPLHMAAQNGHKNLVELLIRKYNAAVDLKTLNGKTPLHMAAEQGQIDVCKSLLFDKYCCPDPSASDTKGQTPMHLAAKNDHPEVVKLFLRYKPELLMVNNLEGMNCVHLAASKGSLSVVKEFMRFNKFIIHEVRNKSSGSTPLHLAIEGGHLKVVKTLLDAGANPCDENNEGMTGLHIAAKYGHILLLEYLKSKVNLMFESKKTGMTALHIASHYGQIDFVRELLVEVPAHIKSKLPKSKNN-ESQFTDSGLTALHLASQSGHENLVRLLLNYSGVEVDSATDSNGTIPLHLAVLNGHISVTSLLLSKSATQLTKKDRKGRTALHLVSSHGHLEITVLLIGQGADINDKDNLGFTPLHYAAKSGYLKVCKLLVESGAKCNAQTNDFNVPLIYAAKCNHTEVVSYLLHNNHSTEKLMADNKFLYDIMICSKINNFKTIEEFILLSPAPAEIAAKLSKLFIYLSEKEKERSKDLTVISEYCENMCTDLVALAAYEKGADKLLKSYDRHGVQFLDILIETEQKEVISHPSVHQYMSNVWRGDIKWPIWKFLLLMIFLSFPLSWLTAMLPKTKNLFKLPVIKFIVYLFSHIYLMGLLVYVTI--EKPAERSEVLPNYLEWILLIWLAGLFISELVNPVDRSSIAVLRIFVLVFSCVAILVHVSSCFINESYLPEMIYIRNQILGAATFLCFVVTLDFLSFHHLFGPWTVIIRDLIGDLVRFLVFFIVFLFAFACMLAGTFQSVKQPEPEDVIPDIIDVIILLYFCLFGLVSPEDMPDPNLSPPYGNKLSKFVFGFALLMMIIVLINLLIAMMSDTYQRIQDQSDVEWKYGRAKLIRNMKNTTPIASPFIIISQFIILVTTGLYYKIKRKPITQISDDEKDEIESRLRRRSELNPNLLESSSLFKFGPDKVEEVVNWPDIARKYLEIRGISNIIINSD 1763          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK33.433e-9030.99ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK33.597e-9030.83ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK11.667e-8931.29ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK32.892e-8931.32ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK13.334e-8931.29ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-40.000e+040.34TRP (Transient receptor potential) channel family ... [more]
unc-442.502e-7829.69AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.502e-7829.69AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.529e-7829.69AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.529e-7829.69AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nompC0.000e+043.89gene:FBgn0016920 transcript:FBtr0300012[more]
nompC0.000e+043.70gene:FBgn0016920 transcript:FBtr0304843[more]
nompC0.000e+043.44gene:FBgn0016920 transcript:FBtr0343224[more]
nompC0.000e+043.26gene:FBgn0016920 transcript:FBtr0347408[more]
nompC0.000e+042.99gene:FBgn0016920 transcript:FBtr0347409[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01073736.17.432e-2942.21pep chromosome:GRCz11:19:1465004:1479740:1 gene:EN... [more]
ank1b3.669e-10031.39ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.005e-9530.18ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b3.261e-9531.23ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b5.759e-9531.76ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx142.358e-15842.54sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
snx141.752e-13143.89sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
ANK13.541e-9232.30ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK13.561e-9232.08ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK15.323e-9232.30ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank32.594e-8830.44ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.846e-8830.37ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank34.977e-8830.37ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank35.179e-8830.37ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank35.216e-8830.37ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12955|ANK3_HUMAN1.389e-8831.32Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|O70511|ANK3_RAT1.456e-8830.32Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|P16157|ANK1_HUMAN1.939e-8831.29Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|G5E8K5|ANK3_MOUSE4.105e-8730.37Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q505D1|ANR28_MOUSE2.952e-8629.78Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JZM79.890e-2350.50serine/threonine-protein phosphatase 6 regulatory ... [more]
A0A267FPR40.000e+052.52ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1S3H7A82.043e-2250.44serine/threonine-protein phosphatase 6 regulatory ... [more]
A0A267DZS70.000e+052.22ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GWH20.000e+053.63ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048767.10.000e+047.25serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSAMXT00000016978.20.000e+047.02serine/threonine-protein phosphatase 6 regulatory ... [more]
ank1b4.605e-9631.14ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1a1.981e-9431.12ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a3.366e-8531.00ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007334.11.632e-12339.63pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gen... [more]
ENSPMAT00000007332.11.746e-12336.93pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gen... [more]
ENSPMAT00000000095.11.420e-8430.19pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.11.254e-8330.52pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000003991.13.259e-7428.09pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PHO811.048e-1125.67Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
AVO22.006e-1129.24Component of a complex containing the Tor2p kinase... [more]
NAS62.103e-1127.32Evolutionarily conserved 19S regulatory particle a... [more]
HOS41.882e-1028.31Subunit of the Set3 complex; complex is a meiotic-... [more]
GDE19.786e-1025.35Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387026.255e-2425.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299749.454e-2324.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387251.502e-1928.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436904.425e-1830.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494851.923e-1730.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031565.15.316e-9430.66ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1b2.111e-9031.16ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000039458.12.179e-8930.20ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ankrd441.206e-8730.21ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ankrd441.168e-8429.47ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020706.10.000e+097.64SMESG000020706.1[more]
SMESG000020706.10.000e+093.75SMESG000020706.1[more]
SMESG000020706.10.000e+099.73SMESG000020706.1[more]
SMESG000020709.10.000e+056.70SMESG000020709.1[more]
SMESG000020709.10.000e+056.70SMESG000020709.1[more]
back to top