slc17a-3

Overview
Nameslc17a-3 (AKN21526.1)
Smed IDSMED30029814
Length (bp)2012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc17a-3 (SMED30029814) t-SNE clustered cells

Violin plots show distribution of expression levels for slc17a-3 (SMED30029814) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc17a-3 (SMED30029814) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc17a-3 (SMED30029814) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029814

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029814SMESG000038128.1 Contig3687GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029814SMESG000066847.1 Contig3687GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30029814SMESG000066847.1 dd_Smed_v4_1874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30029814SMESG000066847.1 dd_Smed_v4_1874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029814SMESG000066847.1 dd_Smed_v4_1874_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30029814SMESG000066847.1 dd_Smed_v4_1874_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
distal tubuleSMED30029814SMESG000066847.1 Smed-slc17a-3smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
proximal tubuleSMED30029814SMESG000066847.1 Smed-slc17a-3smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc17a-3 vs. Ensembl Human
Match: SLC17A5 (solute carrier family 17 member 5 [Source:HGNC Symbol;Acc:HGNC:10933])

HSP 1 Score: 345.125 bits (884), Expect = 4.926e-111
Identity = 215/467 (46.04%), Postives = 301/467 (64.45%), Query Frame = 3
Query:  285 CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVN-NSAIKDLGLNLTPE-CP-NSDSAKVTKD---GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV--NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            C   RY +A+  F GF +VYALRVNLSVA++ MV+ N+ ++D   N T + CP +S   KV  +    ++ WD   QG +LG+FF+GYI  QIP G +A K+GGK   G G+L T++LTL TP+AA LG G LI LR LEG GE +T+PAMH M   WAP +E + +  I Y+G+  G VI L  S  +        W  VFY  G IGI WF++W ++   TP  H RI+  EK +I SS+   LSS++   +VPW  IL SLP+WAI VA+F   W+ YTLLT LP Y + +L F++ +NG+L++LPYL S +  ++SG+ AD +R++   ST   R++F+  GM+  A+F+VA  +IGCD  L V FL I+  LG   S+G+++NH+D+AP YAG+L GITN+ AT+ G++GP +   LT    T   WQ VFYI++AI +FGAIFF +F  G+ Q+WA+    
Sbjct:   35 CCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLED---NRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIIC---YYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQK---SVPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTP-DNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDHH 491          
BLAST of slc17a-3 vs. Ensembl Human
Match: SLC17A6 (solute carrier family 17 member 6 [Source:HGNC Symbol;Acc:HGNC:16703])

HSP 1 Score: 326.25 bits (835), Expect = 1.295e-102
Identity = 189/460 (41.09%), Postives = 280/460 (60.87%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKD-GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            F +P RY+IA+   LGF + + +R NL VAI+ MVNNS I   G             KV K+  +F WD    G++ G+FFWGYI  QIP G IA ++     FG  +L TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG VI +  +  L++     GW SVFY+ G  G+VW++ W  V++ +PA HP IT  E+R+IE S+    NL         PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+L+  I+  + G+IAD +RS++ LSTT  RK+ N  G  + A  ++ + Y    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ +R+ WQ VF I++ +   G IF+ IF SG++Q WA
Sbjct:   65 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGG-------------KVIKEKAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT---GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGY-SHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNK-SREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWA 506          
BLAST of slc17a-3 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 324.709 bits (831), Expect = 2.956e-102
Identity = 188/469 (40.09%), Postives = 283/469 (60.34%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS----NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIED 1676
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS     G              V +  +F WD    GL+ G+FFWGYI  QIP G I  K      FG  ++ TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG V+ +  +  L++ +   GW SVFY+ G  GI W++ W  V++ +PA HP I+  E+++IE ++  S++  +     + PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G+IAD +RSR+ +STT  RKL N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ +F SG++Q WA E  E+  E 
Sbjct:   57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGG------------HVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYS---GWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGY-SHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHK-TREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEEMSEEK 507          
BLAST of slc17a-3 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 325.094 bits (832), Expect = 3.910e-102
Identity = 200/508 (39.37%), Postives = 297/508 (58.46%), Query Frame = 3
Query:  216 SNENYDNLDENSE-------SPKEKWYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA----IEKSEIEIEDQN 1682
            + E  DN++ N E        P     +  C  +P RY+IA+   LGF + + +R NL VAI+ MVNNS +   G    PE          +  +F WD    GL+ G+FFWGYI  QIP G I+ K      FG  +  TS L +  P AAR+ YG ++ +RIL+G  E +TYPA H M   WAP +E + +    + GS+AG V+ +  +  L++     GW SVFYI G+ GI+W++ W   A+  PA HP I+  EK +IE+S+    N+ S  + S  PWK    SLPV+AI VANFC  W+ Y LL S P YFE V GF+I++ G L+A+P+++  IV  + G++AD +RSR+ L+TT  RK+ N   FGM    + +V  S+    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I++ +   G IF+ +F SG++Q WA    + + +  I DQ+
Sbjct:   39 TTEEEDNIELNEEGRPVQTSRPSPPLCDCHCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDG---KPE---------IQTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQ---YIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFST-PWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHT---KGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHK-TREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQD 526          
BLAST of slc17a-3 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 312.768 bits (800), Expect = 1.439e-98
Identity = 182/455 (40.00%), Postives = 274/455 (60.22%), Query Frame = 3
Query:  324 LGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS----NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIED 1676
            LGF + + +R NL VAI++MVNNS     G              V +  +F WD    GL+ G+FFWGYI  QIP G I  K      FG  ++ TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG V+ +  +  L++ +   GW SVFY+ G  GI W++ W  V++ +PA HP I+  E+++IE ++  S++  +     + PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G+IAD +RSR+ +STT  RKL N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ +F SG++Q WA E  E+  E 
Sbjct:    4 LGFCISFGIRCNLGVAIVSMVNNSTTHRGG------------HVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYS---GWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGY-SHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHK-TREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEEMSEEK 440          
BLAST of slc17a-3 vs. Ensembl Celegans
Match: slc-17.2 (Uncharacterized transporter slc-17.2 [Source:UniProtKB/Swiss-Prot;Acc:Q03567])

HSP 1 Score: 263.848 bits (673), Expect = 2.208e-80
Identity = 178/470 (37.87%), Postives = 267/470 (56.81%), Query Frame = 3
Query:  279 RFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPEC-----PNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNV---PWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDK-VLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            R    TR+ +++  F G  V Y +R N+S A++ MVN +   D G+     C     P   ++ V   GEF WD+   G+VL +FF+GYI  QI  G +A + GGK    + +L ++LLTLL PVAAR     L  LR   G  +  T+PAMHTM   W P +E + + G+ Y+G+  G VI L  S  L E    GGWPS+FYI G+ G++W  +W +V+   PA HPRIT  EK++I ++V  S  +    V   PW  IL S  VWA    +F   W  YT+L SLP + + VLG +++  G + ++PY+   +     G +AD +RS+  LST  TR+      ++   IF+VA  Y GC + VLV+ F+   +A+     AG+ VN++++AP ++G + G  N+I+ +AGII P+V   LT +  T++ WQ+V ++++ I   GA+ F IF SG+ Q WA   +E
Sbjct:    9 RLVPSTRFALSLVMFFGCLVTYMMRTNMSFAVVCMVNENK-TDTGVEKVSRCGKEMTPVESNSSVI--GEFDWDKQTTGMVLSSFFYGYIGSQIIGGHLASRYGGKRVVFVTILGSALLTLLNPVAARTSEYALAILRAAIGFLQGATFPAMHTMWSVWGPPLELSVLTGVTYAGAQIGNVIVLPLSGFLCEYGFDGGWPSIFYIIGVFGVLWTAVWWYVSSDKPATHPRITPEEKQYIVTAVEASMGKDTGKVPSTPWIKILTSPAVWACWAGHFAGDWGAYTMLVSLPSFLKDVLGLNLSSLGAVASIPYIAYFLAINAGGVLADTLRSKGILSTLNTRRAAMLVALIGQGIFLVASGYCGCGQDVLVIIFITCGMAISGLQYAGFVVNYLEIAPPFSGTVMGTGNTISALAGIISPAVSSYLTPNG-TQEEWQMVLWLTAGILTIGALLFSIFASGEVQPWAKLTAE 474          
BLAST of slc17a-3 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 256.144 bits (653), Expect = 1.395e-77
Identity = 170/483 (35.20%), Postives = 256/483 (53.00%), Query Frame = 3
Query:  210 YTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
            Y ++E  D+ DE  ES + K         R+V+A+   LGFA +YA+R NLS+AI+ M + +  K           N  +  V  D E  W    QG+VL +FF+GYI  Q+P G +A   G K  F  G   T++ TLLTP  AR+GYG L+  R +EG  E +TYPAMH +   WAP ME T +    +SGS+ G V+ +  SA L E     GWP +F+  G +G++W ++W       P + P+I+ +E   ++     +  + H  VPW  IL S PVWA+ VA+       Y +LT+LP   + + G+++ + G  ++LPY L     +  G++ D +R  K   T   RK+    G +  ++F+  +     + +L+V F  I++ LG     G++VNH+DLAPQYAG L   +N+ AT+ GI GP +VG +  +  T   W ++ YI  +  L GA  F  F     Q WA E +
Sbjct:   13 YGTSETIDD-DEALESKRWK--------RRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERKV----------NGTTLHVLGDFE-NWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHF---GWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRD---AVSQNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLV-MTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNG-TIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAEHT 467          
BLAST of slc17a-3 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 253.447 bits (646), Expect = 1.393e-76
Identity = 170/494 (34.41%), Postives = 258/494 (52.23%), Query Frame = 3
Query:  198 RINYYTSNENYDNLDE-------NSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
            RI     NE   N ++       + E+ + K + R     R+V+A+   LGFA +YA+R NLS+AI+ M + +  K           N  +  V  D E  W    QG+VL +FF+GYI  Q+P G +A   G K  F  G   T++ TLLTP  AR+GYG L+  R +EG  E +TYPAMH +   WAP ME T +    +SGS+ G V+ +  SA L E     GWP +F+  G +G++W ++W       P + P+I+ +E   ++     +  + H  VPW  IL S PVWA+ VA+       Y +LT+LP   + + G+++ + G  ++LPY L     +  G++ D +R  K   T   RK+    G +  ++F+  +     + +L+V F  I++ LG     G++VNH+DLAPQYAG L   +N+ AT+ GI GP +VG +  +  T   W ++ YI  +  L GA  F  F     Q WA E +
Sbjct:    3 RILSQNENECSKNDEDVNIRRAIDDEALESKRWKR-----RHVVAILALLGFANIYAMRANLSIAIVEMTSGTERK----------VNGTTLHVLGDFE-NWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHF---GWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRD---AVSQNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLV-MTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNG-TIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAEHT 472          
BLAST of slc17a-3 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 239.965 bits (611), Expect = 1.195e-70
Identity = 161/478 (33.68%), Postives = 254/478 (53.14%), Query Frame = 3
Query:  219 NENYDNLDENS--ESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIG-LRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS--NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQ 1637
            NEN   +  N   +  ++ W  +     R+++A+   +GF + + +R N   A   M  N                +D        EF W  +   ++  ++F+GY+  QIPAG +A K      FG G+   + L +L P   ++   +L+  ++I +G  + + YPAMH +  YWAP ME + +    ++GS+AG V+GL  SA L+       W + FY+ G+ G++W I+W  V F  PA HP I+  EK FIE ++   S    +  ++PWK+I+ S PVWAI VANF   W+ Y LL +   Y +  LG  IA +G L A+P+L+   V ++ G++AD +RS K LSTT  RK+FN  G    A F++ ++Y   D   ++  L  AV +     +G+NVNH+D+AP+YA +L G +N I T+AG+  P V    T H  ++  W  VF ++S I   G  F+ ++ SG+ Q
Sbjct:   22 NENPMQMHSNKVLQVMEQTWIGK--CRKRWLLAILANMGFMISFGIRCNFGAAKTHMYKNY---------------TDPYGKVHMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYV---SWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMA-LIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAH--SKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 476          
BLAST of slc17a-3 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 239.58 bits (610), Expect = 2.481e-70
Identity = 161/478 (33.68%), Postives = 254/478 (53.14%), Query Frame = 3
Query:  219 NENYDNLDENS--ESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIG-LRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS--NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQ 1637
            NEN   +  N   +  ++ W  +     R+++A+   +GF + + +R N   A   M  N                +D        EF W  +   ++  ++F+GY+  QIPAG +A K      FG G+   + L +L P   ++   +L+  ++I +G  + + YPAMH +  YWAP ME + +    ++GS+AG V+GL  SA L+       W + FY+ G+ G++W I+W  V F  PA HP I+  EK FIE ++   S    +  ++PWK+I+ S PVWAI VANF   W+ Y LL +   Y +  LG  IA +G L A+P+L+   V ++ G++AD +RS K LSTT  RK+FN  G    A F++ ++Y   D   ++  L  AV +     +G+NVNH+D+AP+YA +L G +N I T+AG+  P V    T H  ++  W  VF ++S I   G  F+ ++ SG+ Q
Sbjct:   43 NENPMQMHSNKVLQVMEQTWIGK--CRKRWLLAILANMGFMISFGIRCNFGAAKTHMYKNY---------------TDPYGKVHMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYV---SWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMA-LIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAH--SKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 497          
BLAST of slc17a-3 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0339677)

HSP 1 Score: 342.428 bits (877), Expect = 1.826e-109
Identity = 202/487 (41.48%), Postives = 292/487 (59.96%), Query Frame = 3
Query:  276 NRFCIP-TRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNL--TPECP------NSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSS---------------------EERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            N  C P TR++    GFLGFAVVYA+RVNLSVAI+AMVN +AI     ++  T  CP      N       K+GEFVWD+  QGLVLG+FF+GY+  Q+P G +A   GGK  +G GVL T++ TL+TP+AA      L+ +RILEG GE +TYPAMH ML +W P +E      IVY+GS  G VI +  +  L   + +GGWPS FYI G++GI+WFI W ++ +  P++HPRI+ +E+ +IE S+ +                             +PW S+L S+P+WAI +      W+ YT LT LP Y  ++L F I  N  LNA+PYL S  V +    +AD + +R+++S   + KL+NT   ++ ++ ++ I Y+GCD V V   L    + G    AG  +NHI L+P+YAG +YGITNS A + G + P V+G++ NH+ET  +W +VF++++ + + G   +LIF S + QSW+
Sbjct:   60 NHGCGPKTRHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVGSFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-3 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0073724)

HSP 1 Score: 342.428 bits (877), Expect = 1.826e-109
Identity = 202/487 (41.48%), Postives = 292/487 (59.96%), Query Frame = 3
Query:  276 NRFCIP-TRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNL--TPECP------NSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSS---------------------EERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            N  C P TR++    GFLGFAVVYA+RVNLSVAI+AMVN +AI     ++  T  CP      N       K+GEFVWD+  QGLVLG+FF+GY+  Q+P G +A   GGK  +G GVL T++ TL+TP+AA      L+ +RILEG GE +TYPAMH ML +W P +E      IVY+GS  G VI +  +  L   + +GGWPS FYI G++GI+WFI W ++ +  P++HPRI+ +E+ +IE S+ +                             +PW S+L S+P+WAI +      W+ YT LT LP Y  ++L F I  N  LNA+PYL S  V +    +AD + +R+++S   + KL+NT   ++ ++ ++ I Y+GCD V V   L    + G    AG  +NHI L+P+YAG +YGITNS A + G + P V+G++ NH+ET  +W +VF++++ + + G   +LIF S + QSW+
Sbjct:   60 NHGCGPKTRHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVGSFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-3 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0339678)

HSP 1 Score: 342.428 bits (877), Expect = 1.826e-109
Identity = 202/487 (41.48%), Postives = 292/487 (59.96%), Query Frame = 3
Query:  276 NRFCIP-TRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNL--TPECP------NSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSS---------------------EERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            N  C P TR++    GFLGFAVVYA+RVNLSVAI+AMVN +AI     ++  T  CP      N       K+GEFVWD+  QGLVLG+FF+GY+  Q+P G +A   GGK  +G GVL T++ TL+TP+AA      L+ +RILEG GE +TYPAMH ML +W P +E      IVY+GS  G VI +  +  L   + +GGWPS FYI G++GI+WFI W ++ +  P++HPRI+ +E+ +IE S+ +                             +PW S+L S+P+WAI +      W+ YT LT LP Y  ++L F I  N  LNA+PYL S  V +    +AD + +R+++S   + KL+NT   ++ ++ ++ I Y+GCD V V   L    + G    AG  +NHI L+P+YAG +YGITNS A + G + P V+G++ NH+ET  +W +VF++++ + + G   +LIF S + QSW+
Sbjct:   60 NHGCGPKTRHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVGSFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-3 vs. Ensembl Fly
Match: Picot (gene:FBgn0024315 transcript:FBtr0087115)

HSP 1 Score: 296.975 bits (759), Expect = 1.989e-92
Identity = 186/478 (38.91%), Postives = 267/478 (55.86%), Query Frame = 3
Query:  225 NYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKD-LGLNLTPECPNSD-SAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGW-LIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNH--QETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSW 1643
            N  NL E+ E   ++     C  TRY +    FLG A  Y +R N+SVAI+AMVN++AIK         EC + D     ++DGEF W   +QG +L +FF+GY+  QIP G +A K G   F G G+L  S+   L PVAAR G  W L  +R ++G GE    P  H ML  W P  E + +G  VY+G+  G +I +  S  L E    GGWPS+FY+ GI+G VW I +       P++HP I   EK++I  S+  +   +   +P+K+I+ SLP +AI  A+    +   TL+T LP Y + VL FS+  NG L++LPYL   +  +    +AD + S K  S T TRKL N+ G     + ++A SY GCD+ L +  L I V L     +G+ +NH+DL P++AG L  ITN  A +AG++ P   G L +   +    +WQIVF+I++ + +    F+ IFGSG+RQ W
Sbjct:   21 NQRNLHESLEQQPQR-----CFATRYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYW 493          
BLAST of slc17a-3 vs. Ensembl Fly
Match: Picot (gene:FBgn0024315 transcript:FBtr0340067)

HSP 1 Score: 292.738 bits (748), Expect = 6.339e-91
Identity = 181/458 (39.52%), Postives = 259/458 (56.55%), Query Frame = 3
Query:  285 CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKD-LGLNLTPECPNSD-SAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGW-LIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNH--QETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSW 1643
            C  TRY +    FLG A  Y +R N+SVAI+AMVN++AIK         EC + D     ++DGEF W   +QG +L +FF+GY+  QIP G +A K G   F G G+L  S+   L PVAAR G  W L  +R ++G GE    P  H ML  W P  E + +G  VY+G+  G +I +  S  L E    GGWPS+FY+ GI+G VW I +       P++HP I   EK++I  S+  +   +   +P+K+I+ SLP +AI  A+    +   TL+T LP Y + VL FS+  NG L++LPYL   +  +    +AD + S K  S T TRKL N+ G     + ++A SY GCD+ L +  L I V L     +G+ +NH+DL P++AG L  ITN  A +AG++ P   G L +   +    +WQIVF+I++ + +    F+ IFGSG+RQ W
Sbjct:   23 CFATRYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYW 480          
BLAST of slc17a-3 vs. Ensembl Zebrafish
Match: slc17a5 (solute carrier family 17 member 5 [Source:ZFIN;Acc:ZDB-GENE-060929-1158])

HSP 1 Score: 352.058 bits (902), Expect = 5.583e-114
Identity = 211/465 (45.38%), Postives = 291/465 (62.58%), Query Frame = 3
Query:  285 CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPE----CPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIE 1667
            C  +RY +A     GF V YALRVNLSVA++ M+ NS+  +   ++ P      P  +   +  D    W+   QG +LG+FF+GYI  QIP G +A K G KW  G+G+L T + TLLTP+AA LG G+LI +R+LEG GE +TYPAMH M   WAP +E + +  I Y+G+  G V+ L  S Q+        W  VFYI G +G++WF +W     ++P++H RIT  EK +I SS+          +PW SI  S+P+WAI VA+F   W+ YTLLT LP Y   VLGFSI QNG L+ALPYL   ++ ++ G++AD++R R    T + RK F   GM   A+F+VA  Y GC+ +L V FL I+ +LG  +++G+N+NH+D+AP YAG+L GITNS AT+ G++GP +   LT    T   WQIVFYIS+AI +FGA+FF IFG G  Q WA++   I+
Sbjct:   33 CGSSRYGLAFLSCYGFFVAYALRVNLSVAMVDMLKNSSKANTSSSICPPHNIPVPKHNHTAMVYD----WNSETQGWILGSFFYGYIITQIPGGYLARKYGAKWLLGLGILCTVIFTLLTPLAADLGAGYLIAVRVLEGIGEGVTYPAMHAMWASWAPPLERSRLLTISYTGAQLGTVVALPLSGQIC---FYLDWTYVFYIFGAVGLLWFFLWICFVSNSPSSHKRITEAEKTYIMSSLKNELSPTQDYIPWTSIFKSMPLWAIVVAHFSYNWTFYTLLTLLPTYMNDVLGFSIQQNGMLSALPYLGCWLLALLGGQLADLLRERFLFRTVIVRKAFTVVGMAGPAVFLVAAGYTGCNYILAVAFLTISSSLGGISASGFNINHLDIAPSYAGILLGITNSFATIPGMVGPVIARSLTK-SNTIPEWQIVFYISAAINIFGAVFFTIFGKGTVQPWAVQTIHIQ 489          
BLAST of slc17a-3 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 330.102 bits (845), Expect = 2.801e-104
Identity = 204/517 (39.46%), Postives = 299/517 (57.83%), Query Frame = 3
Query:  165 DKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA------IEKSEIEIEDQ 1679
            D SN+    N+ +      E+   +     SP       F +P RY+IA+   LGF + + +R NL VAI+ MVNN+ +   G              V +  +F WD    GL+ G+FFWGYI  QIP G I+ K+     FG  +  TS+L +  P AAR+ YG ++ +RIL+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ GI+W+I W  +A+++PA HP I+  E+ +IE+S+    NL S       PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  I+  + G++AD +RSRK LSTT  RK+ N   FGM    + +V  S+    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG LT H+ TR  WQ VF I+S +   G IF+ IF SG++Q WA       EK  I  ED+
Sbjct:   36 DGSNVTEEDNIELT-----EDGRPVAAPKRSPPLLDCGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYING------------TAVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQ---YVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHT---RAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHK-TRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCGIIGEDE 528          
BLAST of slc17a-3 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 329.331 bits (843), Expect = 6.839e-104
Identity = 204/517 (39.46%), Postives = 299/517 (57.83%), Query Frame = 3
Query:  165 DKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA------IEKSEIEIEDQ 1679
            D SN+    N+ +      E+   +     SP       F +P RY+IA+   LGF + + +R NL VAI+ MVNN+ +   G              V +  +F WD    GL+ G+FFWGYI  QIP G I+ K+     FG  +  TS+L +  P AAR+ YG ++ +RIL+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ GI+W+I W  +A+++PA HP I+  E+ +IE+S+    NL S       PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  I+  + G++AD +RSRK LSTT  RK+ N   FGM    + +V  S+    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG LT H+ TR  WQ VF I+S +   G IF+ IF SG++Q WA       EK  I  ED+
Sbjct:   36 DGSNVNEEDNIELT-----EDGRPVAAPKRSPPLLDCGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYING------------TAVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQ---YVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHT---RAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHK-TRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCGIIGEDE 528          
BLAST of slc17a-3 vs. Ensembl Zebrafish
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 321.242 bits (822), Expect = 6.687e-101
Identity = 190/461 (41.21%), Postives = 277/461 (60.09%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSE----ERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS I   G  +           + +  +F WD    GL+ G+FFWGYI  QIP G I+ ++     FG  +L TS L +  P AAR  YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG VI +  +  L++     GW SVFY+ G  GI W++ W  V++ +PA HP IT  E+ +IE S+  S++          PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+ALP+L+  I+  + G++AD +RS+  LSTT  RK+ N   FGM    + IV  S+    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ IF SG++Q WA
Sbjct:   64 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHLNGKII-----------IKEKAKFNWDPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARGHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT---GWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAEERCYIEESIGESAKLLGPADKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQLADHLRSKNILSTTTVRKIMNCGGFGMEATLLLIVGYSH---SKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHK-TREEWQYVFLIASLVHYGGVIFYGIFASGEKQPWA 506          
BLAST of slc17a-3 vs. Ensembl Zebrafish
Match: slc17a6a (solute carrier family 17 member 6a [Source:NCBI gene;Acc:494492])

HSP 1 Score: 318.161 bits (814), Expect = 1.095e-99
Identity = 187/462 (40.48%), Postives = 282/462 (61.04%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSE-----ERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            F +P RY+IA+   LGF + + +R NL VAI+ MVNNS I   G  +  E             +F WD    G++ G+FFWGYI  QIP G I+ ++     FG  +L TS L +  P AAR+ YG ++ +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG V+ +  +  L++ +   GW SVFYI G  GIVW++ W  V++ +PA+HP IT  E+ +IE S+  S++     E++   PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G++AD +RS+  L+TT  RK+ N   FGM    + +V  S+    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I+S +   G IF+ IF SG++Q WA
Sbjct:   65 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHKGGKIIIKE-----------KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGILVQYS---GWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERTYIEESIGESAKLLGAMEKY-KTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGFSH---SKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNK-TREEWQNVFLIASLVHYGGVIFYGIFASGEKQPWA 507          
BLAST of slc17a-3 vs. Ensembl Xenopus
Match: SLC17A8 (solute carrier family 17 (vesicular glutamate transporter), member 8 [Source:NCBI gene;Acc:100489470])

HSP 1 Score: 330.872 bits (847), Expect = 7.826e-105
Identity = 197/499 (39.48%), Postives = 297/499 (59.52%), Query Frame = 3
Query:  195 LRINYYTSNENYDNLDENS---ESPKEK--WYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
            L+I+     E+   LDE+    ++P +    ++ +C  IP RY+IA+   LGF + + +R NL VAI+ MVNN+ +              D     +  +F WD    GL+ G+FFWGYI  QIP G IA K+     FG  +  TS+L +L P AAR+ +G +I +R+L+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ G+ W++ W   A  +PA HP IT  E+ +IE+S+    NL +  +    PWK    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  I+  V G++AD +RSRK LSTT  RK+ N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I++ +   G IF+ IF SG++Q WA  +S
Sbjct:    2 LKIDGRNIEEDNIELDEDGRPVQAPTQPPPRFDCYCCGIPKRYIIAMMSGLGFCISFGIRCNLGVAIVEMVNNNTVY------------VDGKPEMQKAQFNWDPETVGLIHGSFFWGYIITQIPGGFIANKLAANRVFGAAIFLTSILNMLIPSAARVHFGCVISVRVLQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQ---YIGWPSVFYIYGVFGMCWYVFWLLHATESPAAHPSITFEERTYIETSIGEGSNLVTTGKF-KTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIIVPVGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGY-SHTKAISISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNK-TREEWQNVFLIAAIVHYSGVIFYGIFASGEKQEWADPES 482          
BLAST of slc17a-3 vs. Ensembl Xenopus
Match: SLC17A8 (solute carrier family 17 (vesicular glutamate transporter), member 8 [Source:NCBI gene;Acc:100489470])

HSP 1 Score: 330.487 bits (846), Expect = 9.276e-105
Identity = 197/490 (40.20%), Postives = 294/490 (60.00%), Query Frame = 3
Query:  228 YDN--LDENS---ESPKEK--WYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
            YDN  LDE+    ++P +    ++ +C  IP RY+IA+   LGF + + +R NL VAI+ MVNN+ +              D     +  +F WD    GL+ G+FFWGYI  QIP G IA K+     FG  +  TS+L +L P AAR+ +G +I +R+L+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ G+ W++ W   A  +PA HP IT  E+ +IE+S+    NL +  +    PWK    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  I+  V G++AD +RSRK LSTT  RK+ N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I++ +   G IF+ IF SG++Q WA  +S
Sbjct:    2 YDNIELDEDGRPVQAPTQPPPRFDCYCCGIPKRYIIAMMSGLGFCISFGIRCNLGVAIVEMVNNNTVY------------VDGKPEMQKAQFNWDPETVGLIHGSFFWGYIITQIPGGFIANKLAANRVFGAAIFLTSILNMLIPSAARVHFGCVISVRVLQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQ---YIGWPSVFYIYGVFGMCWYVFWLLHATESPAAHPSITFEERTYIETSIGEGSNLVTTGKF-KTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIIVPVGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGY-SHTKAISISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNK-TREEWQNVFLIAAIVHYSGVIFYGIFASGEKQEWADPES 473          
BLAST of slc17a-3 vs. Ensembl Xenopus
Match: SLC17A8 (solute carrier family 17 (vesicular glutamate transporter), member 8 [Source:NCBI gene;Acc:100489470])

HSP 1 Score: 330.102 bits (845), Expect = 1.342e-104
Identity = 197/501 (39.32%), Postives = 297/501 (59.28%), Query Frame = 3
Query:  198 RINYYTSNENYDNLDENS---ESPKEK--WYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIE 1667
            +I+     E+   LDE+    ++P +    ++ +C  IP RY+IA+   LGF + + +R NL VAI+ MVNN+ +              D     +  +F WD    GL+ G+FFWGYI  QIP G IA K+     FG  +  TS+L +L P AAR+ +G +I +R+L+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ G+ W++ W   A  +PA HP IT  E+ +IE+S+    NL +  +    PWK    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  I+  V G++AD +RSRK LSTT  RK+ N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I++ +   G IF+ IF SG++Q WA  +S  E
Sbjct:   10 KIDGRNIEEDNIELDEDGRPVQAPTQPPPRFDCYCCGIPKRYIIAMMSGLGFCISFGIRCNLGVAIVEMVNNNTVY------------VDGKPEMQKAQFNWDPETVGLIHGSFFWGYIITQIPGGFIANKLAANRVFGAAIFLTSILNMLIPSAARVHFGCVISVRVLQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQ---YIGWPSVFYIYGVFGMCWYVFWLLHATESPAAHPSITFEERTYIETSIGEGSNLVTTGKF-KTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIIVPVGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGY-SHTKAISISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNK-TREEWQNVFLIAAIVHYSGVIFYGIFASGEKQEWADPESLSE 492          
BLAST of slc17a-3 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 330.872 bits (847), Expect = 1.761e-104
Identity = 198/509 (38.90%), Postives = 296/509 (58.15%), Query Frame = 3
Query:  141 IKRNNSMTDKS--NLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKD-GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            IKRN  ++ K   N L   N         E+   ++   + P       F +P RY+IA+   LGF + + +R NL VAI+ MVNNS I   G             K+ K+  +F WD  I G++ G+FFWGYI  QIP G IA ++     FG  ++ TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG VI +  +  L++     GW SVFY+ G  G+VW++ W  V++ +PA HP IT  E+ +IE S+    N+         PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+L+  I+  + G+IAD +RS++ LSTT  RK+ N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ +R+ WQ VF I++ +   G IF+ IF SG++Q WA
Sbjct:   13 IKRNKEISPKYHWNFLEKKNKTGENIELTEDGKPVEVAEKKPPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHHGG-------------KIIKEKAKFNWDPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT---GWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGY-SHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHK-SREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWA 503          
BLAST of slc17a-3 vs. Ensembl Xenopus
Match: SLC17A8 (solute carrier family 17 (vesicular glutamate transporter), member 8 [Source:NCBI gene;Acc:100489470])

HSP 1 Score: 330.102 bits (845), Expect = 4.202e-104
Identity = 204/516 (39.53%), Postives = 305/516 (59.11%), Query Frame = 3
Query:  150 NNSMTDKSNLLNVSNLRINYYTSNENYDN--LDENS---ESPKEK--WYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
             NS+ D     ++ NL+      N   DN  LDE+    ++P +    ++ +C  IP RY+IA+   LGF + + +R NL VAI+ MVNN+ +   G    PE          +  +F WD    GL+ G+FFWGYI  QIP G IA K+     FG  +  TS+L +L P AAR+ +G +I +R+L+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ G+ W++ W   A  +PA HP IT  E+ +IE+S+    NL +  +    PWK    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  I+  V G++AD +RSRK LSTT  RK+ N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I++ +   G IF+ IF SG++Q WA  +S
Sbjct:   22 KNSIGD-----SLGNLQRKIDGRNIEEDNIELDEDGRPVQAPTQPPPRFDCYCCGIPKRYIIAMMSGLGFCISFGIRCNLGVAIVEMVNNNTVYVDG---KPE---------MQKAQFNWDPETVGLIHGSFFWGYIITQIPGGFIANKLAANRVFGAAIFLTSILNMLIPSAARVHFGCVISVRVLQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQ---YIGWPSVFYIYGVFGMCWYVFWLLHATESPAAHPSITFEERTYIETSIGEGSNLVTTGKF-KTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIIVPVGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGY-SHTKAISISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNK-TREEWQNVFLIAAIVHYSGVIFYGIFASGEKQEWADPES 514          
BLAST of slc17a-3 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 328.561 bits (841), Expect = 2.073e-103
Identity = 198/487 (40.66%), Postives = 293/487 (60.16%), Query Frame = 3
Query:  258 PKEKWYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA----IEKSEIEIEDQN 1682
            PK    +  C  IP RY+IAV   LGF + + +R NL VAI+ MVNNS +    ++  PE          +  +F WD    GL+ G+FFWGYI  QIP G I+ K      FG  +  TS L +  P AAR+ YG ++G+RIL+G  E +TYPA H M   WAP +E + +    + GS+AG V+ +  +  L++     GW SVFYI G+ GI+W++ W   A+  PA HP I+  E+ +IE+S+    NL+S  +  N PW+    SLPV+AI VANFC  W+ Y LL S P YFE V GF+I++ G L+A+P+++  IV  + G++AD +RSRK L+TT  RK+ N   FGM    + +V  S+    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I++ +   G IF+ +F SG++Q WA    + + +  I DQ+
Sbjct:   73 PKRYICDCSCCGIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVY---VDGKPE---------IQTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIPSAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYI---GWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKF-NTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHT---KGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHK-TREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEDKCGIIDQD 539          
BLAST of slc17a-3 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 325.479 bits (833), Expect = 8.762e-103
Identity = 189/469 (40.30%), Postives = 282/469 (60.13%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS----NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIED 1676
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS     G              V +  +F WD    GL+ G+FFWGYI  QIP G I  K      FG  ++ TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG V+ +  +  L++ +   GW SVFY+ G  GI W++ W  V++ +PA HP I+  E+++IE ++  S++  +     N PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G+IAD +RSR  +STT  RKL N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ +F SG++Q WA E  E+  E 
Sbjct:   57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGG------------HVVVQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYS---GWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGY-SHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHK-TREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEEMSEEK 507          
BLAST of slc17a-3 vs. Ensembl Mouse
Match: Slc17a6 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [Source:MGI Symbol;Acc:MGI:2156052])

HSP 1 Score: 325.865 bits (834), Expect = 1.304e-102
Identity = 188/460 (40.87%), Postives = 280/460 (60.87%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKD-GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            F +P RY+IA+   LGF + + +R NL VAI+ MVNNS I   G             KV K+  +F WD    G++ G+FFWGYI  QIP G IA ++     FG  +L TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG VI +  +  L++     GW SVFY+ G  G+VW++ W  V++ +PA HP IT  E+R+IE S+    NL         PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+L+  I+  + G+IAD +RS++ LSTT  RK+ N  G  + A  ++ + Y    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ +R+ WQ VF I++ +   G IF+ +F SG++Q WA
Sbjct:   65 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGG-------------KVIKEKAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT---GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGY-SHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNK-SREEWQYVFLIAALVHYGGVIFYALFASGEKQPWA 506          
BLAST of slc17a-3 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 324.709 bits (831), Expect = 4.049e-102
Identity = 191/483 (39.54%), Postives = 287/483 (59.42%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKV--------------TKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS----NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIED 1676
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS     G ++  + P     K               T+  +F WD    GL+ G+FFWGYI  QIP G I  K      FG  ++ TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG V+ +  +  L++ +   GW SVFY+ G  GI W++ W  V++ +PA HP I+  E+++IE ++  S++  +     N PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G+IAD +RSR  +STT  RKL N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ +F SG++Q WA E  E+  E 
Sbjct:   57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGG-HVVVQTPYRSVHKQEAVTPTLGDIQGGDTEKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYS---GWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGY-SHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHK-TREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEEMSEEK 532          
BLAST of slc17a-3 vs. Ensembl Mouse
Match: Slc17a5 (solute carrier family 17 (anion/sugar transporter), member 5 [Source:MGI Symbol;Acc:MGI:1924105])

HSP 1 Score: 311.997 bits (798), Expect = 2.252e-98
Identity = 216/490 (44.08%), Postives = 303/490 (61.84%), Query Frame = 3
Query:  219 NENYDNLDENSESP--KEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVN-NSAIKDLGLNLTPEC-PNSDSAKVTKD---GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV--NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            N++ ++ D     P  ++      C   RY +A+  F GF V+YALRVNLSVA++ MV+ N+ + D     + EC  +S   KV  +    ++ WD   QG +LG+FF+GYI  QIP G IA +VGGK   G+G+L TS+ TL TP+AA LG   L+ LR LEG GE +T+PAMH M   WAP +E + +  I Y+G+  G VI L  S  +        W  VFY+ GI+GIVWFI+W ++   TP  H  I+  EK +I SS+   LSS++    VPW SIL SLP+WAI VA+F   WS YTLLT LP Y + +L F++ +NG+L+ALPY    +  ++ G+ AD +R +   ST   R++F+  GM+  A+F+VA  +IGCD  L V FL I+  LG   S+G+++NH+D+AP YAG+L GITN+ AT+ G+ GP +   LT     R+ WQ VF I++AI +FGAIFF +F  G+ QSWA+    
Sbjct:   11 NDDEESSDSTPLLPGARQTEAAPVCCSARYNLAILAFCGFFVLYALRVNLSVALVDMVDSNTTLTDN--RTSKECAEHSAPIKVHHNHTGKKYKWDAETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIIC---YYMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKV---VPWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIRE-WQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSDHH 491          
BLAST of slc17a-3 vs. UniProt/SwissProt
Match: sp|Q9NRA2|S17A5_HUMAN (Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2)

HSP 1 Score: 345.125 bits (884), Expect = 2.366e-110
Identity = 215/467 (46.04%), Postives = 301/467 (64.45%), Query Frame = 3
Query:  285 CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVN-NSAIKDLGLNLTPE-CP-NSDSAKVTKD---GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV--NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            C   RY +A+  F GF +VYALRVNLSVA++ MV+ N+ ++D   N T + CP +S   KV  +    ++ WD   QG +LG+FF+GYI  QIP G +A K+GGK   G G+L T++LTL TP+AA LG G LI LR LEG GE +T+PAMH M   WAP +E + +  I Y+G+  G VI L  S  +        W  VFY  G IGI WF++W ++   TP  H RI+  EK +I SS+   LSS++   +VPW  IL SLP+WAI VA+F   W+ YTLLT LP Y + +L F++ +NG+L++LPYL S +  ++SG+ AD +R++   ST   R++F+  GM+  A+F+VA  +IGCD  L V FL I+  LG   S+G+++NH+D+AP YAG+L GITN+ AT+ G++GP +   LT    T   WQ VFYI++AI +FGAIFF +F  G+ Q+WA+    
Sbjct:   35 CCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLED---NRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIIC---YYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQK---SVPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTP-DNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDHH 491          
BLAST of slc17a-3 vs. UniProt/SwissProt
Match: sp|Q9MZD1|S17A5_SHEEP (Sialin OS=Ovis aries OX=9940 GN=SLC17A5 PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 8.349e-105
Identity = 214/467 (45.82%), Postives = 294/467 (62.96%), Query Frame = 3
Query:  285 CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVN-NSAIKDLGLNLTP-EC-PNSDSAKVTKD---GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV--NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            C   RY +A   F GF V+Y+LRVNLSVA++ MV+ N+  KD   N T  EC  +S   KV  +    ++ WD   QG +LG+FF+GYI  QIP G +A + GGK   G G+  T++ TL TP+AA  G G L+ LR LEG GE +TYPAMH M   WAP +E + +  I Y+G+  G V+ L  S  +        W  VFY  GI+GI+WFI+W  +   TP  H  IT  EK +I SS+   LSS++   +VPW  +L SLP+WAI VA+F   W+ YTLLT LP Y + VL F+I +NG+L+A+PYL   +  ++SG+ AD +R+R   ST   R++F+  GM+  AIF+VA  +IGCD  L V FL I+  LG   S+G+++NH+D+AP YAG+L GITN+ AT+ G+IGP +   LT  + T   WQ VF I++AI +FGAIFF +F  G+ Q+WAI   +
Sbjct:   35 CCSARYNLAFLSFFGFFVLYSLRVNLSVALVDMVDSNTTAKD---NRTSYECAEHSAPIKVLHNQTGKKYRWDAETQGWILGSFFYGYIITQIPGGYVASRSGGKLLLGFGIFATAIFTLFTPLAADFGVGALVALRALEGLGEGVTYPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVVSLPLSGVIC---YYMNWTYVFYFFGIVGIIWFILWICLVSDTPETHKTITPYEKEYILSSLKNQLSSQK---SVPWIPMLKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEVLRFNIQENGFLSAVPYLGCWLCMILSGQAADNLRARWNFSTLWVRRVFSLIGMIGPAIFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMIGPIIARSLTP-ENTIGEWQTVFCIAAAINVFGAIFFTLFAKGEVQNWAISDHQ 491          
BLAST of slc17a-3 vs. UniProt/SwissProt
Match: sp|Q1L8X9|VGLU3_DANRE (Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2)

HSP 1 Score: 330.102 bits (845), Expect = 2.115e-103
Identity = 204/517 (39.46%), Postives = 299/517 (57.83%), Query Frame = 3
Query:  165 DKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA------IEKSEIEIEDQ 1679
            D SN+    N+ +      E+   +     SP       F +P RY+IA+   LGF + + +R NL VAI+ MVNN+ +   G              V +  +F WD    GL+ G+FFWGYI  QIP G I+ K+     FG  +  TS+L +  P AAR+ YG ++ +RIL+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ GI+W+I W  +A+++PA HP I+  E+ +IE+S+    NL S       PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  I+  + G++AD +RSRK LSTT  RK+ N   FGM    + +V  S+    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG LT H+ TR  WQ VF I+S +   G IF+ IF SG++Q WA       EK  I  ED+
Sbjct:   36 DGSNVTEEDNIELT-----EDGRPVAAPKRSPPLLDCGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYING------------TAVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQ---YVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHT---RAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHK-TRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCGIIGEDE 528          
BLAST of slc17a-3 vs. UniProt/SwissProt
Match: sp|Q8BFU8|VGLU3_MOUSE (Vesicular glutamate transporter 3 OS=Mus musculus OX=10090 GN=Slc17a8 PE=2 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 1.450e-102
Identity = 198/487 (40.66%), Postives = 293/487 (60.16%), Query Frame = 3
Query:  258 PKEKWYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA----IEKSEIEIEDQN 1682
            PK    +  C  IP RY+IAV   LGF + + +R NL VAI+ MVNNS +    ++  PE          +  +F WD    GL+ G+FFWGYI  QIP G I+ K      FG  +  TS L +  P AAR+ YG ++G+RIL+G  E +TYPA H M   WAP +E + +    + GS+AG V+ +  +  L++     GW SVFYI G+ GI+W++ W   A+  PA HP I+  E+ +IE+S+    NL+S  +  N PW+    SLPV+AI VANFC  W+ Y LL S P YFE V GF+I++ G L+A+P+++  IV  + G++AD +RSRK L+TT  RK+ N   FGM    + +V  S+    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I++ +   G IF+ +F SG++Q WA    + + +  I DQ+
Sbjct:   73 PKRYICDCSCCGIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVY---VDGKPE---------IQTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIPSAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYI---GWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKF-NTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHT---KGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHK-TREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEDKCGIIDQD 539          
BLAST of slc17a-3 vs. UniProt/SwissProt
Match: sp|A4FV52|VGLU1_BOVIN (Vesicular glutamate transporter 1 OS=Bos taurus OX=9913 GN=SLC17A7 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 3.204e-102
Identity = 189/469 (40.30%), Postives = 283/469 (60.34%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS----NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIED 1676
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS     G              V +  +F WD    GL+ G+FFWGYI  QIP G I  K      FG  ++ TS L +L P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG V+ +  +  L++ +   GW SVFY+ G  GI W++ W  V++ +PA HP I+  E+++IE ++  S++  +     N PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G+IAD +RSR+ +STT  RKL N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ +F SG++Q WA E  E+  E 
Sbjct:   57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGG------------HVVMQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYS---GWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGY-SHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHK-TREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEEMSEEK 507          
BLAST of slc17a-3 vs. TrEMBL
Match: A0A0H3YJ16 (Slc17a-3 OS=Schmidtea mediterranea OX=79327 GN=slc17a-3 PE=2 SV=1)

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 509/509 (100.00%), Postives = 509/509 (100.00%), Query Frame = 3
Query:  159 MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 1685
            MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI
Sbjct:    1 MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 509          
BLAST of slc17a-3 vs. TrEMBL
Match: A0A3Q0K7N2 (sialin OS=Ciona intestinalis OX=7719 GN=LOC100187364 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 7.406e-128
Identity = 229/497 (46.08%), Postives = 319/497 (64.19%), Query Frame = 3
Query:  201 INYYTSNENYDNLDENS--ESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIK-DLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQN 1682
            IN  TS     N +ENS  E  K+    +  + TR+ +A     GF  VYALRVNLSVAIL+MVN+S ++     N++  CP S S K +  GEF WD + + LVLGAFF+GYI  Q+P G +A + GGKW FG+G+L TS+LTLLTPVA R  +  LI LRI EG GE +T+PAMH+M G WAP  E + +  I Y+G   G VI    S  L  S  +GGWPSVFY+ G +GI+W I+W   A S PA+HPRIT +E  +I+S  NL  ++   +VPW  I  S  VWAIS+A+FC+ W  YTLLT LP Y + VL F I Q+G+++ALPYL+  I    +G +AD +R ++ L+TT TRK+FN    +   IF+VA  ++GC+KV  V+ +C+A A       G+N NH+D+ P+YAG+L GITN+ AT+ G   P+VVG+LT +  +R +W+IVFYI++ + L G I + +  +G+ Q W   K ++E++ + 
Sbjct:   12 INTSTSTSPILNSNENSNKEYFKKPPTVKTWLSTRFCLAYLACFGFMNVYALRVNLSVAILSMVNSSYMEIHTHNNISDACPASPSHKNSTTGEFNWDAHKRSLVLGAFFYGYILTQLPGGYLAGRFGGKWLFGLGILCTSVLTLLTPVATRTSFVLLIILRIFEGIGEGVTFPAMHSMWGIWAPPSERSRLVSITYAGCHLGTVIAQPISGILCASTFLGGWPSVFYVFGTLGILWCIVWFIFAHSKPADHPRITTSELNYIQS--NLEPKDDSVSVPWWEIATSKRVWAISIAHFCNNWGFYTLLTCLPTYLKDVLKFDIQQDGFISALPYLVMWISINFNGLLADYLREKEILNTTQTRKIFNAVAFIGPGIFLVASGFVGCNKVAAVSLICLATAFNGAGFPGFNTNHVDIGPRYAGILMGITNTWATIPGFAAPAVVGLLTENNPSRSQWRIVFYIAAGVYLTGTILYSLMATGEEQEWNRGKKKVELDQKQ 506          
BLAST of slc17a-3 vs. TrEMBL
Match: A0A2C9JWM3 (MFS domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106070883 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 4.290e-126
Identity = 229/511 (44.81%), Postives = 321/511 (62.82%), Query Frame = 3
Query:  150 NNSMTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECP---NSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA-IEKSEIEI 1670
            N+S+   S  ++ S+  +  Y   E     +E S+          CI  R+V+A+  FLGF  VY LRV+LSVA++AMVN+S+        T +CP     +S    K GEF WD+  QG +LGAFF+GYI  Q+P G +A K GGK  FG GVL TS+LTL+TPVAAR     LI +R+LEG GE +T+PAMH M G WAPV E + +    Y+G+  G VI +  S  L +S+  GGWPS FY+ G +G VWF+ W F+  +TPA HPRI+ +E+ +IESSV    +  H   PW  IL    +W IS+A+F + W  YTLLT LP Y  ++L F++ +NG L+A+PY +  +    SG +AD +R R +LST   RKLF + G++  AIF++ ++Y+GCD VL V FL ++V L      GYN+NH+D+AP++AGVL GITNS+ T+ G +GP+VVG LTN+ +TR +WQIVFYI++ +   GAI + +   G+   W+ +   E EI
Sbjct:   13 NSSVHSGSQDMDESDALLPSYAELERKKKDEEGSQ----------CIAARHVLAIMAFLGFVNVYCLRVDLSVALVAMVNSSSSSSNSSKST-DCPAPGKDNSTSPAKVGEFDWDETTQGYILGAFFYGYIVTQVPGGWLASKFGGKNLFGYGVLCTSVLTLITPVAARYSVYLLIAVRVLEGLGEGVTFPAMHAMWGSWAPVWERSKLAAFTYAGAQLGTVISMPVSGLLCDSDFGGGWPSAFYVFGSLGCVWFVAWMFLVHNTPAEHPRISTSEREYIESSVG---KREHIKTPWLQILTCPALWGISLAHFTNNWCYYTLLTCLPAYMSNILRFNLKENGLLSAMPYAVCFLTQNTSGVLADFLRGRGYLSTGNARKLFTSIGLLSPAIFLIVVNYVGCDHVLAVLFLTLSVGLQGCIMGGYNINHLDIAPKFAGVLMGITNSLGTIPGFMGPAVVGYLTNNNQTRGQWQIVFYITAGMCFVGAIGYDLLAKGEEMHWSRLPHKEQEI 509          
BLAST of slc17a-3 vs. TrEMBL
Match: A0A0B7A1X2 (MFS domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF91830 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 4.763e-126
Identity = 229/490 (46.73%), Postives = 316/490 (64.49%), Query Frame = 3
Query:  219 NENYDNLDE---------NSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLN-LTPECPN----SDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
              N DN DE         + E  +++     C   R+++AV  FLGF  VY LRVNLSVA++AMVN S       + +  ECP+    + SAK T  GEF WDQ  QG VLGAFF+GYI  Q+P G +A + GGK   G G+L T+LLT++TP AAR     +I +R+LEG GE +T+PAMH M G WAPV E + +    Y+G+  G V  +  S  L  S+  GGWPSVFY+ GI+G VWF+ W  +   TP+ HPRI+  E+ +IE+S+     +   + PWK IL S  VW ++VA+F + W  YTLLTSLP Y +++L F + +NG L+A+PY +  +V  +SG  AD +RS  ++ST  TRKLFNT G +I  I ++ + Y+GCD VL + FL ++V  G    AGYNVNH+D+AP++AG+L GITN++AT+ G IGP+VVG LTN+ ETR +WQI+FYI+++I L GAI F+I   G+  SW+
Sbjct:   35 QNNDDNPDEVTHLLPSYADVERKRKQATGSQCFEARHMLAVMAFLGFFNVYCLRVNLSVALVAMVNTSQSASSSNSSIDNECPDPYGGNSSAKYT--GEFNWDQKTQGNVLGAFFYGYIITQLPGGWLASRFGGKRLLGFGILGTALLTIITPFAARYSVYLMIAVRVLEGVGEGVTFPAMHAMWGRWAPVWERSKLVSFTYAGAQLGTVFSMPISGLLCASDFAGGWPSVFYVFGILGCVWFVAWMLLVHDTPSQHPRISTAERDYIENSI---GTQETVSTPWKQILTSSAVWGMAVAHFANNWGFYTLLTSLPTYMKNILKFDMKENGLLSAIPYAVCWVVQNLSGLTADYLRSHGYISTGNTRKLFNTLGTVIPGIMLIIVGYVGCDHVLAMVFLTLSVGFGGCTIAGYNVNHLDIAPKFAGILCGITNAVATIPGFIGPAVVGYLTNNNETRGQWQIIFYITASIYLTGAIVFIILAKGEEMSWS 519          
BLAST of slc17a-3 vs. TrEMBL
Match: F7ANS1 (MFS domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 392.119 bits (1006), Expect = 9.301e-126
Identity = 227/500 (45.40%), Postives = 319/500 (63.80%), Query Frame = 3
Query:  201 INYYTSNENYDNLDENS--ESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIK-DLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESS-----VNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIED 1676
            IN  TS     N +ENS  E  K+    +  + TR+ +A     GF  VYALRVNLSVAIL+MVN+S ++     N++  CP S S K +  GEF WD + + LVLGAFF+GYI  Q+P G +A + GGKW FG+G+L TS+LTLLTPVA R  +  LI LRI EG GE +T+PAMH+M G WAP  E + +  I Y+G   G VI    S  L  S  +GGWPSVFY+ G +GI+W I+W   A S PA+HPRIT +E  +I+S+     ++   ++   +VPW  I  S  VWAIS+A+FC+ W  YTLLT LP Y + VL F I Q+G+++ALPYL+  I    +G +AD +R ++ L+TT TRK+FN    +   IF+VA  ++GC+KV  V+ +C+A A       G+N NH+D+ P+YAG+L GITN+ AT+ G   P+VVG+LT +  +R +W+IVFYI++ + L G I + +  +G+ Q W   K ++E++ 
Sbjct:   12 INTSTSTSPILNSNENSNKEYFKKPPTVKTWLSTRFCLAYLACFGFMNVYALRVNLSVAILSMVNSSYMEIHTHNNISDACPASPSHKNSTTGEFNWDAHKRSLVLGAFFYGYILTQLPGGYLAGRFGGKWLFGLGILCTSVLTLLTPVATRTSFVLLIILRIFEGIGEGVTFPAMHSMWGIWAPPSERSRLVSITYAGCHLGTVIAQPISGILCASTFLGGWPSVFYVFGTLGILWCIVWFIFAHSKPADHPRITTSELNYIQSNLEPDKISFLQKDDSVSVPWWEIATSKRVWAISIAHFCNNWGFYTLLTCLPTYLKDVLKFDIQQDGFISALPYLVMWISINFNGLLADYLREKEILNTTQTRKIFNAVAFIGPGIFLVASGFVGCNKVAAVSLICLATAFNGAGFPGFNTNHVDIGPRYAGILMGITNTWATIPGFAAPAVVGLLTENNPSRSQWRIVFYIAAGVYLTGTILYSLMATGEEQEWNRGKKKVELDQ 511          
BLAST of slc17a-3 vs. Ensembl Cavefish
Match: si:ch1073-513e17.1 (sialin-like [Source:NCBI gene;Acc:103042153])

HSP 1 Score: 334.339 bits (856), Expect = 6.610e-107
Identity = 214/496 (43.15%), Postives = 297/496 (59.88%), Query Frame = 3
Query:  240 DENSE--SP------KEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNS-AIKDLGLNLTPECP---NSDSAKVTK-DG--EFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQN 1682
            DENSE  SP      +E      C   R  +A+  F GFAVVY LRVNLSVA++AMVN + +   L  + T ECP   NS S    + DG   + WD  +QG++LGAFF+GY+  QIP G ++   GG+ F G GVL T++LTLLTP+AA LG  WL  LR LEG GE +TYPAM  M   WAP +E   +  +  +G   G  +    +  +  S    GWP+VFY  G  G +W I+W  +    P  HPRI+  EK +I +++         +VP   +LLS+P+WAI +   CS WS YTLLTSLP Y + VL F + QN +L+ALPYL   +  V+SG IAD +  R+ +  T  RK+F   GM++ A F+VA+++ GC   L VTFL ++  +G  +SAG  +N ID+AP+YAGVL GITN+  T+ G++ P VVG L     +   W  VFY+S+ +++ GAI F +FGSG  Q+WA+ + E E + ++
Sbjct:   15 DENSEENSPLLQKEAEELSVPPKCCSARCNLAIMMFFGFAVVYGLRVNLSVAMVAMVNGTNSQPSLNGSETHECPGALNSSSQSPDQLDGVPRYNWDSQMQGMLLGAFFFGYLFTQIPGGYLSGHFGGRIFLGGGVLCTAILTLLTPLAAELGARWLFALRALEGFGEGVTYPAMMAMWACWAPPLERARLMSLSGAGGNFGAFVSFPLTGFICHSL---GWPAVFYWCGGAGCLWAILWFILVSDDPRKHPRISDQEKEYIVNTIGSEGGSHGWSVPLLPMLLSVPLWAIIITQMCSNWSYYTLLTSLPTYMDTVLHFDLRQNSFLSALPYLGGWLFSVLSGVIADNLLERELMGVTAIRKIFTVVGMVVPAGFLVAVAFSGCSGGLAVTFLTLSSTIGGASSAGVYMNQIDIAPRYAGVLLGITNTFGTIPGVLAPIVVGQLAK-DHSLTGWSNVFYVSAGVSVVGAIIFTVFGSGKLQNWAVSEDEREADRES 506          
BLAST of slc17a-3 vs. Ensembl Cavefish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 327.791 bits (839), Expect = 1.472e-103
Identity = 193/465 (41.51%), Postives = 283/465 (60.86%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
            F +P RY+IA+   LGF + + +R NL VAI+ MVNN+ +    +N TP         V +  +F WD    GL+ G+FFWGYI  QIP G I+ K+     FG  +  TS+L +  P AAR+ YG ++ +RIL+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ GI+W+  W  +A+ +PA HP I+  EK +IE+++    +L S       PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  IV  + G++AD +RS K LSTT  RK+ N   FGM    + +V  S+    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG LT H+ TR  WQ VF I+S +   G IF+ IF SG++Q WA  +S
Sbjct:   54 FGLPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVY---INGTP---------VMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSMLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQ---YVGWPSVFYIYGVFGIIWYTFWLLLAYDSPAVHPTISDEEKIYIETTIGEGASLMSATEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIVVPIGGQLADFLRSNKILSTTTVRKIMNCGGFGMEATLLLVVGFSH---TRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHK-TRLEWQNVFVIASMVHYCGVIFYAIFASGEKQDWADPES 499          
BLAST of slc17a-3 vs. Ensembl Cavefish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 325.865 bits (834), Expect = 1.064e-102
Identity = 195/471 (41.40%), Postives = 285/471 (60.51%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECP-NSDSAKVTKD-----GEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSV----NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
            F +P RY+IA+   LGF + + +R NL VAI+ MVNN+ +    +N TP    N    K T+       +F WD    GL+ G+FFWGYI  QIP G I+ K+     FG  +  TS+L +  P AAR+ YG ++ +RIL+G  E +TYPA H M   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ GI+W+  W  +A+ +PA HP I+  EK +IE+++    +L S       PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  IV  + G++AD +RS K LSTT  RK+ N   FGM    + +V  S+    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG LT H+ TR  WQ VF I+S +   G IF+ IF SG++Q WA  +S
Sbjct:   54 FGLPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVY---INGTPVMQVNKKKHKRTESFFILPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSMLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQ---YVGWPSVFYIYGVFGIIWYTFWLLLAYDSPAVHPTISDEEKIYIETTIGEGASLMSATEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIVVPIGGQLADFLRSNKILSTTTVRKIMNCGGFGMEATLLLVVGFSH---TRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHK-TRLEWQNVFVIASMVHYCGVIFYAIFASGEKQDWADPES 514          
BLAST of slc17a-3 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 322.013 bits (824), Expect = 1.514e-101
Identity = 189/472 (40.04%), Postives = 285/472 (60.38%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSE----ERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQ 1679
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS I + G  +           + +  +F WD    G++ G+FFWGYI  QIP G I+ ++     FG  ++ TS L +  P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG VI +  +  L++     GW SVFY+ G  G+VW++ W  V++ +PA HP IT  E+ +IE S+  S++          PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+ALP+L+  I+  + G+IAD +RS+  +STT  RK+ N   FGM    + IV  S+    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I+S +   G IF+ IF SG++Q WA    E+  E++
Sbjct:   43 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHENGKII-----------IKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT---GWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSH---SKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNK-TREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWA--DPELTSEEK 494          
BLAST of slc17a-3 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 322.013 bits (824), Expect = 3.114e-101
Identity = 189/472 (40.04%), Postives = 285/472 (60.38%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSE----ERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQ 1679
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS I + G  +           + +  +F WD    G++ G+FFWGYI  QIP G I+ ++     FG  ++ TS L +  P AAR+ YG +I +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG VI +  +  L++     GW SVFY+ G  G+VW++ W  V++ +PA HP IT  E+ +IE S+  S++          PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+ALP+L+  I+  + G+IAD +RS+  +STT  RK+ N   FGM    + IV  S+    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I+S +   G IF+ IF SG++Q WA    E+  E++
Sbjct:   65 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHENGKII-----------IKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT---GWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSH---SKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNK-TREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWA--DPELTSEEK 516          
BLAST of slc17a-3 vs. Ensembl Sea Lamprey
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 245.743 bits (626), Expect = 2.169e-73
Identity = 173/484 (35.74%), Postives = 256/484 (52.89%), Query Frame = 3
Query:  231 DNLDENSESPKEKWYNRFC--IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVW--DQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGK--WFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLS----SEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            D      + PKE      C  +P RYVIAV   LGF + + +R NL VA++ MVNNS+             +S    + + G   W  D  +Q   L  FF  +  L    G I VK   +         L    L +       +    L  L  L    + +TYPA H +   WAP +E + +    + GS+AG V+ +  +  L++     GW SVFY+ G  G+ W+I W  +A+ +PA HP I+  EK +IE S+  S       +    PWK    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  IV  + G++AD  RS+K +STT  RK+ N   FGM    + +V  S+    K + +TFL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T  + TR+ WQ VF I++ +   G IF+ +F SG++Q WA
Sbjct:    6 DGRPVQVKPPKEPLCECRCFGMPKRYVIAVMSGLGFCISFGIRCNLGVAVVDMVNNSSY------------HSGDKLIVQKGSLGWSMDLAMQLHELYNFFLFF--LATWQGHIVVKSMSREERLHQCSTLPPHWLPVHVEERRAVPCACLTSLS-LSSVEQGVTYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQ---YAGWSSVFYVYGSFGLFWYIFWLCIAYESPAKHPTISDEEKTYIEESIGESYGILGSTQKFKTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIISALPHLVMTIVVPIGGQLADFFRSKKIMSTTTVRKMMNCGGFGMEATLLLVVGFSH---GKGIAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKGK-TREEWQNVFLIAALVHYGGVIFYGLFASGEKQPWA 467          
BLAST of slc17a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010352.1 (pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene:ENSPMAG00000009375.1 transcript:ENSPMAT00000010352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.083 bits (549), Expect = 1.085e-65
Identity = 111/244 (45.49%), Postives = 161/244 (65.98%), Query Frame = 3
Query:  924 AFSTPANHPRITMTEKRFIESSVNLSSEERH-SNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIE 1652
            AF +P  HPRI+  E+ FI  S+    +  H +++PW+ +   +P+WAI+VA FCS W  Y LLTSLP Y   VL + + QNG L+ALPYL   +  V  G  AD +R R  LS T  RK+  T G+ + ++ +VA  ++GC+ +L V+FL ++VA G   +AG  +N +D+APQYAGVL GI+N+   + G + P++ G LT H +T K W +VF+IS+AI +FGA+F+L+FGSG +QSWA E
Sbjct:   15 AFDSPERHPRISAEEREFILKSLQAERQANHGTSIPWRHVWTCMPLWAINVAMFCSGWGFYVLLTSLPTYMSTVLHYEMQQNGLLSALPYLAGWVFTVAGGMAADALRIRGLLSITAIRKVATTLGLAVPSLCLVASGFVGCNHLLAVSFLTLSVAFGAFTTAGCGINQLDIAPQYAGVLLGISNTFNNLPGFLAPTLTGYLTEH-DTLKEWHMVFFISAAINMFGALFYLVFGSGKQQSWARE 257          
BLAST of slc17a-3 vs. Ensembl Nematostella
Match: EDO45514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS9])

HSP 1 Score: 344.739 bits (883), Expect = 1.276e-111
Identity = 214/469 (45.63%), Postives = 292/469 (62.26%), Query Frame = 3
Query:  285 CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVT-KDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEER--HSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTT--NSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIED 1676
            C   RY +A+   LGF VVY LRVNLSVA++AMVN S    +  N   ECP  ++   T K+G+F WDQ  QGL+LG+FF+GYI  Q+P G +A + GGK  FG GVL TS+ TLLTP AA  G   LI LRILEG GE +T+PAMH +   WAP +E + +  + Y+G   G +I +  +  L  S + GGWPSVFYI G +GI+WF++W+ +    PA+HP I+  E+ +I SS+  S + +    N PW +I  S  VWAI +A+FC+ W  YT LT LP YF+ VL FSI  NG+L+A+PY    +  V++G+IAD +  R+  S +  RK+F     +I A  +VA SY GC    +   L  + ALG T  N +G+NVNH+D+AP+YAG+L GITNS  TV GI  P V G +TN +  R  WQIVF+IS+ + + GAI F+    G  + W I + ++  E 
Sbjct:   21 CWRVRYTLALLACLGFCVVYGLRVNLSVALVAMVN-STYDGIDGNTNSECPGGNTPDTTYKNGDFNWDQKTQGLILGSFFYGYICTQLPGGWLASQFGGKHLFGFGVLCTSIFTLLTPWAAHQGIPMLIALRILEGLGEGVTFPAMHAIWSSWAPPLERSKLLTLSYAGCQLGNIIFMPLAGVLCASEIAGGWPSVFYIFGSLGILWFVVWTLMVTEKPADHPTISEAERDYIISSIGTSQDRKTTKQNTPWSAIWSSPAVWAIIIAHFCNNWGFYTFLTLLPSYFKEVLNFSILTNGFLSAVPYSTQWLFIVIAGQIADWLLRRRISSVSDVRKVFCVTAFIIPACLLVATSYTGCTTTTLSVCL-FSTALGFTGFNLSGFNVNHLDIAPRYAGILMGITNSFGTVPGIAAPYVAGWITNKKPDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRWNIPEKDMIQES 487          
BLAST of slc17a-3 vs. Ensembl Nematostella
Match: EDO46366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH0])

HSP 1 Score: 302.753 bits (774), Expect = 1.871e-95
Identity = 186/464 (40.09%), Postives = 275/464 (59.27%), Query Frame = 3
Query:  276 NRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEE--RHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            ++  +P RY++AV G  G  V ++LRVNLSVA++AMVN++                      K+  F WDQ  +G++LG+FF+GYI + IP G +A + GGK F G+GVL +S+L+LLTP+AAR  Y  LI LRILEG  + + YP+++ +L  WAP  E + +  I ++G  AG +IGL+ S  L  S     WPSVFY+ G  GIVW++ W F+ + +P+ HPRI++ EK +I +++  S ++  +    PW+ IL S  V AIS++ FCS W   T LTSLP YF+ VL F+I  NG L+ALPY       + +G +AD +     ++ T  RK+F      + +  +VA+ +     V+ VT LC+     T ++ G+ ++ ++ AP+Y G+L+ I NSI T  GI  P VVG LTN Q TR +WQ V+YI + I +FGA+ F   G+   Q W     E
Sbjct:    4 SKCILPCRYILAVLGCFGLTVTFSLRVNLSVALVAMVNSTQTGQ-----------------PKEDYFSWDQQTRGIILGSFFYGYIVMLIPGGWLAERNGGKHFVGLGVLISSVLSLLTPLAARYSYKMLIVLRILEGLAQGVIYPSVNVLLSCWAPPEERSKMLVITWTGCQAGNIIGLVVSGLLCASRFQ--WPSVFYLFGASGIVWYLFWCFLVYDSPSVHPRISLEEKEYIVTAIGASQDKVVKKHPTPWRQILTSRAVLAISISFFCSNWGFCTFLTSLPTYFQEVLHFNITTNGLLSALPYFCQYFTSLPAGFLADWLIHSHIITVTEVRKIFT-----LASCIMVALGFTN-QPVVAVTLLCVLFMFQTIDTCGHWISPMEFAPRYCGLLFAIANSIGTSTGIAAPFVVGYLTNGQPTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPWNTPPEE 442          
BLAST of slc17a-3 vs. Ensembl Nematostella
Match: EDO31704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX52])

HSP 1 Score: 301.212 bits (770), Expect = 9.347e-95
Identity = 186/483 (38.51%), Postives = 270/483 (55.90%), Query Frame = 3
Query:  237 LDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEE-RHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQN 1682
            L E   +   KW     IP RYV+    +LGF  +Y++RVNL+VAI+ MVN+  I    L+              K  EF WD  +QGLVLG+FF+GY  LQIP   +A+++GG   FG GV  TSLL LLTPVA R     L+G+RI +G    +T+P  H +   WAP  E + +  I  +G   G ++ +  +  L +    GGWPSVFY  G  GI+W+  W  V   +PA HP I+  E+  IE+S+  S  + +   +PW  IL    VWAI + +F + W  YTL T +P YF+ VL F I Q G+L A PYL  A++  + G +AD +     L     R +F   G ++  +FIVA SY    + + V FL + V     N+ GY VNH+D+APQYAGVL G+TN+ A+  G I P + G++T H++ ++ W+IVF+I+  + +   I +    SG RQ WA  + ++E+ ++ 
Sbjct:   23 LHEEPAAKTTKW----GIPKRYVLLAMTWLGFINIYSMRVNLNVAIVGMVNDQTISKGRLHFI------------KKAEFNWDSALQGLVLGSFFYGYWVLQIPGAWLAMRIGGTRVFGYGVFVTSLLALLTPVATRYSVWGLVGVRIFQGLFLGVTFPCNHAIWSKWAPPFERSTLITISIAGCPFGNIVAIPLTGLLSKYGFDGGWPSVFYCFGTSGIIWYCCWELVVHESPATHPTISKEERELIENSIASSDNKAQFEGLPWHHILRCKAVWAIVIGHFGACWGYYTLFTGMPTYFKDVLDFDIEQTGFLAACPYLFKALLAPLGGILADYLIKHNILRIGTVRVIFYAVGCLLAGVFIVATSY-ATTRHMCVIFLVLGVGFSGLNAIGYAVNHLDIAPQYAGVLMGLTNTFASTPGFISPQITGIVTKHKK-QEEWRIVFWITMIVYVVAVIGYSALCSGYRQPWAGGRDQVELSEKE 487          
BLAST of slc17a-3 vs. Ensembl Nematostella
Match: EDO48671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA9])

HSP 1 Score: 282.722 bits (722), Expect = 3.529e-88
Identity = 182/457 (39.82%), Postives = 262/457 (57.33%), Query Frame = 3
Query:  297 RYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLN----LTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEK 1655
            RY++A+  FLG  V YALRVNLSVAI AM N   + + G      L   C      +     EF W   +QG +LGAF++GY+ +Q+P G +  + GG   FGI +   S+LT+LTP+AAR     LI LR++EG      +P  H +   WAP  E T +  I  +G   G ++ +  S  + +    GGW SVFY  G +G++WF +W     +TP+ HP I+  EK +IE+++      + S +PWKSIL S PVWAI +ANF + W +YT+L  LP YF  VL F +A+ G+L ALPY+L A V    G I D +   K LS   TR+   T G  + +IF++A  Y      L V  L I V +   N+AGY VN +D+AP+YAGV+ G+TN      G I P +VG++T ++ T K W++VF+I+  + + G + F +  SGD+Q WA++ 
Sbjct:    1 RYIVAIMVFLGICVQYALRVNLSVAIGAMCNPHTVTENGFTIKKVLVVYCVTVRRHQKVLPAEFDWSSKLQGTILGAFYYGYMTMQLPGGWLGQRFGGTRVFGICLGIASVLTMLTPLAARTSVVALITLRVIEGLTLGALFPCNHAIWSKWAPPSERTRLFTITVAGCPVGTILSMPLSGLMSKYGFDGGWASVFYCFGAVGLLWFFVWQLSIHATPSEHPTISEEEKVYIETAIADQPGVKLS-IPWKSILTSGPVWAIIIANFTADWGMYTILICLPKYFIEVLKFDLAKTGFLAALPYVLKAFVGPTGGVIVDWLIKNK-LSVKNTRRCVFTVGCTVASIFVLATGYAN-QPYLAVGLLTIGVGITGINAAGYAVNILDIAPKYAGVIMGVTNVFGAAPGFISPQIVGIITPNK-TAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKWAMDD 453          
BLAST of slc17a-3 vs. Ensembl Nematostella
Match: EDO31712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX51])

HSP 1 Score: 265.774 bits (678), Expect = 3.029e-82
Identity = 170/436 (38.99%), Postives = 255/436 (58.49%), Query Frame = 3
Query:  339 VYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 1646
            +YA+R  LSVAI+AMV+NS +              +  K  K  EF W   +QGLVLG+F++GY  LQIPAG   +K+GGK  FG G+L  S+L L+TP   +  +   I LRI +G    +   A H +   W+P+ E   +  I  SG+  G ++ +  +  L +S    GWP  FY  G +G++WFI W +  + TP +HP IT  E  FI    N+  E   S VPW SIL S PVWA +   F S W  Y++L  +PL+ + VL FS+++ G+++ALP++L  IV  VSG  AD +R+R  LST   RK+F   G+  ++ F+VA+ Y      L +  L + +      +AG   N IDL+P+YAG+L G +N++ +++G + P VVGVLT H  T + W++VF++++ ++L G + ++ FGSG +QSWA
Sbjct:    1 MYAVRTCLSVAIVAMVSNSTVLI------------NGKKTVKPPEFAWSSEMQGLVLGSFYYGYAVLQIPAGWAVLKIGGKPIFGFGILVASVLALVTPPIVKQSFIVFICLRIAQGLSLGLIASAHHCIWATWSPIFERASLLTIAGSGTLVGTIVTMPVTGLLCDSP--KGWPLAFYFIGSLGVLWFIAWQYFMYETPQDHPTITQAEIEFIGVPWNI-DEATKSVVPWASILCSTPVWAANFTMFISDWCFYSMLICIPLFMKQVLHFSLSETGFVSALPFVLMTIVSPVSGMYADRLRARGVLSTGAIRKIFQCAGLAASSCFVVAVGY-ESKPFLSLALLTLGIGSFGLIAAGVGPNLIDLSPKYAGLLMGFSNTMGSLSGFLAPGVVGVLTVHG-TLEEWRLVFWLTAVLSLAGILVYVAFGSGKKQSWA 419          
BLAST of slc17a-3 vs. Ensembl Medaka
Match: slc17a5 (solute carrier family 17 member 5 [Source:NCBI gene;Acc:101165833])

HSP 1 Score: 352.443 bits (903), Expect = 3.468e-114
Identity = 208/458 (45.41%), Postives = 294/458 (64.19%), Query Frame = 3
Query:  285 CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGE-FVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEK 1655
            C  +RY +A+    GF VVY+LRVNLSVA++ M+N +   +   ++ P  P+    K       + WD   QG +LG+FF+GYI  QIP G +A + G KW  G G+L T++ TLLTP+AA LG  +LI +R+LEG GE +++PAM+TM   WAP +E + +  I Y G+  G VI L  S Q+       GW  VFYI GIIG+VWF++W+F  F +P  HPRI+  E+ +I +S+          +PW++IL S P+ AI VA+F   W+ YTLLT LP Y   +LGFSI QNG L+ALPY+  A+  VVSG+IAD +R      T   RK F+  GM+  A+F+VA  +IGCD  L VTFL ++ +LG  +++G+N+NH+D+AP YAG+L GITN+ AT+ G++GP +   LT H  T   WQ+VFYI++AI + GA+F+ +FG G  Q WA+ +
Sbjct:   33 CCSSRYGLALLSCYGFFVVYSLRVNLSVAMVDMLNTTHQTNHSASVCPAHPSPARPKNNHTANVYNWDSETQGWILGSFFYGYILTQIPGGYMAGRFGAKWLMGFGILGTAVFTLLTPLAADLGASYLIAVRVLEGIGEGVSFPAMYTMWAAWAPPLERSRLLTISYLGAQLGTVISLPVSGQIC---FYLGWTYVFYIFGIIGLVWFVLWAFFVFDSPNTHPRISERERLYITNSLKNELSPSAGFIPWRAILTSRPLLAIVVAHFSYNWTFYTLLTLLPTYMNDILGFSIQQNGMLSALPYVGCALFAVVSGQIADYLRETCLYPTVTVRKCFSLVGMIGPALFLVAAGFIGCDYTLAVTFLTLSSSLGGVSASGFNINHLDIAPSYAGILLGITNTFATIPGMVGPVIARALTQHN-TIAEWQVVFYIAAAINVVGALFYSVFGRGTVQPWAVSE 486          
BLAST of slc17a-3 vs. Ensembl Medaka
Match: ENSORLT00000010015.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 321.627 bits (823), Expect = 8.561e-102
Identity = 184/472 (38.98%), Postives = 285/472 (60.38%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS--NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 1685
            F +P RY+IA+   +GF + + +R NL VA+++MVN+  +               + +V    +F WD    G++ G+FFWGYI  QIP G I  K      FG  ++ TS L +L P AAR+ +G +I +RI +G  E ++YPA H +   WAP +E + +    + GS+AG VI +  +  L++ +   GW SVFY+ G  G++W+  W  V++ +PA HP IT  E+++IE S+  S++   +  N PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G+IAD +RS + ++TT  RKL N   FGM    + +V  S+    K + +TFL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ +F SG++Q+WA E  E+ +E   I
Sbjct:    9 FGLPRRYIIAILSGIGFCISFGIRCNLGVAVVSMVNSHKVL------------RGNKEVIVKAQFEWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAAARMHFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYS---GWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYIEESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSH---TKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHK-TREEWQGVFLIASLVHYGGVIFYGLFASGEKQTWA-EPEELSVEKCGI 460          
BLAST of slc17a-3 vs. Ensembl Medaka
Match: slc17a8 (vesicular glutamate transporter 3 [Source:NCBI gene;Acc:101165727])

HSP 1 Score: 322.783 bits (826), Expect = 1.205e-101
Identity = 189/460 (41.09%), Postives = 285/460 (61.96%), Query Frame = 3
Query:  288 IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS-NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS 1658
            +P RY+IA+   LGF + + +R NL VAI+ MVNN+ +    +N TP         V +  +F WD    GL+ G+FFWGYI  QIP G IA K+     FG  +  TS+L +  P AAR+ YG ++ +RIL+G  E +TYPA H +   WAP +E + +    + GS+AG VI +  +  L++     GWPSVFYI G+ GI+W+++W  +A+ +PA+HP IT  E+ +IE+++  +  +      PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+A+P+++  IV  + G++AD +RS+K +STT  RKL N   FGM    + +V  S+    + + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG LT ++ TR  WQ VF I+S +   G IF+ IF SG++Q WA  +S
Sbjct:   70 LPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVY---INGTP---------VLQRAQFNWDPETVGLIHGSFFWGYIVTQIPGGFIANKLSANRVFGAAIFLTSVLNMFIPSAARVHYGCVLFVRILQGLVEGVTYPACHGLWAKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQ---YVGWPSVFYIYGVFGIMWYVMWLLLAYGSPADHPTITEEERLYIEAAIGETVNQLSKFRTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIVVPIGGQLADFLRSKKIMSTTNVRKLMNCGGFGMEATLLLVVGFSHT---RGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKNK-TRLEWQHVFVIASMVHYSGVIFYAIFASGEQQDWANPES 510          
BLAST of slc17a-3 vs. Ensembl Medaka
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:101175075])

HSP 1 Score: 322.783 bits (826), Expect = 1.279e-101
Identity = 185/466 (39.70%), Postives = 280/466 (60.09%), Query Frame = 3
Query:  282 FCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSE----ERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIE 1667
            F +P RY+IA+   LGF + + +R NL VAI++MVNNS I   G  +           V +  +F WD    G++ G+FFWGYI  QIP G I+ ++     FG  ++ TS L +  P AAR  YG +I +RIL+G  E +TYPA H +   WAP +E + +  + + GS+AG VI +  +  L++     GW SVFY+ G  GI W++ W  V++ +PA HP IT  E+R+IE S+  S++          PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G L+ALP+L+  I+  + G++AD +RS   +STT+ RK+ N  G  + A  ++ + Y    K + ++FL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T ++ TR+ WQ VF I+S +   G +F+ IF SG++Q WA  +   E
Sbjct:   65 FGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNNSTIHQNGKII-----------VKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARSHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATLSFCGSYAGAVIAMPLAGVLVQYT---GWSSVFYVYGSFGIFWYMFWILVSYESPAEHPTITEEERRYIEESIGESAQLMGPSEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPLGGQLADYLRSHNIMSTTMVRKIMNCGGFGMEATLLLVVGY-SHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNK-TREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADPEETKE 514          
BLAST of slc17a-3 vs. Ensembl Medaka
Match: ENSORLT00000010014.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 322.398 bits (825), Expect = 1.627e-101
Identity = 189/494 (38.26%), Postives = 291/494 (58.91%), Query Frame = 3
Query:  216 SNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHS--NVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT--FGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 1685
            S E    L +  E P       F +P RY+IA+   +GF + + +R NL VA+++MVN+  +               + +V    +F WD    G++ G+FFWGYI  QIP G I  K      FG  ++ TS L +L P AAR+ +G +I +RI +G  E ++YPA H +   WAP +E + +    + GS+AG VI +  +  L++ +   GW SVFY+ G  G++W+  W  V++ +PA HP IT  E+++IE S+  S++   +  N PW+    S+PV+AI VANFC  W+ Y LL S P YFE V GF I++ G ++ALP+L+  I+  + G+IAD +RS + ++TT  RKL N   FGM    + +V  S+    K + +TFL +AV       +G+NVNH+D+AP+YA +L GI+N + T++G++ P +VG +T H+ TR+ WQ VF I+S +   G IF+ +F SG++Q+WA E  E+ +E   I
Sbjct:   33 SAEGRPELVQEKEMPVVD-CTCFGLPRRYIIAILSGIGFCISFGIRCNLGVAVVSMVNSHKVL------------RGNKEVIVKAQFEWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAAARMHFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYS---GWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYIEESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSH---TKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHK-TREEWQGVFLIASLVHYGGVIFYGLFASGEKQTWA-EPEELSVEKCGI 505          
BLAST of slc17a-3 vs. Planmine SMEST
Match: SMESG000066847.1 (SMESG000066847.1)

HSP 1 Score: 918.687 bits (2373), Expect = 0.000e+0
Identity = 499/509 (98.04%), Postives = 505/509 (99.21%), Query Frame = 3
Query:  159 MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 1685
            MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKD GLNLTPECPNS+ +KVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGY+NALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT GM INAIFIVAISYIGC+KVLVVTFLCIAVALGT+NSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRK+WQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI
Sbjct:    1 MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDPGLNLTPECPNSNLSKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYVNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTVGMTINAIFIVAISYIGCNKVLVVTFLCIAVALGTSNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKQWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 509          
BLAST of slc17a-3 vs. Planmine SMEST
Match: SMESG000066847.1 (SMESG000066847.1)

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 483/509 (94.89%), Postives = 488/509 (95.87%), Query Frame = 3
Query:  159 MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 1685
            MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKD GLNLTPECPNS+ +KVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGY+NALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNT GM INAIFIVAISYIG                 T+NSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRK+WQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI
Sbjct:    1 MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDPGLNLTPECPNSNLSKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYVNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTVGMTINAIFIVAISYIGW----------------TSNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKQWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIEIEDQNI 493          
BLAST of slc17a-3 vs. Planmine SMEST
Match: SMESG000060615.1 (SMESG000060615.1)

HSP 1 Score: 291.967 bits (746), Expect = 6.146e-91
Identity = 178/485 (36.70%), Postives = 284/485 (58.56%), Query Frame = 3
Query:  261 KEKWYNRF--CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLG---------LNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKW-FFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNV-----PWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCD-KVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            KE+   ++  C   R ++A+ GF+G   +Y++R+NLSV IL M N++A+  +           N+T         +  KDG+ VW +  + ++LG FFWGY+  QIPAG +  +   KW  FG  +L +SL  + TP+AAR   G+++ LR++ G    + +P+++ +   WAP  + + + G+  SG   G  + L  +  L E    GGWPS+FY  G+ GI+W I+W+F+ + TP++HP I+  EK +IE S+     + + NV     PW++I  S P WAI+V N    W+ YT +TS P Y + VL F+++QNG+++A PY+   I  +    + DI++ RK LS T  RKL N  GM+   + +V ++Y+ C+ + L V  L I ++  +    G  VNH+D+APQYAG+L+G+TN++    G      VG +T + +    W+IVF++ S I + GAIF+LIFGSG  QSWAI+ ++
Sbjct:    2 KEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMMALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNS-WRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTK 484          
BLAST of slc17a-3 vs. Planmine SMEST
Match: SMESG000060615.1 (SMESG000060615.1)

HSP 1 Score: 291.967 bits (746), Expect = 6.351e-91
Identity = 178/485 (36.70%), Postives = 284/485 (58.56%), Query Frame = 3
Query:  261 KEKWYNRF--CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLG---------LNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKW-FFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNV-----PWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCD-KVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            KE+   ++  C   R ++A+ GF+G   +Y++R+NLSV IL M N++A+  +           N+T         +  KDG+ VW +  + ++LG FFWGY+  QIPAG +  +   KW  FG  +L +SL  + TP+AAR   G+++ LR++ G    + +P+++ +   WAP  + + + G+  SG   G  + L  +  L E    GGWPS+FY  G+ GI+W I+W+F+ + TP++HP I+  EK +IE S+     + + NV     PW++I  S P WAI+V N    W+ YT +TS P Y + VL F+++QNG+++A PY+   I  +    + DI++ RK LS T  RKL N  GM+   + +V ++Y+ C+ + L V  L I ++  +    G  VNH+D+APQYAG+L+G+TN++    G      VG +T + +    W+IVF++ S I + GAIF+LIFGSG  QSWAI+ ++
Sbjct:    5 KEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMMALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNS-WRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTK 487          
BLAST of slc17a-3 vs. Planmine SMEST
Match: SMESG000060615.1 (SMESG000060615.1)

HSP 1 Score: 291.967 bits (746), Expect = 7.198e-91
Identity = 178/485 (36.70%), Postives = 284/485 (58.56%), Query Frame = 3
Query:  261 KEKWYNRF--CIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLG---------LNLTPECPNSDSAKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKW-FFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYXXXXXXXXXXXXXXXXAFSTPANHPRITMTEKRFIESSVNLSSEERHSNV-----PWKSILLSLPVWAISVANFCSMWXXXXXXXXXXXXFEHVLGFSIAQNGYLNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCD-KVLVVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 1661
            KE+   ++  C   R ++A+ GF+G   +Y++R+NLSV IL M N++A+  +           N+T         +  KDG+ VW +  + ++LG FFWGY+  QIPAG +  +   KW  FG  +L +SL  + TP+AAR   G+++ LR++ G    + +P+++ +   WAP  + + + G+  SG   G  + L  +  L E    GGWPS+FY  G+ GI+W I+W+F+ + TP++HP I+  EK +IE S+     + + NV     PW++I  S P WAI+V N    W+ YT +TS P Y + VL F+++QNG+++A PY+   I  +    + DI++ RK LS T  RKL N  GM+   + +V ++Y+ C+ + L V  L I ++  +    G  VNH+D+APQYAG+L+G+TN++    G      VG +T + +    W+IVF++ S I + GAIF+LIFGSG  QSWAI+ ++
Sbjct:    5 KEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMMALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNS-WRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTK 487          
The following BLAST results are available for this feature:
BLAST of slc17a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A54.926e-11146.04solute carrier family 17 member 5 [Source:HGNC Sym... [more]
SLC17A61.295e-10241.09solute carrier family 17 member 6 [Source:HGNC Sym... [more]
SLC17A72.956e-10240.09solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A83.910e-10239.37solute carrier family 17 member 8 [Source:HGNC Sym... [more]
SLC17A71.439e-9840.00solute carrier family 17 member 7 [Source:HGNC Sym... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc-17.22.208e-8037.87Uncharacterized transporter slc-17.2 [Source:UniP... [more]
slc-17.11.395e-7735.20SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-17.11.393e-7634.41SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
eat-41.195e-7033.68Probable vesicular glutamate transporter eat-4 [S... [more]
eat-42.481e-7033.68Probable vesicular glutamate transporter eat-4 [S... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFS101.826e-10941.48gene:FBgn0030452 transcript:FBtr0339677[more]
MFS101.826e-10941.48gene:FBgn0030452 transcript:FBtr0073724[more]
MFS101.826e-10941.48gene:FBgn0030452 transcript:FBtr0339678[more]
Picot1.989e-9238.91gene:FBgn0024315 transcript:FBtr0087115[more]
Picot6.339e-9139.52gene:FBgn0024315 transcript:FBtr0340067[more]
back to top
BLAST of slc17a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a55.583e-11445.38solute carrier family 17 member 5 [Source:ZFIN;Acc... [more]
slc17a82.801e-10439.46solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a86.839e-10439.46solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a6b6.687e-10141.21solute carrier family 17 member 6b [Source:NCBI ge... [more]
slc17a6a1.095e-9940.48solute carrier family 17 member 6a [Source:NCBI ge... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A87.826e-10539.48solute carrier family 17 (vesicular glutamate tran... [more]
SLC17A89.276e-10540.20solute carrier family 17 (vesicular glutamate tran... [more]
SLC17A81.342e-10439.32solute carrier family 17 (vesicular glutamate tran... [more]
lrpap11.761e-10438.90LDL receptor related protein associated protein 1 ... [more]
SLC17A84.202e-10439.53solute carrier family 17 (vesicular glutamate tran... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc17a82.073e-10340.66solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a78.762e-10340.30solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a61.304e-10240.87solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a74.049e-10239.54solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a52.252e-9844.08solute carrier family 17 (anion/sugar transporter)... [more]
back to top
BLAST of slc17a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NRA2|S17A5_HUMAN2.366e-11046.04Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=... [more]
sp|Q9MZD1|S17A5_SHEEP8.349e-10545.82Sialin OS=Ovis aries OX=9940 GN=SLC17A5 PE=2 SV=1[more]
sp|Q1L8X9|VGLU3_DANRE2.115e-10339.46Vesicular glutamate transporter 3 OS=Danio rerio O... [more]
sp|Q8BFU8|VGLU3_MOUSE1.450e-10240.66Vesicular glutamate transporter 3 OS=Mus musculus ... [more]
sp|A4FV52|VGLU1_BOVIN3.204e-10240.30Vesicular glutamate transporter 1 OS=Bos taurus OX... [more]
back to top
BLAST of slc17a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ160.000e+0100.00Slc17a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A3Q0K7N27.406e-12846.08sialin OS=Ciona intestinalis OX=7719 GN=LOC1001873... [more]
A0A2C9JWM34.290e-12644.81MFS domain-containing protein OS=Biomphalaria glab... [more]
A0A0B7A1X24.763e-12646.73MFS domain-containing protein OS=Arion vulgaris OX... [more]
F7ANS19.301e-12645.40MFS domain-containing protein OS=Ciona intestinali... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-513e17.16.610e-10743.15sialin-like [Source:NCBI gene;Acc:103042153][more]
slc17a81.472e-10341.51solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a81.064e-10241.40solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a6b1.514e-10140.04vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6b3.114e-10140.04vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc17a6b2.169e-7335.74solute carrier family 17 member 6b [Source:NCBI ge... [more]
ENSPMAT00000010352.11.085e-6545.49pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc17a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455141.276e-11145.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463661.871e-9540.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317049.347e-9538.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486713.529e-8839.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317123.029e-8238.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc17a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a53.468e-11445.41solute carrier family 17 member 5 [Source:NCBI gen... [more]
ENSORLT00000010015.28.561e-10238.98vesicular glutamate transporter 1-like [Source:NCB... [more]
slc17a81.205e-10141.09vesicular glutamate transporter 3 [Source:NCBI gen... [more]
slc17a6a1.279e-10139.70solute carrier family 17 member 6 [Source:NCBI gen... [more]
ENSORLT00000010014.21.627e-10138.26vesicular glutamate transporter 1-like [Source:NCB... [more]
back to top
BLAST of slc17a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066847.10.000e+098.04SMESG000066847.1[more]
SMESG000066847.10.000e+094.89SMESG000066847.1[more]
SMESG000060615.16.146e-9136.70SMESG000060615.1[more]
SMESG000060615.16.351e-9136.70SMESG000060615.1[more]
SMESG000060615.17.198e-9136.70SMESG000060615.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029814
GenBankAKN21526.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029814 ID=SMED30029814|Name=slc17a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2012bp
GTAATAAATAAAAATAGTAACATATATGATGCTAATATGAATCAATCATG
CATACACAGTGATGAGATCGATTTTGTGTCATAATTCAATGAGTTGCACC
ATATTTCACGTGATCAGTTCACTATTGATTCTGTTGCACAATAAAACGGA
ATAATTCGATGACAGACAAATCAAATCTTTTGAATGTTTCAAATCTACGA
ATCAATTATTACACCTCGAATGAGAACTATGACAATCTAGACGAGAATTC
TGAAAGTCCTAAAGAAAAATGGTATAACCGATTCTGCATACCTACGAGAT
ATGTAATTGCCGTTTGGGGATTTTTGGGATTCGCAGTCGTTTATGCTCTT
AGAGTCAATCTCAGCGTTGCTATTCTTGCCATGGTGAACAATTCAGCAAT
TAAAGACTTGGGATTAAATCTGACTCCTGAGTGCCCTAATTCTGATTCAG
CGAAAGTCACGAAAGACGGAGAATTTGTTTGGGATCAGAACATTCAAGGG
TTGGTACTTGGAGCGTTTTTTTGGGGATATATACCACTTCAAATTCCAGC
TGGAGCTATTGCTGTTAAAGTAGGAGGAAAATGGTTCTTTGGAATAGGAG
TTTTGTGGACATCGTTACTAACATTATTGACACCTGTAGCTGCAAGACTG
GGCTATGGATGGCTAATTGGGTTGAGAATTTTAGAGGGGGCAGGAGAGAG
CATCACTTATCCAGCCATGCATACAATGTTGGGCTACTGGGCTCCTGTAA
TGGAAACTACATTTATTGGTGGAATTGTTTACTCTGGAAGTTTTGCAGGT
TTGGTTATAGGATTATTGGCTTCTGCACAATTGATTGAATCCAATGTAAT
GGGGGGATGGCCATCTGTTTTCTATATACCTGGAATTATCGGTATTGTAT
GGTTTATTATATGGTCTTTCGTTGCCTTCAGTACTCCTGCAAACCACCCG
AGAATAACCATGACTGAAAAAAGATTCATTGAATCTTCCGTAAACCTCTC
CAGTGAAGAAAGACATTCAAATGTTCCTTGGAAATCCATCTTATTATCGT
TGCCGGTTTGGGCAATCTCAGTGGCAAACTTTTGTTCCATGTGGTCATTA
TATACTTTACTGACAAGCTTACCTCTATATTTCGAGCATGTTCTTGGCTT
TTCTATCGCTCAAAATGGATATCTAAATGCTTTACCGTACTTATTAAGTG
CGATCGTATTCGTCGTTTCTGGGAAAATAGCTGATATTATTAGGTCACGA
AAATGGTTATCCACTACTGTCACAAGGAAACTTTTTAATACCTTTGGGAT
GATGATTAACGCAATATTTATTGTAGCAATTAGCTACATTGGATGTGATA
AAGTTCTAGTGGTCACTTTCCTTTGCATTGCTGTTGCTTTAGGGACCACA
AATTCTGCAGGTTACAATGTGAATCACATTGATCTTGCACCCCAGTATGC
TGGTGTTTTATATGGAATCACAAATTCAATAGCTACAGTTGCTGGTATAA
TAGGGCCTTCTGTTGTTGGGGTGCTAACTAACCATCAAGAAACAAGAAAG
CGGTGGCAAATCGTCTTTTATATTTCTTCGGCGATAACTTTATTTGGTGC
AATATTTTTCCTAATTTTCGGATCAGGAGACCGGCAAAGTTGGGCAATTG
AAAAATCAGAAATTGAAATTGAAGATCAGAATATATAAGTTATGTGAAAT
ACCATTCATTCTGTGATTATATAATTAATTAAAATAATTATTTACTTTTT
TTTTATATTTATCGATTTTTTGTTAGGTTAGAGCAGGGATTACCAATCCA
CATCCAATGGGTCGAATGTAGCCCGTCGTGTGTGATTTTGCAACTCTCAA
GATTTAACACAATTTCACAAAATTATTTTATTATATTTTTATGACTTTAT
GGAGGTGTAATCGTGACGAAGACCGGCAATATCAACTACAATGTACAATA
GTTAAGATATTTAAAATATCTTGTGTATAAATGATTGATTATTAGTATTT
TTTATGAAATTG
back to top

protein sequence of SMED30029814-orf-1

>SMED30029814-orf-1 ID=SMED30029814-orf-1|Name=SMED30029814-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=510bp
MTDKSNLLNVSNLRINYYTSNENYDNLDENSESPKEKWYNRFCIPTRYVI
AVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDLGLNLTPECPNSDSAKV
TKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLW
TSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMET
TFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFI
IWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPV
WAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYLNALPYLLSAIV
FVVSGKIADIIRSRKWLSTTVTRKLFNTFGMMINAIFIVAISYIGCDKVL
VVTFLCIAVALGTTNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGP
SVVGVLTNHQETRKRWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKS
EIEIEDQNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005313L-glutamate transmembrane transporter activity
GO:0015293symporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000053distal tubule
PLANA:0000070intestinal phagocyte
PLANA:0000087proximal tubule
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0043005neuron projection
GO:0045202synapse
GO:0016020membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0050803regulation of synapse structure or activity
GO:0050957equilibrioception
GO:0060005vestibular reflex
GO:0089711L-glutamate transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006814sodium ion transport
GO:0006836neurotransmitter transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 55..450
e-value: 7.6E-49
score: 166.5
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 45..267
e-value: 9.3E-32
score: 112.0
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 286..494
e-value: 4.1E-35
score: 122.9
NoneNo IPR availablePANTHERPTHR11662:SF427FI19708P1coord: 44..498
NoneNo IPR availablePANTHERPTHR11662SODIUM-DEPENDENT PHOSPHATE TRANSPORTERScoord: 44..498
NoneNo IPR availableCDDcd17318MFS_SLC17coord: 51..488
e-value: 3.19704E-151
score: 435.51
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 468..490
NoneNo IPR availableTMHMMTMhelixcoord: 295..317
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 375..394
NoneNo IPR availableTMHMMTMhelixcoord: 399..418
NoneNo IPR availableTMHMMTMhelixcoord: 332..354
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 55..492
score: 19.736
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 36..489