E3 ubiquitin-protein ligase MYLIP

Overview
NameE3 ubiquitin-protein ligase MYLIP
Smed IDSMED30029820
Length (bp)581
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase MYLIP (SMED30029820) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MYLIP (SMED30029820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase MYLIP (SMED30029820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MYLIP (SMED30029820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029820SMESG000074789.1 SmedASXL_015816SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029820SMESG000074789.1 SMESG000054150.1 dd_Smed_v4_2867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029820SMESG000074789.1 SMESG000054150.1 dd_Smed_v4_2867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029820SMESG000074789.1 SMESG000054150.1 dd_Smed_v6_2867_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029820SMESG000074789.1 SMESG000054150.1 DN293934ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30029820SMESG000074789.1 SMESG000054150.1 DN293934ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Category 4 cellSMED30029820SMESG000074789.1 SMESG000054150.1 dd_Smed_v4_2867_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029820SMESG000074789.1 SMESG000054150.1 dd_Smed_v4_2867_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029820SMESG000074789.1 SMESG000054150.1 dd_Smed_v4_2867_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.521 bits (114), Expect = 3.206e-6
Identity = 20/55 (36.36%), Postives = 27/55 (49.09%), Query Frame = 2
Query:  239 RNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            R  Q  +   C IC D  I  V+ CGH  C  CG  +  CP+CR    +  +IF+
Sbjct: 1002 RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV 1056          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.521 bits (114), Expect = 3.211e-6
Identity = 20/55 (36.36%), Postives = 27/55 (49.09%), Query Frame = 2
Query:  239 RNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            R  Q  +   C IC D  I  V+ CGH  C  CG  +  CP+CR    +  +IF+
Sbjct: 1016 RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV 1070          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.1358 bits (113), Expect = 3.582e-6
Identity = 20/55 (36.36%), Postives = 27/55 (49.09%), Query Frame = 2
Query:  239 RNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            R  Q  +   C IC D  I  V+ CGH  C  CG  +  CP+CR    +  +IF+
Sbjct:  915 RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV 969          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.1358 bits (113), Expect = 3.624e-6
Identity = 20/55 (36.36%), Postives = 27/55 (49.09%), Query Frame = 2
Query:  239 RNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            R  Q  +   C IC D  I  V+ CGH  C  CG  +  CP+CR    +  +IF+
Sbjct: 1012 RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV 1066          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 48.1358 bits (113), Expect = 3.763e-6
Identity = 20/55 (36.36%), Postives = 27/55 (49.09%), Query Frame = 2
Query:  239 RNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            R  Q  +   C IC D  I  V+ CGH  C  CG  +  CP+CR    +  +IF+
Sbjct:  865 RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV 919          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 47.3654 bits (111), Expect = 4.321e-6
Identity = 20/55 (36.36%), Postives = 27/55 (49.09%), Query Frame = 2
Query:  239 RNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            R  Q  +   C IC D  I  V+ CGH  C  CG  +  CP+CR    +  +IF+
Sbjct:  867 RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQIFV 921          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. TrEMBL
Match: A0A2V0P5Q7 (RING-type domain-containing protein OS=Raphidocelis subcapitata OX=307507 GN=Rsub_04611 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.304e-6
Identity = 30/96 (31.25%), Postives = 50/96 (52.08%), Query Frame = 2
Query:  116 DLEKHLHNAN-IPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIF 400
            DLE  L  A+ + +DL+  V+RT   +Q                S  ++  +C++C ++  + V+DCGHT C+ CGE +  CP CR + T   ++F
Sbjct:  848 DLEARLDAASRVVRDLV--VERTVAELQ---------------RSSAAESALCTVCMERRKELVFDCGHTLCVECGEALPMCPFCRKDVTARIRLF 926          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. TrEMBL
Match: A0A4D6LBQ4 (Nucleoprotein TPR OS=Vigna unguiculata OX=3917 GN=DEO72_LG3g509 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.838e-6
Identity = 40/136 (29.41%), Postives = 62/136 (45.59%), Query Frame = 2
Query:    5 KVKGTDNAKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHN----ANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIF 400
            KV   ++ + Q  T++   + +  K+    V+    +  E+  H+     N  +DLI    R +  I   K      L D  R  + SD KICS+C   + D  + CGH  C  CG  +  CP+CR + TN  K+F
Sbjct:  410 KVLQEEHKRAQRLTVESGKSHEAAKIAMKEVEAVRQEIQEEREHSQHLKENFRRDLIFAESRAA--IAEEK------LSDLYRKIRTSDYKICSVCLSNDKDLAFGCGHMTCRDCGSKLSRCPICREQITNYIKLF 537          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. TrEMBL
Match: A0A445GWX8 (Nuclear-pore anchor OS=Glycine soja OX=3848 GN=D0Y65_041689 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.744e-6
Identity = 33/122 (27.05%), Postives = 56/122 (45.90%), Query Frame = 2
Query:   35 QSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIF 400
            Q  T++ D + +  K+    V+    +  E+  H   + ++    V  +      ++ +    L D  R  + SD K+CSIC   + D  + CGH  C  CG  +  CP+CR + TN  K+F
Sbjct:  283 QRLTMESDKSREAAKIAMREVEAVRQELQEEREHAQRLKENFHRDVIFSESRATFAEAK----LSDLYRKIRMSDYKVCSICLSNDRDLAFGCGHMTCRDCGSKLSKCPICREQITNHIKLF 400          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. TrEMBL
Match: A0A1S3VXP3 (nuclear-pore anchor OS=Vigna radiata var. radiata OX=3916 GN=LOC106779533 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.499e-6
Identity = 33/132 (25.00%), Postives = 61/132 (46.21%), Query Frame = 2
Query:    5 KVKGTDNAKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIF 400
            KV   ++ + Q  T++     +  K+    V+    +  E+  H+ ++ ++    +        +++    + L D  R  + SD KICS+C   + D  + CGH  C  CG  +  CP+CR + TN  K+F
Sbjct:  235 KVLQEEHRRAQRLTVESGKNHEAAKIAMKEVEAVRQEIKEEREHSQHLKENFRRDLVFAESRAAIAE----EKLTDLYRKIRTSDYKICSVCLSNDKDLAFGCGHMTCRDCGSKLSRCPICREQITNYIKLF 362          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. TrEMBL
Match: K7MCZ6 (Uncharacterized protein OS=Glycine max OX=3847 GN=100811876 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.759e-6
Identity = 33/122 (27.05%), Postives = 56/122 (45.90%), Query Frame = 2
Query:   35 QSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIF 400
            Q  T++ D + +  K+    V+    +  E+  H   + ++    V  +      ++ +    L D  R  + SD K+CSIC   + D  + CGH  C  CG  +  CP+CR + TN  K+F
Sbjct:  415 QRLTMESDKSREAAKIAMREVEAVRQELQEEREHAQRLKENFHRDVIFSESRATFAEAK----LSDLYRKIRMSDYKVCSICLSNDRDLAFGCGHMTCRDCGSKLSKCPICREQITNHIKLF 532          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Planmine SMEST
Match: SMESG000054150.1 (SMESG000054150.1)

HSP 1 Score: 278.87 bits (712), Expect = 2.487e-96
Identity = 132/134 (98.51%), Postives = 132/134 (98.51%), Query Frame = 2
Query:    2 SKVKGTDNAKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            SKV GTD AKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL
Sbjct:   77 SKVSGTDKAKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 210          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Planmine SMEST
Match: SMESG000054150.1 (SMESG000054150.1)

HSP 1 Score: 276.174 bits (705), Expect = 4.762e-96
Identity = 132/134 (98.51%), Postives = 132/134 (98.51%), Query Frame = 2
Query:    2 SKVKGTDNAKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            SKV GTD AKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL
Sbjct:   29 SKVSGTDKAKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 162          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Planmine SMEST
Match: SMESG000074789.1 (SMESG000074789.1)

HSP 1 Score: 128.642 bits (322), Expect = 1.384e-34
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  236 IRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            IRNSQESDIKICSICRD E+DCVY+CGHTFCMTCGETMYCCPVCRSEPTNPRKIFL
Sbjct:  540 IRNSQESDIKICSICRDNEVDCVYNCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 595          

HSP 2 Score: 75.0998 bits (183), Expect = 7.754e-16
Identity = 43/87 (49.43%), Postives = 58/87 (66.67%), Query Frame = 2
Query:   26 AKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRD 286
             K  S+TI+  DA  GP+L + N ++  ADDLEK LHNANI Q L N ++R SENI+LSK EFM++LMD  R  Q +D  +  + +D
Sbjct:  245 TKCHSETIEQVDALDGPRLINRNFKRSFADDLEKKLHNANIRQVLTNKLERNSENIELSKNEFMEILMD--RTFQYTDKLLERLSKD 329          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Planmine SMEST
Match: SMESG000074789.1 (SMESG000074789.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.580e-34
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  236 IRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            IRNSQESDIKICSICRD E+DCVY+CGHTFCMTCGETMYCCPVCRSEPTNPRKIFL
Sbjct:  504 IRNSQESDIKICSICRDNEVDCVYNCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 559          

HSP 2 Score: 75.0998 bits (183), Expect = 7.473e-16
Identity = 43/87 (49.43%), Postives = 58/87 (66.67%), Query Frame = 2
Query:   26 AKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRD 286
             K  S+TI+  DA  GP+L + N ++  ADDLEK LHNANI Q L N ++R SENI+LSK EFM++LMD  R  Q +D  +  + +D
Sbjct:  209 TKCHSETIEQVDALDGPRLINRNFKRSFADDLEKKLHNANIRQVLTNKLERNSENIELSKNEFMEILMD--RTFQYTDKLLERLSKD 293          
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Planmine SMEST
Match: SMESG000074789.1 (SMESG000074789.1)

HSP 1 Score: 128.257 bits (321), Expect = 2.076e-34
Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  236 IRNSQESDIKICSICRDKEIDCVYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 403
            IRNSQESDIKICSICRD E+DCVY+CGHTFCMTCGETMYCCPVCRSEPTNPRKIFL
Sbjct:  587 IRNSQESDIKICSICRDNEVDCVYNCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL 642          

HSP 2 Score: 74.7146 bits (182), Expect = 1.074e-15
Identity = 43/87 (49.43%), Postives = 58/87 (66.67%), Query Frame = 2
Query:   26 AKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIPQDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRD 286
             K  S+TI+  DA  GP+L + N ++  ADDLEK LHNANI Q L N ++R SENI+LSK EFM++LMD  R  Q +D  +  + +D
Sbjct:  292 TKCHSETIEQVDALDGPRLINRNFKRSFADDLEKKLHNANIRQVLTNKLERNSENIELSKNEFMEILMD--RTFQYTDKLLERLSKD 376          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB23.206e-636.36mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.211e-636.36mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.582e-636.36mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.624e-636.36mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.763e-636.36mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mib24.321e-636.36mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2V0P5Q71.304e-631.25RING-type domain-containing protein OS=Raphidoceli... [more]
A0A4D6LBQ41.838e-629.41Nucleoprotein TPR OS=Vigna unguiculata OX=3917 GN=... [more]
A0A445GWX84.744e-627.05Nuclear-pore anchor OS=Glycine soja OX=3848 GN=D0Y... [more]
A0A1S3VXP35.499e-625.00nuclear-pore anchor OS=Vigna radiata var. radiata ... [more]
K7MCZ65.759e-627.05Uncharacterized protein OS=Glycine max OX=3847 GN=... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MYLIP vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054150.12.487e-9698.51SMESG000054150.1[more]
SMESG000054150.14.762e-9698.51SMESG000054150.1[more]
SMESG000074789.11.384e-3494.64SMESG000074789.1[more]
SMESG000074789.11.580e-3494.64SMESG000074789.1[more]
SMESG000074789.12.076e-3494.64SMESG000074789.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029820 ID=SMED30029820|Name=E3 ubiquitin-protein ligase MYLIP|organism=Schmidtea mediterranea sexual|type=transcript|length=581bp
ATCAAAGGTCAAGGGAACAGATAATGCCAAATTACAATCACAAACAATTG
ACCTAGATGATGCACCTCAAGGACCAAAATTGAGAAGTAGTAATGTTCAA
AAATATTCTGCAGATGATCTAGAAAAGCATTTACACAATGCAAACATTCC
CCAAGATTTGATAAATACAGTAAAGAGAACTTCTGAAAATATTCAGTTAT
CCAAAATTGAATTTATGAAAATGTTAATGGATCATATTAGAAATTCACAG
GAATCGGATATAAAAATATGCTCAATATGCAGAGATAAGGAAATTGATTG
CGTGTACGACTGCGGTCACACATTTTGCATGACGTGTGGAGAGACCATGT
ACTGCTGTCCAGTGTGTAGGTCTGAACCGACTAATCCCAGGAAAATTTTT
CTCTGAAATTATCACTAAGTTATTAACAATTTATACATGATTTAATCTTT
TGCCATGTTATTTATAAATTATCAGTAGAGTTGTATTAACTCTCTAGTTC
TCAGGCCCATTTTGAGAACGTTTTTTATTATTCTGATATACAAATATATT
TACAAATACATTTTAGAACTAGTTACCAAAA
back to top

protein sequence of SMED30029820-orf-1

>SMED30029820-orf-1 ID=SMED30029820-orf-1|Name=SMED30029820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
SKVKGTDNAKLQSQTIDLDDAPQGPKLRSSNVQKYSADDLEKHLHNANIP
QDLINTVKRTSENIQLSKIEFMKMLMDHIRNSQESDIKICSICRDKEIDC
VYDCGHTFCMTCGETMYCCPVCRSEPTNPRKIFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 67..134
e-value: 1.5E-10
score: 42.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..19
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 89..128
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 90..123
score: 11.781