Tyrosine-protein kinase receptor

Overview
NameTyrosine-protein kinase receptor
Smed IDSMED30029811
Length (bp)2984
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase receptor (SMED30029811) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase receptor (SMED30029811) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase receptor (SMED30029811) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase receptor (SMED30029811) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029811

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30029811SMESG000041792.1 dd_Smed_v4_7911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029811SMESG000041792.1 dd_Smed_v4_7911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029811SMESG000041792.1 dd_Smed_v4_7911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029811SMESG000041792.1 dd_Smed_v4_7911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029811SMESG000041792.1 dd_Smed_v4_7911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029811SMESG000041792.1 dd_Smed_v6_7911_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30029811SMESG000041792.1 SMED30029811smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30029811SMESG000041792.1 SMED30029811smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30029811SMESG000041792.1 OX_Smed_1.0.19365ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
ventral epidermis progenitor cellSMED30029811SMESG000041792.1 dd_Smed_v4_7911_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: ROR1 (receptor tyrosine kinase like orphan receptor 1 [Source:HGNC Symbol;Acc:HGNC:10256])

HSP 1 Score: 440.654 bits (1132), Expect = 3.524e-139
Identity = 264/751 (35.15%), Postives = 396/751 (52.73%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXS---RSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFT-SVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            YL L++ + N+T  +G+   L C +SG P PTI W K   P+V    ++  R +++GS L+I +LD +D G++ C A N              +  SS   + V+           S      G+CQ ++  +C +++    VY+    +Q E E +I +    I +  S     +C +  +   CH  F  C E     KPR LC+++CE +    C   Y       ++L +LK      +P CE L   +      C R     A P+      K + CYN TG +Y GTVS T  G  C  W +            F ++   ++YCRNP      Q++APWCFT       ++C +  C    S   +  +     +P  ++I   I  +   I +C   +KS         S  + R+       P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   EF+QEA +M+EL H N++ L+G   ++ P C++F+++ +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNILIGE L  KISD+GL ++ YS+DYYR    +L LPIRWM PEAI +G+F+ +SD+W++GV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECWNE+P  RP+FK+IH R+R W+
Sbjct:    2 YLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNG------------KEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLK------LPNCEDLPQPESPEAANCIRIGIPMADPIN-----KNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNP----GNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPS-VAIPLAIALLFFFICVCRNNQKSS--------SAPVQRQ-------PKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYINQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSL-LPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWE 695          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: ROR1 (receptor tyrosine kinase like orphan receptor 1 [Source:HGNC Symbol;Acc:HGNC:10256])

HSP 1 Score: 441.425 bits (1134), Expect = 6.205e-139
Identity = 264/753 (35.06%), Postives = 397/753 (52.72%), Query Frame = 3
Query:  345 EGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXS---RSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFT-SVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            + YL L++ + N+T  +G+   L C +SG P PTI W K   P+V    ++  R +++GS L+I +LD +D G++ C A N              +  SS   + V+           S      G+CQ ++  +C +++    VY+    +Q E E +I +    I +  S     +C +  +   CH  F  C E     KPR LC+++CE +    C   Y       ++L +LK      +P CE L   +      C R     A P+      K + CYN TG +Y GTVS T  G  C  W +            F ++   ++YCRNP      Q++APWCFT       ++C +  C    S   +  +     +P  ++I   I  +   I +C   +KS         S  + R+       P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   EF+QEA +M+EL H N++ L+G   ++ P C++F+++ +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNILIGE L  KISD+GL ++ YS+DYYR    +L LPIRWM PEAI +G+F+ +SD+W++GV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECWNE+P  RP+FK+IH R+R W+
Sbjct:   55 DSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNG------------KEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLK------LPNCEDLPQPESPEAANCIRIGIPMADPIN-----KNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNP----GNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPS-VAIPLAIALLFFFICVCRNNQKSS--------SAPVQRQ-------PKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYINQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSL-LPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWE 750          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: ROR2 (receptor tyrosine kinase like orphan receptor 2 [Source:HGNC Symbol;Acc:HGNC:10257])

HSP 1 Score: 423.705 bits (1088), Expect = 3.616e-132
Identity = 256/746 (34.32%), Postives = 384/746 (51.47%), Query Frame = 3
Query:  336 PQFEGY-LKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITG-NSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            P  +GY L   + + N+T   G+   L C ++G P P + W K   P+V    +I IR++ +GS L+I+DLD +D G+Y C A N       T  + V    +                 ++    G+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S     +C +  +   CH  F +C   S   KPR LC+++CE +    C   Y +          + +PKCE L      +   C R   +PA  +      + + CYNG+G +Y GT S T  G  C  W          +   F ++   + YCRNP      Q + PWCFT     R E+C V  C    SP  S        L   I+I  VI  +   + +C   +K+   T          R+  +    P Q+     E  L+  +K +    +  LS +RF E++GE  FG VYK  L G     P  G  +  V +KTL   +   L+ EF+ EA + + L+H NV+ L+GV  +  P  +IF +   GDLHE L+  +       S V +   D      L   D + + AQIA+GMEYLSS   VH+DLA RN+L+ + L  KISD+GL ++ Y++DYY+  G++L LPIRWM+PEAI +G+F+++SD+W+YGV+LWE++S GLQP+ G+SN +V+E++R+RQ+L CPD+CP  VY LM+ECWNE P  RP+FK+IHSR+R W
Sbjct:   55 PTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTH---------SPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGT--STHLSDQCSQFAIPSFCHFVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIG-IPAERLG-----RYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNP----GGQMEGPWCFTQNKNVRMELCDVPSC----SPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTP--------QRRQLMA--SPSQD----MEMPLINQHK-QAKLKEISLSAVRFMEELGEDRFGKVYKGHLFG-----PAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPH-----SDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSL-LPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAW 749          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: ROR2 (receptor tyrosine kinase like orphan receptor 2 [Source:HGNC Symbol;Acc:HGNC:10257])

HSP 1 Score: 376.711 bits (966), Expect = 4.440e-117
Identity = 222/620 (35.81%), Postives = 329/620 (53.06%), Query Frame = 3
Query:  711 GYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITG-NSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            G+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S     +C +  +   CH  F +C   S   KPR LC+++CE +    C   Y +          + +PKCE L      +   C R   +PA  +      + + CYNG+G +Y GT S T  G  C  W          +   F ++   + YCRNP      Q + PWCFT     R E+C V  C    SP  S        L   I+I  VI  +   + +C   +K+   T          R+  +    P Q+     E  L+  +K +    +  LS +RF E++GE  FG VYK  L G     P  G  +  V +KTL   +   L+ EF+ EA + + L+H NV+ L+GV  +  P  +IF +   GDLHE L+  +       S V +   D      L   D + + AQIA+GMEYLSS   VH+DLA RN+L+ + L  KISD+GL ++ Y++DYY+  G++L LPIRWM+PEAI +G+F+++SD+W+YGV+LWE++S GLQP+ G+SN +V+E++R+RQ+L CPD+CP  VY LM+ECWNE P  RP+FK+IHSR+R W
Sbjct:   32 GFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGT--STHLSDQCSQFAIPSFCHFVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIG-IPAERLG-----RYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNP----GGQMEGPWCFTQNKNVRMELCDVPSC----SPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTP--------QRRQLMA--SPSQD----MEMPLINQHK-QAKLKEISLSAVRFMEELGEDRFGKVYKGHLFG-----PAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPH-----SDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSL-LPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAW 609          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: MUSK (muscle associated receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:7525])

HSP 1 Score: 270.396 bits (690), Expect = 5.508e-77
Identity = 145/352 (41.19%), Postives = 212/352 (60.23%), Query Frame = 3
Query: 1449 FVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPAD---SMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIH 2495
            FV++TI+  + C++ K   N    S  +T  +        +         +  L   K+ S +YP + I +   IGEG FG V++A   G     P T    +V VK L   +S  +Q +F++EA +M+E  + N++ L+GV     P CL+F++M  GDL+E L S +   V S+S         + + G   LS  +Q+ IA Q+A+GM YLS R FVHRDLA RN L+GEN++ KI+D GL ++ YS+DYY+   +   +PIRWM PE+I + R+T ESDVWAYGV+LWEI+S GLQP+YG ++ EV+  VR   ILSCP+NCP ++Y+LM  CW+++P  RP F +IH
Sbjct:  421 FVLLTITTLYCCRRRKQWKNKKRESAAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFT----MVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANEND-AIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSFTSIH 767          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 242.276 bits (617), Expect = 1.325e-67
Identity = 125/289 (43.25%), Postives = 171/289 (59.17%), Query Frame = 3
Query: 1647 SQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            SQ+  +E+IGEG FG V+     G   +         V VK     ++   + + +QE + ++   H NV+ L+GV         +F++M  GDLHELL          +   PAD     G +T +  + ++IA QIA GMEYL+S SFVHRDLA RN L+G+    KI+D GL++  Y SDYY+    + M P+RWMS EAI  GRF+  SDVW++GV LWEIWS G QP+ G SN +V+ELV +R +L CP NCPT +Y LM+ECW+E    RP F  I SR++ W
Sbjct:  429 SQLSVREKIGEGQFGVVHS----GIYTSGLFAPEPMAVAVKKCRHDATNAERAQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHGDLHELL---------KVRVPPADH--DMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFGLMRTSYGSDYYKMLHRSWM-PVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGRQPYEGASNQQVIELVANRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSW 701          

HSP 2 Score: 88.1965 bits (217), Expect = 1.607e-17
Identity = 68/248 (27.42%), Postives = 108/248 (43.55%), Query Frame = 3
Query:  711 GYCQTFQSSSCGKYLSGHMVYVTHGRVQA----EKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPR--RLCQEDCEDVTKKRCNYTYKLMLQ-KLKKDYLVSV-PKCEKLHNNQGCFRF--NELPAVPVK--TKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK-------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNK 1397
            G C  ++  +C +YLS   V +T+   +     ++  R A L    +  +SQ+    C +    + CH  + +C  D   +   +C+ DC+ +    C     L  Q +L  D   ++ P C +L +   C       L + PV    +  L  + CY  +G +Y GTV+QT  G  C  W        NV  F +++   NYCRNP      ++  PWC++   G  E C V QC  D  P  +D K
Sbjct:   44 GDCVQYRGEACRQYLSNKFVMMTNESREEMYDIDRNLRAAMLFINGAPTISQK----CRQLSQAVACHHMYKVCESDSNNQIVSICKHDCDVIQNDECPSELALAAQHELVGDTPKALFPLCSRLSSTSNCIPVMSTALQSSPVAEVNRGHLTHW-CYVNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSKNYCRNP----GGKKSRPWCYSKPMGQEEYCDVPQCPSDMYPHLNDKK 282          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 243.047 bits (619), Expect = 4.973e-67
Identity = 125/289 (43.25%), Postives = 171/289 (59.17%), Query Frame = 3
Query: 1647 SQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            SQ+  +E+IGEG FG V+     G   +         V VK     ++   + + +QE + ++   H NV+ L+GV         +F++M  GDLHELL          +   PAD     G +T +  + ++IA QIA GMEYL+S SFVHRDLA RN L+G+    KI+D GL++  Y SDYY+    + M P+RWMS EAI  GRF+  SDVW++GV LWEIWS G QP+ G SN +V+ELV +R +L CP NCPT +Y LM+ECW+E    RP F  I SR++ W
Sbjct:  562 SQLSVREKIGEGQFGVVHS----GIYTSGLFAPEPMAVAVKKCRHDATNAERAQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHGDLHELL---------KVRVPPADH--DMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFGLMRTSYGSDYYKMLHRSWM-PVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGRQPYEGASNQQVIELVANRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSW 834          

HSP 2 Score: 88.1965 bits (217), Expect = 1.679e-17
Identity = 68/248 (27.42%), Postives = 108/248 (43.55%), Query Frame = 3
Query:  711 GYCQTFQSSSCGKYLSGHMVYVTHGRVQA----EKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPR--RLCQEDCEDVTKKRCNYTYKLMLQ-KLKKDYLVSV-PKCEKLHNNQGCFRF--NELPAVPVK--TKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK-------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNK 1397
            G C  ++  +C +YLS   V +T+   +     ++  R A L    +  +SQ+    C +    + CH  + +C  D   +   +C+ DC+ +    C     L  Q +L  D   ++ P C +L +   C       L + PV    +  L  + CY  +G +Y GTV+QT  G  C  W        NV  F +++   NYCRNP      ++  PWC++   G  E C V QC  D  P  +D K
Sbjct:  177 GDCVQYRGEACRQYLSNKFVMMTNESREEMYDIDRNLRAAMLFINGAPTISQK----CRQLSQAVACHHMYKVCESDSNNQIVSICKHDCDVIQNDECPSELALAAQHELVGDTPKALFPLCSRLSSTSNCIPVMSTALQSSPVAEVNRGHLTHW-CYVNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSKNYCRNP----GGKKSRPWCYSKPMGQEEYCDVPQCPSDMYPHLNDKK 415          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 242.662 bits (618), Expect = 7.906e-67
Identity = 125/289 (43.25%), Postives = 171/289 (59.17%), Query Frame = 3
Query: 1647 SQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            SQ+  +E+IGEG FG V+     G   +         V VK     ++   + + +QE + ++   H NV+ L+GV         +F++M  GDLHELL          +   PAD     G +T +  + ++IA QIA GMEYL+S SFVHRDLA RN L+G+    KI+D GL++  Y SDYY+    + M P+RWMS EAI  GRF+  SDVW++GV LWEIWS G QP+ G SN +V+ELV +R +L CP NCPT +Y LM+ECW+E    RP F  I SR++ W
Sbjct:  588 SQLSVREKIGEGQFGVVHS----GIYTSGLFAPEPMAVAVKKCRHDATNAERAQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHGDLHELL---------KVRVPPADH--DMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFGLMRTSYGSDYYKMLHRSWM-PVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGRQPYEGASNQQVIELVANRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSW 860          

HSP 2 Score: 88.1965 bits (217), Expect = 1.787e-17
Identity = 68/248 (27.42%), Postives = 108/248 (43.55%), Query Frame = 3
Query:  711 GYCQTFQSSSCGKYLSGHMVYVTHGRVQA----EKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPR--RLCQEDCEDVTKKRCNYTYKLMLQ-KLKKDYLVSV-PKCEKLHNNQGCFRF--NELPAVPVK--TKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK-------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNK 1397
            G C  ++  +C +YLS   V +T+   +     ++  R A L    +  +SQ+    C +    + CH  + +C  D   +   +C+ DC+ +    C     L  Q +L  D   ++ P C +L +   C       L + PV    +  L  + CY  +G +Y GTV+QT  G  C  W        NV  F +++   NYCRNP      ++  PWC++   G  E C V QC  D  P  +D K
Sbjct:  203 GDCVQYRGEACRQYLSNKFVMMTNESREEMYDIDRNLRAAMLFINGAPTISQK----CRQLSQAVACHHMYKVCESDSNNQIVSICKHDCDVIQNDECPSELALAAQHELVGDTPKALFPLCSRLSSTSNCIPVMSTALQSSPVAEVNRGHLTHW-CYVNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSKNYCRNP----GGKKSRPWCYSKPMGQEEYCDVPQCPSDMYPHLNDKK 441          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 172.94 bits (437), Expect = 9.724e-46
Identity = 104/293 (35.49%), Postives = 154/293 (52.56%), Query Frame = 3
Query: 1653 IRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRT-TGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDV 2528
            +R   QIG G FG V++      N N P       V VK L AG++     +F  EAQ+M +L+H  +LSL  V  R  P  ++ + M++  L  L       ++  +                     + I+AQ+A+GM YL   +F+HRDLAARNILI  +L  KI+D GL +     + Y   TG+    PI+W +PEA  + RFT +SDVW++G+LL EI + G  P+ G +NAEV++ V +   + CP  CP  +YD+M +CW   P  RP F+ +      W+ ED+
Sbjct:  240 VRLIRQIGAGQFGEVWEGRW---NVNVP-------VAVKKLKAGTADPT--DFLAEAQIMKKLRHPKLLSLYAVCTRDEPILIVTELMQENLLTFLQRRGRQCQMPQL---------------------VEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARILMKENEYEARTGAR--FPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRPTFETLQ-----WKLEDL 492          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 169.859 bits (429), Expect = 7.190e-45
Identity = 99/291 (34.02%), Postives = 155/291 (53.26%), Query Frame = 3
Query: 1641 PLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENL----MCKISDIGLIKDCYSSDYYRT-TGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVY-DLMLECWNEMPRYRPQFKNIH 2495
            P +Q+  + ++G+G FG V+  +  G             V +KT+  G+       F QEAQ+M +  H N++ L  V  R+ P+ +I ++M  G L + L ++ +                    TL     + +AAQIA+GM YL  R  VHRDLAARN+L+G+ +    + K++D GL +     D Y   TG+    PI+W +PEA   G FTV+SDVW+YG+LL+EI + G  P+ G  N EV+E V     +  P  CP ++Y +++L+CW++ P  RP F  ++
Sbjct:  202 PRNQLHLKRKLGDGNFGEVWYGKWRGIVE----------VAIKTMKPGTMSP--EAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGS--------------------TLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKF--PIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCWDKTPDRRPTFDTLY 458          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Ror (gene:FBgn0010407 transcript:FBtr0079978)

HSP 1 Score: 299.286 bits (765), Expect = 9.953e-89
Identity = 144/309 (46.60%), Postives = 209/309 (67.64%), Query Frame = 3
Query: 1593 SSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQ 2519
            S L++ N + +    + L  + F E++GEG FG VYK +L+  N  + IT     V +K L   +SVK Q +FK+E +++S+LKH N++ ++GV + + P+C++F++M  GDLHE LISN+  E +S+S +                + + IA QI+ GM+YLS+  +VHRDLAARN L+ E L+ KISD GL +D YSSDYYR    +L LP+RWM  E+I +G+FT ESDVW++GV+LWEI+S G+QP+YG SN EV+ L+RSRQ+LS P+NCPT VY LM+ECW+E    RP F +I +R++ W +
Sbjct:  391 SKLIERNTL-LRINHFTLQDVEFLEELGEGAFGKVYKGQLLQPNKTT-IT-----VAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPTEGKSLSQL----------------EFLQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSL-LPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYSLMIECWHEQSVKRPTFTDISNRLKTWHE 675          

HSP 2 Score: 54.299 bits (129), Expect = 5.414e-7
Identity = 33/116 (28.45%), Postives = 52/116 (44.83%), Query Frame = 3
Query: 1032 LVSVPKCEKLHNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTW----KNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR--EVCSVRQC 1361
            +V V  C+KL  ++ C        V        K  +CY   G  Y G  + +  G PC+ W    K +  F +++   NYCRN    P   +++PWCF   +  R  E+C + +C
Sbjct:  207 MVGVEDCQKLPQHKDCLSLGITIEVD-------KTENCYWEDGSTYRGVANVSASGKPCLRWSWLMKEISDFPELIGQ-NYCRN----PGSVENSPWCFVDSSRERIIELCDIPKC 310          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Nrk (gene:FBgn0020391 transcript:FBtr0087728)

HSP 1 Score: 271.552 bits (693), Expect = 2.866e-78
Identity = 199/667 (29.84%), Postives = 302/667 (45.28%), Query Frame = 3
Query:  711 GYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIAS-----LVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVS------VPKCEKL-HNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN-VPG--------FEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDN----KSFRNFLPVYISIGCVIGFVIMT---ISICWICKKSK------------------FGTNGSCHSNGLTRKSYLG-------------------IYKPCQNDCKKSESSLVQLNK--IKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIR 2507
            GYC  +    C +YL+G + Y         K  ++ +     L+++++  L ++A ++ L       CH    M         LC EDC+    + C   + L+ +K +++  +       +P C  L H N    R N       + K     YDC NG GR Y+GT++ +  G PC  W    P         F  ++   NYCRN   E    +  PWC+T     R + C +  C     P+  D     K  + F P  I +   IGFV +    + I  + K SK                      G C  N  T +  LG                   I+  C      +  S  +  K   ++   +YP   I +   +G+G FG V++A   G   +        +V VK L   +S ++Q +F++EA +++E  H N++ L+GV     P CL+F++M  GDL E L        R+ S            + L+    + +AA IA+GM YLS R FVHRDLA RN LI E++  KI+D GL    Y  DYY+   +   +PIRWM  E+I + +F++ESDVWAYG+ LWE++S  LQP++G ++ EV++ ++   +L CPDN P  VY LM  CWN  P  RP F  I+  I+
Sbjct:   68 GYCAPYSGKVCKEYLTGQVWYSLEDPTGGWKNEQVTTALWDELISDLTG-LCREAAEKMLCAYAFPNCH----MEGGRAVKAPLCFEDCQATHLQFCYNDWVLIEEKKERNMFIKSRGHFRLPNCSSLPHYNASMRRPNCSYIGLTELKESEVSYDCRNGNGRFYMGTMNVSKSGIPCQRWDTQYPHKHFQPPLVFHQLLEGENYCRNAGGE----EPHPWCYTVDESVRWQHCDIPMCPDYVDPNAVDLNTPIKMEKFFTPSMIFLLAGIGFVAIVTLHLMILLVYKLSKHKDYSQPAGAATAECSVSMRGGGDCGGNLNTSRETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKGTKPNARLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQ----EDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFL--------RACSPYATHQAPTQDRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKGDENDF-IPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEVIKYIKEGNVLGCPDNTPLSVYALMRRCWNRKPSERPGFAEINHCIQ 712          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Alk (gene:FBgn0040505 transcript:FBtr0087118)

HSP 1 Score: 199.904 bits (507), Expect = 7.478e-52
Identity = 108/306 (35.29%), Postives = 164/306 (53.59%), Query Frame = 3
Query: 1653 IRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILI---GENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEIN---PNCIG 2552
            ++    +G+G FG VY A     + ++   G    V VKTL      + + +F +EA +M++  H N++ L+GV   + P+ ++ + +  GDL + L  N     R+    P+          L+  D +F A  +A G  Y+ S+ F+HRD+AARN L+   G   + KI+D G+ +D Y SDYYR  G   MLPI+WM PEA   G FT ++DVW++G+LLWE++S G  P+ G  N +VMELV     L  P  CP  +Y +M +CWN  P  RP F  +   +    Q+   +N   PN +G
Sbjct: 1193 LQLVNALGKGAFGEVYMALYRHRDGDAVEMG----VAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLREN-----RNTPERPS---------LLTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKA-MLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMNAPLPNILG 1479          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Alk (gene:FBgn0040505 transcript:FBtr0331926)

HSP 1 Score: 199.904 bits (507), Expect = 7.478e-52
Identity = 108/306 (35.29%), Postives = 164/306 (53.59%), Query Frame = 3
Query: 1653 IRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILI---GENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEIN---PNCIG 2552
            ++    +G+G FG VY A     + ++   G    V VKTL      + + +F +EA +M++  H N++ L+GV   + P+ ++ + +  GDL + L  N     R+    P+          L+  D +F A  +A G  Y+ S+ F+HRD+AARN L+   G   + KI+D G+ +D Y SDYYR  G   MLPI+WM PEA   G FT ++DVW++G+LLWE++S G  P+ G  N +VMELV     L  P  CP  +Y +M +CWN  P  RP F  +   +    Q+   +N   PN +G
Sbjct: 1193 LQLVNALGKGAFGEVYMALYRHRDGDAVEMG----VAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLREN-----RNTPERPS---------LLTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKA-MLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMNAPLPNILG 1479          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0301285)

HSP 1 Score: 189.504 bits (480), Expect = 6.146e-49
Identity = 110/285 (38.60%), Postives = 152/285 (53.33%), Query Frame = 3
Query: 1653 IRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCY-SSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRI 2504
            I  +  IG G FG V +  L       P       V +KTL  GSS K + +F  EA +M +  H NV+ L GV  R  P  +I ++ME G L   L  N                    D        I +   IASGM YLS  ++VHRDLAARN+L+   L+CKI+D GL ++   +SD Y T G  +  P+RW +PEAIAF +FT  SDVW+YGV+LWE+ S G +P++  SN +V++ +     L  P +CP  +Y LML+CW +   +RP F +I S +
Sbjct:  708 ITIEAIIGGGEFGDVCRGRL----KIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVN--------------------DGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDAYTTRGGKI--PVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTL 966          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: ror1 (receptor tyrosine kinase-like orphan receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6104])

HSP 1 Score: 454.521 bits (1168), Expect = 5.693e-144
Identity = 264/748 (35.29%), Postives = 405/748 (54.14%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHN-----NQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            +L+L+  + N+T  +G+   L C +SG P P++ W K   P+V    ++  R + +GS L+I++LD +D G++ C A N++G  +TT  +        +   P           E+   +G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S      C +  +   CH  F  C       KPR LC+++CE +    C   Y       L+L++LK      +PKCE L          C R      +P+  +   K + CYN +G +Y GTVS T  G  C  W +            + ++   ++YCRNP      + DAPWCFT     R E+C +  C      S S++      L   ++I   I  +   I +C   +K+             +R       KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   SS +  G+F+QEA +++EL H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + +A Q+A+GMEYL+S  F+H+DLAARNIL+GE L  KISD+GL ++ YSSDYYR   +TL LPIRWM PEAI +G+++ +SDVWA+GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP ++Y LM ECW E P  RP+FK+IH+R+R W+
Sbjct:   54 FLRLDAPMNNITTSLGQTAELHCHVSGTPSPSVRWLKNDAPVVQEPRRVSYRPTPYGSRLRIKNLDTTDTGYFQCVATNSYGTVSTTGILF-------VKFDPAPTPLPGRPSPEDFDEEGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNHLSDRCSQFAIPSLCHFAFPTCDRSSGMDKPRDLCKDECEILENDLCKTEYIIARSNPLILKRLK------LPKCEDLATLDSPEAANCMRI----GIPI-AETINKSHKCYNNSGSDYRGTVSVTKSGRQCQPWNSQYPHSHTFLAMRYPELNGGHSYCRNP----GNKHDAPWCFTLDEAVRMELCDIPPCDLPKHGSSSNSMGILYILVPSVAIPLAIALLFFFICVCRNNQKA-------------SRPPAPRQPKPVRG--QNVEMSMLTAYKPKSKAKELPLSAVRFMEELGESAFGKIYKGHLY-----LPGMEHAQLVAIKTLKDISSAQHWGDFQQEASVLAELHHPNVVCLLGVVTQEQPVCMLFEFLAQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHLAIQVAAGMEYLASHFFIHKDLAARNILVGEQLHIKISDLGLSREIYSSDYYRVQPNTL-LPIRWMPPEAIVYGKYSTDSDVWAFGVVLWEIFSFGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRMYALMTECWQEGPARRPRFKDIHTRLRAWE 750          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: ror1 (receptor tyrosine kinase-like orphan receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6104])

HSP 1 Score: 454.521 bits (1168), Expect = 7.070e-144
Identity = 264/748 (35.29%), Postives = 405/748 (54.14%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHN-----NQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            +L+L+  + N+T  +G+   L C +SG P P++ W K   P+V    ++  R + +GS L+I++LD +D G++ C A N++G  +TT  +        +   P           E+   +G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S      C +  +   CH  F  C       KPR LC+++CE +    C   Y       L+L++LK      +PKCE L          C R      +P+  +   K + CYN +G +Y GTVS T  G  C  W +            + ++   ++YCRNP      + DAPWCFT     R E+C +  C      S S++      L   ++I   I  +   I +C   +K+             +R       KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   SS +  G+F+QEA +++EL H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + +A Q+A+GMEYL+S  F+H+DLAARNIL+GE L  KISD+GL ++ YSSDYYR   +TL LPIRWM PEAI +G+++ +SDVWA+GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP ++Y LM ECW E P  RP+FK+IH+R+R W+
Sbjct:   63 FLRLDAPMNNITTSLGQTAELHCHVSGTPSPSVRWLKNDAPVVQEPRRVSYRPTPYGSRLRIKNLDTTDTGYFQCVATNSYGTVSTTGILF-------VKFDPAPTPLPGRPSPEDFDEEGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNHLSDRCSQFAIPSLCHFAFPTCDRSSGMDKPRDLCKDECEILENDLCKTEYIIARSNPLILKRLK------LPKCEDLATLDSPEAANCMRI----GIPI-AETINKSHKCYNNSGSDYRGTVSVTKSGRQCQPWNSQYPHSHTFLAMRYPELNGGHSYCRNP----GNKHDAPWCFTLDEAVRMELCDIPPCDLPKHGSSSNSMGILYILVPSVAIPLAIALLFFFICVCRNNQKA-------------SRPPAPRQPKPVRG--QNVEMSMLTAYKPKSKAKELPLSAVRFMEELGESAFGKIYKGHLY-----LPGMEHAQLVAIKTLKDISSAQHWGDFQQEASVLAELHHPNVVCLLGVVTQEQPVCMLFEFLAQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHLAIQVAAGMEYLASHFFIHKDLAARNILVGEQLHIKISDLGLSREIYSSDYYRVQPNTL-LPIRWMPPEAIVYGKYSTDSDVWAFGVVLWEIFSFGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRMYALMTECWQEGPARRPRFKDIHTRLRAWE 759          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: ror2 (receptor tyrosine kinase-like orphan receptor 2 [Source:ZFIN;Acc:ZDB-GENE-060427-5])

HSP 1 Score: 427.557 bits (1098), Expect = 8.424e-134
Identity = 259/779 (33.25%), Postives = 404/779 (51.86%), Query Frame = 3
Query:  246 LIIIVYMVFLNQPISGFTAKDIKQTDSKQP---PQFEGY-LKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQK-PRR--LCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK-NVPG--------FEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
             I      +    ++ F +++I+     Q    P  EGY L+  +   N+T   G+  TL C ++G PRP+I W K   P+V    ++ IR++  GS L+I+DLD +D G+Y C A N+    + T  + V        ++    +       + +  KG+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S Q   +C +  +   C+  F +C E  + PRR  LC+++CE +    CN  Y +          + +P C  L      +   C R      +P +  PP  ++ CYN +G  Y GTVS T  G  C  W    P         +  +   +N+CRNP      Q ++PWCFT     R ++C +  C   + P     +     +P   S+   + F  +   IC +C+  +  +  +     LT      +  P  N   K ++ L +LN          LS +RF E++GE  FG VYK  L G+         + +V +KT+       L+ EF+ EA + S L+H N++ L+GV  ++ P  +IF +  +GDLHE L+  +       S V +   D     TL   D + I  Q+A+GMEYLSS   VH+DLAARNIL+ + L  KI D+GL ++ YS+DYY+  G++   PIRWMSPEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+ G+SN +V+E+VR+RQ+LSCPD+CP  +Y +MLECWNE P  RP+FK+IH+R+R W+
Sbjct:   22 FIFFATFAYAEADVNLFESEEIEALAEAQSGGLPTPEGYYLEFLEQPNNITIVQGQTATLHCKVAGHPRPSIRWLKNDAPVVQEQGRVSIRKTEAGSKLRIQDLDTTDTGYYQCVATNSIKVISATGVLYV--------RLGNTGQSPAHGAEDSTHEKGFCQPYRGIACARFIGNRSIYVESLQMQGESENRITAAFTMIGT--STQLSDQCSEFAIPSFCYYVFPLCEEGTRGPRRRQLCRDECEALENDLCNAEYTIARSNPLILMQLELPVCSLLPHPGSPDASSCIRI----GLPPQYSPP--DHSCYNESGGNYKGTVSVTKSGFQCQPWSAQYPHSHHLSPIEYPQLRGGHNFCRNP----GGQMESPWCFTLDPNVRVDLCDIPPC---NPPEKMKKELLYILIP---SVATPLVFACLFFLIC-MCRNKQKESVDTPTRRQLTASPSQEMELPLLNQ-HKHQAKLRELN----------LSAVRFMEELGEDRFGKVYKGHLYGTAPGE----QTQVVAIKTVKDKDEGPLREEFRHEAMLRSRLQHPNIVCLLGVITKEQPMSMIFSYSGQGDLHEFLVMRSPH-----SDVGSSDDDKTVKSTLEQADFLHIVTQVAAGMEYLSSHHVVHKDLAARNILVCDKLNVKILDLGLFREVYSADYYKLMGAS-PFPIRWMSPEAILYGKFSTDSDIWSYGVVLWEIFSYGLQPYCGYSNQDVIEMVRNRQVLSCPDDCPAWIYTMMLECWNEFPSRRPRFKDIHARLRTWE 752          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: ror2 (receptor tyrosine kinase-like orphan receptor 2 [Source:ZFIN;Acc:ZDB-GENE-060427-5])

HSP 1 Score: 427.557 bits (1098), Expect = 8.424e-134
Identity = 259/779 (33.25%), Postives = 404/779 (51.86%), Query Frame = 3
Query:  246 LIIIVYMVFLNQPISGFTAKDIKQTDSKQP---PQFEGY-LKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQK-PRR--LCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK-NVPG--------FEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
             I      +    ++ F +++I+     Q    P  EGY L+  +   N+T   G+  TL C ++G PRP+I W K   P+V    ++ IR++  GS L+I+DLD +D G+Y C A N+    + T  + V        ++    +       + +  KG+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S Q   +C +  +   C+  F +C E  + PRR  LC+++CE +    CN  Y +          + +P C  L      +   C R      +P +  PP  ++ CYN +G  Y GTVS T  G  C  W    P         +  +   +N+CRNP      Q ++PWCFT     R ++C +  C   + P     +     +P   S+   + F  +   IC +C+  +  +  +     LT      +  P  N   K ++ L +LN          LS +RF E++GE  FG VYK  L G+         + +V +KT+       L+ EF+ EA + S L+H N++ L+GV  ++ P  +IF +  +GDLHE L+  +       S V +   D     TL   D + I  Q+A+GMEYLSS   VH+DLAARNIL+ + L  KI D+GL ++ YS+DYY+  G++   PIRWMSPEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+ G+SN +V+E+VR+RQ+LSCPD+CP  +Y +MLECWNE P  RP+FK+IH+R+R W+
Sbjct:   22 FIFFATFAYAEADVNLFESEEIEALAEAQSGGLPTPEGYYLEFLEQPNNITIVQGQTATLHCKVAGHPRPSIRWLKNDAPVVQEQGRVSIRKTEAGSKLRIQDLDTTDTGYYQCVATNSIKVISATGVLYV--------RLGNTGQSPAHGAEDSTHEKGFCQPYRGIACARFIGNRSIYVESLQMQGESENRITAAFTMIGT--STQLSDQCSEFAIPSFCYYVFPLCEEGTRGPRRRQLCRDECEALENDLCNAEYTIARSNPLILMQLELPVCSLLPHPGSPDASSCIRI----GLPPQYSPP--DHSCYNESGGNYKGTVSVTKSGFQCQPWSAQYPHSHHLSPIEYPQLRGGHNFCRNP----GGQMESPWCFTLDPNVRVDLCDIPPC---NPPEKMKKELLYILIP---SVATPLVFACLFFLIC-MCRNKQKESVDTPTRRQLTASPSQEMELPLLNQ-HKHQAKLRELN----------LSAVRFMEELGEDRFGKVYKGHLYGTAPGE----QTQVVAIKTVKDKDEGPLREEFRHEAMLRSRLQHPNIVCLLGVITKEQPMSMIFSYSGQGDLHEFLVMRSPH-----SDVGSSDDDKTVKSTLEQADFLHIVTQVAAGMEYLSSHHVVHKDLAARNILVCDKLNVKILDLGLFREVYSADYYKLMGAS-PFPIRWMSPEAILYGKFSTDSDIWSYGVVLWEIFSYGLQPYCGYSNQDVIEMVRNRQVLSCPDDCPAWIYTMMLECWNEFPSRRPRFKDIHARLRTWE 752          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: musk (muscle, skeletal, receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-030131-6458])

HSP 1 Score: 316.235 bits (809), Expect = 1.674e-92
Identity = 233/762 (30.58%), Postives = 358/762 (46.98%), Query Frame = 3
Query:  357 KLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGST-LKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLS-GHMVYVTHGRVQAE--KERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYL-VSVPKCEKLHNNQGCFRFNELPAVP-VKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIK----DHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGS---------CHSNGLTRKSYLG-IYKPCQNDCKKSESSLVQLNKIKI------------TSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSIS--TVPADSMDAYGD--VTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIH 2495
            K+ K+      ++G ++TLEC+ +G P P+I+W    L   +      + ++L G   L +  +       YTCQA N                    + +    +    +        GYC T++   C   L    +V+  +     E  +E    S   E+  V S      C      L CH  F  C+       P+ +C+E C  V +  C   ++   ++ ++ +  +++P+C  L + Q     +   AVP V  K       CYN  GR Y GT + T    PC  W          +V    ++    NYCRNP  E     D PWC+T+    R E C V +C +      +PS +    F  + P  +S    +  +I  I+          G  G+         CH      K     + +        SE  L +L+   +             S +YP + I +   IGEG FG V++A   G     P T    +V VK L   +S  +Q +F++EA +MSE  H N++ L+GV     P CL+F++M  GDL+E L      +  S+S  T+ + S+ +  +    LS  +Q+ I+ Q+A+GM YLS R FVHRDLA RN L+ ENL+ KI+D GL ++ Y++DYY+ + +   +PIRWM PE+I + R+T ESDVWAYGV+LWEI+S G+QP+YG ++ EV+  VR   +LSCP+NCP ++Y+LM  CW+  P  RP F +IH
Sbjct:  210 KILKVPKEKRVQIGSEVTLECNATGNPIPSITW----LENGNTISGASVVETLVGEVILSVLQVVVHKPALYTCQATNRHS--------------GGENTVKATAKITVSVFRLYKGHAGYCSTYRGDVCRNVLRRDALVFFNYSLPNPEDAQEYLAQSAWPELDGVSSF-----CRPAARSLLCHSTFQDCNPSGLGPAPKPVCREHCLTVKELYCYKEWRSAEERSQRGFQHITLPECTSLPSQQA--DPSSCTAVPYVDIKKDQVTSTCYNDKGRFYQGTHNVTASSIPCQRWNQQDPHQHRLSVDVIPELRNAENYCRNPGGE----SDRPWCYTTNPNVRWEYCLVPKCGEVISIRTAPSITKPAHF--YPPPSVSTAYSMSVIIFVIA----------GFAGAAFFTVLILMCHRRKKMWKKRKSRVLETPTLTTLPSELLLDRLHPNPMYQRLPLLLNSKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPTEPFT----MVAVKMLKEEASTDMQNDFQREAALMSEFDHPNIVRLLGVCAVGKPMCLMFEYMAYGDLNEFLRRRCATQQPSLSRDTLTSSSLVSEPERYPPLSCQEQLSISKQVAAGMAYLSERKFVHRDLATRNCLVAENLVVKIADFGLSRNIYAADYYKASEND-AIPIRWMPPESIFYNRYTSESDVWAYGVVLWEIFSYGMQPYYGMAHEEVIYYVRDGNVLSCPENCPQELYNLMRLCWSGHPTDRPSFASIH 925          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ROR1 (receptor tyrosine kinase-like orphan receptor 1 [Source:NCBI gene;Acc:100498561])

HSP 1 Score: 454.907 bits (1169), Expect = 3.643e-144
Identity = 274/788 (34.77%), Postives = 412/788 (52.28%), Query Frame = 3
Query:  255 IVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAEN------TFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ-----KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            ++ +  L   + G+ A+DI             YL+L++ + N+T  +G+   L C +SG P PTI W K   P+V    +I  R + +GS L+I +LD +D G++ C A N      T G          T +  S+D                    GYCQ ++  +C +++  H +YV    +Q E E +I +    I +  S     +C +  +   CH  F  C E+      KPR LC+++CE +    C   Y       ++L +LK      +P CE L        + C R      +P+ T+P  K + CYN TG +Y GTVS T  G  C  W          N   + ++   ++YCRNP      Q++APWCFT     + E+C +  C    S   +  +     +P   S+   +   ++   IC IC+ ++  ++                 +P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   +F+QEA +M+EL H N++ LVGV  ++ P C++F+FM +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNIL+GE L  KISD+GL ++ YSSDYYR    +L LPIRWM PEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECW E+P  RP+FK+I  R+R W+
Sbjct:   23 LLVLTLLEACLWGYRAEDI-------------YLQLDEPMNNITTSLGQTAELHCKVSGNPSPTIRWLKNDAPVVQEPRRISFRTTNYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGSVD----------------DEEDGYCQPYRGIACARFILNHTIYVESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDENAPHSSPKPRDLCRDECEILENVLCQAEYIFARSNPMILMRLK------LPNCEDLPLPDSLEARNCIRI----GIPM-TEPINKNHKCYNNTGVDYRGTVSATKSGRQCQPWNSNHPHTHTFNAIRYPELNGGHSYCRNP----GNQREAPWCFTLDENVKYELCDIPACDSKDSKEKNKMEILYILVP---SVAIPLAIALLFFFIC-ICRNNQKASSPPAQR------------QPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWSDFQQEASLMTELHHPNIVCLVGVVTQEQPVCMLFEFMNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYRVQNKSL-LPIRWMPPEAILYGKFSTDSDIWSYGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWQEIPSRRPRFKDILVRLRTWE 736          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ROR1 (receptor tyrosine kinase-like orphan receptor 1 [Source:NCBI gene;Acc:100498561])

HSP 1 Score: 453.751 bits (1166), Expect = 4.011e-144
Identity = 271/759 (35.70%), Postives = 402/759 (52.96%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAEN------TFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ-----KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYI---SIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            YL+L++ + N+T  +G+   L C +SG P PTI W K   P+V    +I  R + +GS L+I +LD +D G++ C A N      T G          T +  S+D                    GYCQ ++  +C +++  H +YV    +Q E E +I +    I +  S     +C +  +   CH  F  C E+      KPR LC+++CE +    C   Y       ++L +LK      +P CE L        + C R      +P+ T+P  K + CYN TG +Y GTVS T  G  C  W          N   + ++   ++YCRNP      Q++APWCFT     + E+C +  C         D+K       +YI   S+   +   ++   IC IC+ ++  ++                 +P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   +F+QEA +M+EL H N++ LVGV  ++ P C++F+FM +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNIL+GE L  KISD+GL ++ YSSDYYR    +L LPIRWM PEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECW E+P  RP+FK+I  R+R W+
Sbjct:   10 YLQLDEPMNNITTSLGQTAELHCKVSGNPSPTIRWLKNDAPVVQEPRRISFRTTNYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGSVD----------------DEEDGYCQPYRGIACARFILNHTIYVESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDENAPHSSPKPRDLCRDECEILENVLCQAEYIFARSNPMILMRLK------LPNCEDLPLPDSLEARNCIRI----GIPM-TEPINKNHKCYNNTGVDYRGTVSATKSGRQCQPWNSNHPHTHTFNAIRYPELNGGHSYCRNP----GNQREAPWCFTLDENVKYELCDIPAC------DSKDSKEKNKMEILYILVPSVAIPLAIALLFFFIC-ICRNNQKASSPPAQR------------QPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWSDFQQEASLMTELHHPNIVCLVGVVTQEQPVCMLFEFMNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYRVQNKSL-LPIRWMPPEAILYGKFSTDSDIWSYGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWQEIPSRRPRFKDILVRLRTWE 704          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ROR1 (receptor tyrosine kinase-like orphan receptor 1 [Source:NCBI gene;Acc:100498561])

HSP 1 Score: 453.366 bits (1165), Expect = 2.122e-143
Identity = 276/798 (34.59%), Postives = 417/798 (52.26%), Query Frame = 3
Query:  255 IVYMVFLNQPISGFTAKDIKQTDSKQPPQFEG-------YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAEN------TFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ-----KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYI---SIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            ++ +  L   + G+ A+   + + + P  + G       YL+L++ + N+T  +G+   L C +SG P PTI W K   P+V    +I  R + +GS L+I +LD +D G++ C A N      T G          T +  S+D                    GYCQ ++  +C +++  H +YV    +Q E E +I +    I +  S     +C +  +   CH  F  C E+      KPR LC+++CE +    C   Y       ++L +LK      +P CE L        + C R      +P+ T+P  K + CYN TG +Y GTVS T  G  C  W          N   + ++   ++YCRNP      Q++APWCFT     + E+C +  C         D+K       +YI   S+   +   ++   IC IC+ ++  ++                 +P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   +F+QEA +M+EL H N++ LVGV  ++ P C++F+FM +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNIL+GE L  KISD+GL ++ YSSDYYR    +L LPIRWM PEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECW E+P  RP+FK+I  R+R W+
Sbjct:   23 LLVLTLLEACLWGYRAEAHGKGEQRCPMPYIGRLKKRDIYLQLDEPMNNITTSLGQTAELHCKVSGNPSPTIRWLKNDAPVVQEPRRISFRTTNYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGSVD----------------DEEDGYCQPYRGIACARFILNHTIYVESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDENAPHSSPKPRDLCRDECEILENVLCQAEYIFARSNPMILMRLK------LPNCEDLPLPDSLEARNCIRI----GIPM-TEPINKNHKCYNNTGVDYRGTVSATKSGRQCQPWNSNHPHTHTFNAIRYPELNGGHSYCRNP----GNQREAPWCFTLDENVKYELCDIPAC------DSKDSKEKNKMEILYILVPSVAIPLAIALLFFFIC-ICRNNQKASSPPAQR------------QPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWSDFQQEASLMTELHHPNIVCLVGVVTQEQPVCMLFEFMNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYRVQNKSL-LPIRWMPPEAILYGKFSTDSDIWSYGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWQEIPSRRPRFKDILVRLRTWE 756          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ROR1 (receptor tyrosine kinase-like orphan receptor 1 [Source:NCBI gene;Acc:100498561])

HSP 1 Score: 452.981 bits (1164), Expect = 3.219e-143
Identity = 269/756 (35.58%), Postives = 401/756 (53.04%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAEN------TFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ-----KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            YL+L++ + N+T  +G+   L C +SG P PTI W K   P+V    +I  R + +GS L+I +LD +D G++ C A N      T G          T +  S+D                    GYCQ ++  +C +++  H +YV    +Q E E +I +    I +  S     +C +  +   CH  F  C E+      KPR LC+++CE +    C   Y       ++L +LK      +P CE L        + C R      +P+ T+P  K + CYN TG +Y GTVS T  G  C  W          N   + ++   ++YCRNP      Q++APWCFT     + E+C +  C    S   +  +     +P   S+   +   ++   IC IC+ ++  ++                 +P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   +F+QEA +M+EL H N++ LVGV  ++ P C++F+FM +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNIL+GE L  KISD+GL ++ YSSDYYR    +L LPIRWM PEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECW E+P  RP+FK+I  R+R W+
Sbjct:   66 YLQLDEPMNNITTSLGQTAELHCKVSGNPSPTIRWLKNDAPVVQEPRRISFRTTNYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGSVD----------------DEEDGYCQPYRGIACARFILNHTIYVESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDENAPHSSPKPRDLCRDECEILENVLCQAEYIFARSNPMILMRLK------LPNCEDLPLPDSLEARNCIRI----GIPM-TEPINKNHKCYNNTGVDYRGTVSATKSGRQCQPWNSNHPHTHTFNAIRYPELNGGHSYCRNP----GNQREAPWCFTLDENVKYELCDIPACDSKDSKEKNKMEILYILVP---SVAIPLAIALLFFFIC-ICRNNQKASSPPAQR------------QPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWSDFQQEASLMTELHHPNIVCLVGVVTQEQPVCMLFEFMNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYRVQNKSL-LPIRWMPPEAILYGKFSTDSDIWSYGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWQEIPSRRPRFKDILVRLRTWE 760          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: ROR1 (receptor tyrosine kinase-like orphan receptor 1 [Source:NCBI gene;Acc:100498561])

HSP 1 Score: 452.595 bits (1163), Expect = 7.584e-143
Identity = 271/759 (35.70%), Postives = 402/759 (52.96%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAEN------TFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ-----KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYI---SIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            YL+L++ + N+T  +G+   L C +SG P PTI W K   P+V    +I  R + +GS L+I +LD +D G++ C A N      T G          T +  S+D                    GYCQ ++  +C +++  H +YV    +Q E E +I +    I +  S     +C +  +   CH  F  C E+      KPR LC+++CE +    C   Y       ++L +LK      +P CE L        + C R      +P+ T+P  K + CYN TG +Y GTVS T  G  C  W          N   + ++   ++YCRNP      Q++APWCFT     + E+C +  C         D+K       +YI   S+   +   ++   IC IC+ ++  ++                 +P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   +F+QEA +M+EL H N++ LVGV  ++ P C++F+FM +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNIL+GE L  KISD+GL ++ YSSDYYR    +L LPIRWM PEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECW E+P  RP+FK+I  R+R W+
Sbjct:   86 YLQLDEPMNNITTSLGQTAELHCKVSGNPSPTIRWLKNDAPVVQEPRRISFRTTNYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGSVD----------------DEEDGYCQPYRGIACARFILNHTIYVESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDENAPHSSPKPRDLCRDECEILENVLCQAEYIFARSNPMILMRLK------LPNCEDLPLPDSLEARNCIRI----GIPM-TEPINKNHKCYNNTGVDYRGTVSATKSGRQCQPWNSNHPHTHTFNAIRYPELNGGHSYCRNP----GNQREAPWCFTLDENVKYELCDIPAC------DSKDSKEKNKMEILYILVPSVAIPLAIALLFFFIC-ICRNNQKASSPPAQR------------QPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWSDFQQEASLMTELHHPNIVCLVGVVTQEQPVCMLFEFMNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYRVQNKSL-LPIRWMPPEAILYGKFSTDSDIWSYGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWQEIPSRRPRFKDILVRLRTWE 780          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ror1 (receptor tyrosine kinase-like orphan receptor 1 [Source:MGI Symbol;Acc:MGI:1347520])

HSP 1 Score: 442.965 bits (1138), Expect = 1.328e-139
Identity = 268/754 (35.54%), Postives = 397/754 (52.65%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAEN------TFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFT-SVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            YL L++ + N+T  +G+   L C +SG P P+I W K   P+V    +I  R + +GS L+I +LD +D G++ C A N      T G          T +  S D+                   G+CQ ++  +C +++    VY+    +Q E E +I +    I +  S     +C +  +   CH  F  C E     KPR LC+++CE +    C   Y       ++L +LK      +P CE L   +      C R     A P+      K + CYN TG +Y GTVS T  G  C  W +            F ++   ++YCRNP      Q++APWCFT       ++C +  C    S   +  +     +P  ++I   I F+   I +C   +KS         S  + R+      KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   EF+QEA +M+EL H N++ L+G   ++ P C++F++M +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNILIGE L  KISD+GL ++ YS+DYYR   S   LPIRWM PEAI +G+F+ +SD+W++GV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECWNE+P  RP+FK+IH R+R W+
Sbjct:   57 YLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEY---------------EEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLK------LPNCEDLPQPESPEAANCIRIGIPMADPIN-----KNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNP----GNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPS-VAIPLAIAFLFFFICVCRNNQKSS--------SPPVQRQP-----KPVRG--QNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECTFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYMNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQ-SKSSLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWE 750          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ror2 (receptor tyrosine kinase-like orphan receptor 2 [Source:MGI Symbol;Acc:MGI:1347521])

HSP 1 Score: 424.476 bits (1090), Expect = 1.106e-132
Identity = 253/745 (33.96%), Postives = 384/745 (51.54%), Query Frame = 3
Query:  336 PQFEGY-LKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            P  +GY L   + + N+T   G+   L C ++G P P + W K   P+V    ++ IR++ +GS L+I+DLD +D G+Y C A N       T  + V    +                 ++ +  G+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S Q   +C +  +   CH  F +C   S   KPR LC+++CE +    C   Y +          + +PKCE L      +   C R   +PA  +      + + CYNG+G +Y G  S T  G  C  W          +   F ++   + YCRNP      Q + PWCFT     R E+C V  C    SP           L   I+I  VI  +   + +C   +K+   T          R+  +    P Q+     E  L+  +K +    +  LS +RF E++GE  FG VYK  L G     P    +  V +KTL   +   L+ EF+QEA + + L+H N++ L+GV  +  P  +IF +   GDLHE L+  +       S V +   D      L   D + + AQIA+GME+LSS   VH+DLA RN+L+ + L  +ISD+GL ++ YS+DYY+  G++L LPIRWMSPEA+ +G+F+++SD+W+YGV+LWE++S GLQP+ G+SN +V+E++RSRQ+L CPD+CP  VY LM+ECWNE P  RP+FK+IHSR+R W
Sbjct:   43 PTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRVIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGLKTITATGVLYVRLGPTH---------SPNHNFQDDDQEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGT--STQLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLENDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIG-IPAERLG-----RYHQCYNGSGADYRGMASTTKSGHQCQPWALQHPHSHRLSSTEFPELGGGHAYCRNP----GGQVEGPWCFTQNKNVRVELCDVPPC----SPRDGSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTP--------QRRQLMA--SPSQD----MEMPLISQHK-QAKLKEISLSTVRFMEELGEDRFGKVYKGHLFGPAPGEP----TQAVAIKTLKDKAEGPLREEFRQEAMLRARLQHPNIVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPH-----SDVGSTDDDRTVKSALEPPDFVHVVAQIAAGMEFLSSHHVVHKDLATRNVLVYDKLNVRISDLGLFREVYSADYYKLMGNSL-LPIRWMSPEAVMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRSRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRSW 737          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Ror2 (receptor tyrosine kinase-like orphan receptor 2 [Source:MGI Symbol;Acc:MGI:1347521])

HSP 1 Score: 424.476 bits (1090), Expect = 1.727e-132
Identity = 253/745 (33.96%), Postives = 384/745 (51.54%), Query Frame = 3
Query:  336 PQFEGY-LKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            P  +GY L   + + N+T   G+   L C ++G P P + W K   P+V    ++ IR++ +GS L+I+DLD +D G+Y C A N       T  + V    +                 ++ +  G+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S Q   +C +  +   CH  F +C   S   KPR LC+++CE +    C   Y +          + +PKCE L      +   C R   +PA  +      + + CYNG+G +Y G  S T  G  C  W          +   F ++   + YCRNP      Q + PWCFT     R E+C V  C    SP           L   I+I  VI  +   + +C   +K+   T          R+  +    P Q+     E  L+  +K +    +  LS +RF E++GE  FG VYK  L G     P    +  V +KTL   +   L+ EF+QEA + + L+H N++ L+GV  +  P  +IF +   GDLHE L+  +       S V +   D      L   D + + AQIA+GME+LSS   VH+DLA RN+L+ + L  +ISD+GL ++ YS+DYY+  G++L LPIRWMSPEA+ +G+F+++SD+W+YGV+LWE++S GLQP+ G+SN +V+E++RSRQ+L CPD+CP  VY LM+ECWNE P  RP+FK+IHSR+R W
Sbjct:   55 PTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRVIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGLKTITATGVLYVRLGPTH---------SPNHNFQDDDQEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGT--STQLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLENDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIG-IPAERLG-----RYHQCYNGSGADYRGMASTTKSGHQCQPWALQHPHSHRLSSTEFPELGGGHAYCRNP----GGQVEGPWCFTQNKNVRVELCDVPPC----SPRDGSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTP--------QRRQLMA--SPSQD----MEMPLISQHK-QAKLKEISLSTVRFMEELGEDRFGKVYKGHLFGPAPGEP----TQAVAIKTLKDKAEGPLREEFRQEAMLRARLQHPNIVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPH-----SDVGSTDDDRTVKSALEPPDFVHVVAQIAAGMEFLSSHHVVHKDLATRNVLVYDKLNVRISDLGLFREVYSADYYKLMGNSL-LPIRWMSPEAVMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRSRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRSW 749          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Musk (muscle, skeletal, receptor tyrosine kinase [Source:MGI Symbol;Acc:MGI:103581])

HSP 1 Score: 271.937 bits (694), Expect = 3.610e-77
Identity = 158/418 (37.80%), Postives = 241/418 (57.66%), Query Frame = 3
Query: 1281 EPTQQQDAPW-CFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIG-FVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADS---MDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQ 2519
            +PT     P+  F S+T +R    +   +   + SF+ + ++   + V ISI      F ++TI+  + C++ K   N    S  +T  +        +         +  L   K+ S +YP + I +   IGEG FG V++A   G     P T    +V VK L   +S  +Q +F++EA +M+E  + N++ L+GV     P CL+F++M  GDL+E L S +   V S+S     +   + + G   LS  +Q+ IA Q+A+GM YLS R FVHRDLA RN L+GE ++ KI+D GL ++ YS+DYY+  G+   +PIRWM PE+I + R+T ESDVWAYGV+LWEI+S GLQP+YG ++ EV+  VR   IL+CP+NCP ++Y+LM  CW+++P  RP F +IH   R+ Q+
Sbjct:  453 DPTACTRLPYLAFPSITSSRPSADIPN-LPASTSSFAVSPAYS--MTVIISIVSSFALFALLTIATLYCCRRRKEWKNKKRESTAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFT----MVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGETMVVKIADFGLSRNIYSADYYKADGND-AIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSFCSIH---RILQR 859          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Musk (muscle, skeletal, receptor tyrosine kinase [Source:MGI Symbol;Acc:MGI:103581])

HSP 1 Score: 271.937 bits (694), Expect = 4.129e-77
Identity = 166/459 (36.17%), Postives = 254/459 (55.34%), Query Frame = 3
Query: 1158 GREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYC-RNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIG-FVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADS---MDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQ 2519
            G+ + G     +H  P      +P    M  D   C R P L+  ++      F S+T +R    +   +   + SF+ + ++   + V ISI      F ++TI+  + C++ K   N    S  +T  +        +         +  L   K+ S +YP + I +   IGEG FG V++A   G     P T    +V VK L   +S  +Q +F++EA +M+E  + N++ L+GV     P CL+F++M  GDL+E L S +   V S+S     +   + + G   LS  +Q+ IA Q+A+GM YLS R FVHRDLA RN L+GE ++ KI+D GL ++ YS+DYY+  G+   +PIRWM PE+I + R+T ESDVWAYGV+LWEI+S GLQP+YG ++ EV+  VR   IL+CP+NCP ++Y+LM  CW+++P  RP F +IH   R+ Q+
Sbjct:  425 GKAHRGLYRSGMHLLPVPECSKLPS---MHRDPTACTRLPYLDYKKENIT--TFPSITSSRPSADIPN-LPASTSSFAVSPAYS--MTVIISIVSSFALFALLTIATLYCCRRRKEWKNKKRESTAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFT----MVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGETMVVKIADFGLSRNIYSADYYKADGND-AIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSFCSIH---RILQR 867          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q9Z139|ROR1_MOUSE (Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Mus musculus OX=10090 GN=Ror1 PE=2 SV=2)

HSP 1 Score: 442.965 bits (1138), Expect = 9.291e-139
Identity = 268/754 (35.54%), Postives = 397/754 (52.65%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAEN------TFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFT-SVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            YL L++ + N+T  +G+   L C +SG P P+I W K   P+V    +I  R + +GS L+I +LD +D G++ C A N      T G          T +  S D+                   G+CQ ++  +C +++    VY+    +Q E E +I +    I +  S     +C +  +   CH  F  C E     KPR LC+++CE +    C   Y       ++L +LK      +P CE L   +      C R     A P+      K + CYN TG +Y GTVS T  G  C  W +            F ++   ++YCRNP      Q++APWCFT       ++C +  C    S   +  +     +P  ++I   I F+   I +C   +KS         S  + R+      KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   EF+QEA +M+EL H N++ L+G   ++ P C++F++M +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNILIGE L  KISD+GL ++ YS+DYYR   S   LPIRWM PEAI +G+F+ +SD+W++GV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECWNE+P  RP+FK+IH R+R W+
Sbjct:   57 YLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEY---------------EEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLK------LPNCEDLPQPESPEAANCIRIGIPMADPIN-----KNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNP----GNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPS-VAIPLAIAFLFFFICVCRNNQKSS--------SPPVQRQP-----KPVRG--QNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECTFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYMNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQ-SKSSLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWE 750          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q01973|ROR1_HUMAN (Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens OX=9606 GN=ROR1 PE=1 SV=2)

HSP 1 Score: 441.425 bits (1134), Expect = 2.980e-138
Identity = 264/753 (35.06%), Postives = 397/753 (52.72%), Query Frame = 3
Query:  345 EGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXS---RSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFT-SVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            + YL L++ + N+T  +G+   L C +SG P PTI W K   P+V    ++  R +++GS L+I +LD +D G++ C A N              +  SS   + V+           S      G+CQ ++  +C +++    VY+    +Q E E +I +    I +  S     +C +  +   CH  F  C E     KPR LC+++CE +    C   Y       ++L +LK      +P CE L   +      C R     A P+      K + CYN TG +Y GTVS T  G  C  W +            F ++   ++YCRNP      Q++APWCFT       ++C +  C    S   +  +     +P  ++I   I  +   I +C   +KS         S  + R+       P     +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   ++ +   EF+QEA +M+EL H N++ L+G   ++ P C++F+++ +GDLHE LI      +RS  +    S D  G V  +L + D + IA QIA+GMEYLSS  FVH+DLAARNILIGE L  KISD+GL ++ YS+DYYR    +L LPIRWM PEAI +G+F+ +SD+W++GV+LWEI+S GLQP+YG SN EV+E+VR RQ+L C ++CP ++Y LM ECWNE+P  RP+FK+IH R+R W+
Sbjct:   55 DSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNG------------KEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGT--SSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLK------LPNCEDLPQPESPEAANCIRIGIPMADPIN-----KNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNP----GNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPS-VAIPLAIALLFFFICVCRNNQKSS--------SAPVQRQ-------PKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYINQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSL-LPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWE 750          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q9Z138|ROR2_MOUSE (Tyrosine-protein kinase transmembrane receptor ROR2 OS=Mus musculus OX=10090 GN=Ror2 PE=1 SV=2)

HSP 1 Score: 424.476 bits (1090), Expect = 1.208e-131
Identity = 253/745 (33.96%), Postives = 384/745 (51.54%), Query Frame = 3
Query:  336 PQFEGY-LKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            P  +GY L   + + N+T   G+   L C ++G P P + W K   P+V    ++ IR++ +GS L+I+DLD +D G+Y C A N       T  + V    +                 ++ +  G+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S Q   +C +  +   CH  F +C   S   KPR LC+++CE +    C   Y +          + +PKCE L      +   C R   +PA  +      + + CYNG+G +Y G  S T  G  C  W          +   F ++   + YCRNP      Q + PWCFT     R E+C V  C    SP           L   I+I  VI  +   + +C   +K+   T          R+  +    P Q+     E  L+  +K +    +  LS +RF E++GE  FG VYK  L G     P    +  V +KTL   +   L+ EF+QEA + + L+H N++ L+GV  +  P  +IF +   GDLHE L+  +       S V +   D      L   D + + AQIA+GME+LSS   VH+DLA RN+L+ + L  +ISD+GL ++ YS+DYY+  G++L LPIRWMSPEA+ +G+F+++SD+W+YGV+LWE++S GLQP+ G+SN +V+E++RSRQ+L CPD+CP  VY LM+ECWNE P  RP+FK+IHSR+R W
Sbjct:   55 PTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRVIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGLKTITATGVLYVRLGPTH---------SPNHNFQDDDQEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGT--STQLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLENDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIG-IPAERLG-----RYHQCYNGSGADYRGMASTTKSGHQCQPWALQHPHSHRLSSTEFPELGGGHAYCRNP----GGQVEGPWCFTQNKNVRVELCDVPPC----SPRDGSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTP--------QRRQLMA--SPSQD----MEMPLISQHK-QAKLKEISLSTVRFMEELGEDRFGKVYKGHLFGPAPGEP----TQAVAIKTLKDKAEGPLREEFRQEAMLRARLQHPNIVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPH-----SDVGSTDDDRTVKSALEPPDFVHVVAQIAAGMEFLSSHHVVHKDLATRNVLVYDKLNVRISDLGLFREVYSADYYKLMGNSL-LPIRWMSPEAVMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRSRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRSW 749          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q01974|ROR2_HUMAN (Tyrosine-protein kinase transmembrane receptor ROR2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=2)

HSP 1 Score: 423.705 bits (1088), Expect = 1.737e-131
Identity = 256/746 (34.32%), Postives = 384/746 (51.47%), Query Frame = 3
Query:  336 PQFEGY-LKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK---------NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITG-NSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            P  +GY L   + + N+T   G+   L C ++G P P + W K   P+V    +I IR++ +GS L+I+DLD +D G+Y C A N       T  + V    +                 ++    G+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S     +C +  +   CH  F +C   S   KPR LC+++CE +    C   Y +          + +PKCE L      +   C R   +PA  +      + + CYNG+G +Y GT S T  G  C  W          +   F ++   + YCRNP      Q + PWCFT     R E+C V  C    SP  S        L   I+I  VI  +   + +C   +K+   T          R+  +    P Q+     E  L+  +K +    +  LS +RF E++GE  FG VYK  L G     P  G  +  V +KTL   +   L+ EF+ EA + + L+H NV+ L+GV  +  P  +IF +   GDLHE L+  +       S V +   D      L   D + + AQIA+GMEYLSS   VH+DLA RN+L+ + L  KISD+GL ++ Y++DYY+  G++L LPIRWM+PEAI +G+F+++SD+W+YGV+LWE++S GLQP+ G+SN +V+E++R+RQ+L CPD+CP  VY LM+ECWNE P  RP+FK+IHSR+R W
Sbjct:   55 PTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTH---------SPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGT--STHLSDQCSQFAIPSFCHFVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIG-IPAERLG-----RYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNP----GGQMEGPWCFTQNKNVRMELCDVPSC----SPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTP--------QRRQLMA--SPSQD----MEMPLINQHK-QAKLKEISLSAVRFMEELGEDRFGKVYKGHLFG-----PAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPH-----SDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSL-LPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAW 749          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q8AXY6|MUSK_CHICK (Muscle, skeletal receptor tyrosine protein kinase OS=Gallus gallus OX=9031 GN=MUSK PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 4.315e-91
Identity = 234/746 (31.37%), Postives = 356/746 (47.72%), Query Frame = 3
Query:  396 GKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGH-MVYVTHGRVQAEKERRIASLVA--EISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKD------YLVSVPKCEKLHN-NQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTW--------KNVPG-FEDMVADNNYCRNPRLEPTQQQDAPWCFT---SVTGNREVCSVRQCIKDHSPSFSDNK-----------------SFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYG----DVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIH 2495
            G  +TL C  +G P PT++W +    +   +    ++  +  S L++     +  G +TC A N    T   A    T + S   K+                  GYC T++   C   LS + +V+        E+ + +    A  E+ +V S      C      L C+  F  C        P+ +C+E+C  V    C   +  M +  ++        L+++P+C +L + +Q       +P    K +   +   CY+G G+ Y G  + T  G PC  W        +  P  F ++    NYCRNP  E     + PWC+T   SVT   E CSV  C  D S S    K                    N + + IS   +I  VI+ I     C++ K   N    S   T  +        +         +  L   K+ S +YP + I +   IGEG FG V++A   G     P T    +V VK L   +S  +Q +F++EA +M+E  + N++ L+GV     P CL+F++M  GDL+E L   +    R++ ++    ++A       + L  T Q+ IA Q+A+GM YLS R FVHRDLA RN L+GEN++ KI+D GL ++ YS+DYY+   +   +PIRWM PE+I + R+T ESDVWAYGV+LWEI+S G+QP+YG ++ EV+  VR   ILSCPDNCP ++Y+LM  CW+++P  RP F +IH
Sbjct:  226 GSMVTLRCTAAGAPVPTVTWLENGKAVSAGSIAESVKDRVVDSRLQVY---VTRPGLFTCLATNKHSKTFGAAKAAATISVSEWSKL-------------YKGDAGYCSTYRGEVCSAILSRNALVFFNSSYADPEETQELLVHTAWTELKTVSSF-----CQPAAESLLCNYIFQECKPSGVGPAPKPICRENCLAVKDLYCFKEWLSMEENSQRGIYKPGLMLLALPECNRLPSLHQDPSACTHIPFFDFKKENITR--TCYSGNGQFYQGWANVTASGIPCQKWSDQAPHLHRRTPQVFPELSDAENYCRNPGGE----NERPWCYTKDPSVTW--EYCSVSPC-GDASLSLGTRKPNGETQNLPPPPSYSPTYSMNVIILIISSFALI--VILGIITLVCCRRRKQWKNKKRESETPTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFT----MVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEYLRDRSP---RNLCSLVQGGLEARACLLNPLALCCTSQLCIAKQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNMYSADYYKANEND-AIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGMQPYYGMAHEEVIYYVRDGNILSCPDNCPLELYNLMRLCWSKLPADRPSFASIH 931          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A1S6KMI9 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1716.05 bits (4443), Expect = 0.000e+0
Identity = 867/868 (99.88%), Postives = 868/868 (100.00%), Query Frame = 3
Query:  222 MLKCSKKLLIIIVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEINPNCIGAGSARXXXXXXXXXXXXXXXEMCSDHSHLLTGYSPATCQTNQDPSTNGIVNNITFNQQFDPPSLLSQSGPMHFSRLPNTNTIYLPELSHIV 2825
            MLKCSKKLLIIIVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGY+KLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGYTNTTAYVTVTKTKSSIDKIPVENEEEEFIENEESRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEINPNCIGAGSARSVSHSGGSKHTTSSTEMCSDHSHLLTGYSPATCQTNQDPSTNGIVNNITFNQQFDPPSLLSQSGPMHFSRLPNTNTIYLPELSHIV
Sbjct:    1 MLKCSKKLLIIIVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGYIKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGYTNTTAYVTVTKTKSSIDKIPVENEEEEFIENEESRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEINPNCIGAGSARSVSHSGGSKHTTSSTEMCSDHSHLLTGYSPATCQTNQDPSTNGIVNNITFNQQFDPPSLLSQSGPMHFSRLPNTNTIYLPELSHIV 868          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A1B1M0P6 (Tyrosine-protein kinase receptor OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 2.366e-143
Identity = 274/777 (35.26%), Postives = 421/777 (54.18%), Query Frame = 3
Query:  348 GYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLV-DINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDK------IPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQK----PRRLCQEDCEDVTKKRCNYTY-KLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMV--------ADNNYCRNPRLEPTQQQDAPWCFTSVT------------GNREVCS--------VRQCIKD-------HSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQE 2522
            G+++LN  + N T   G  + ++CDISG P P   W K  + +  D + +   + + WGS L+I D+   D G YTC+  N +G    + Y+ V   ++   K         ++EEE     E   S G+CQ ++ ++C K+L+   ++V     Q E E ++ + V  I++  S    Q C +H+++  C   F  C +       P+++C+++CE +    C   Y K     +    LV +P C+ L        + C R      +P       + Y CYN TG+ Y GTVS T+ G  C  W ++      +         ++N+CRNP      ++ APWCFT+              GN+  CS           C+++       H P+ +D    +  L +   I   I   ++   IC ICKK+K                  G +KP     ++ E + +   K+ + + ++P+SQ+RF +++GEG FG VYK EL+G     P   + S V VKTL   +S K+Q +F++E  +M++LKH N++ L+GV ++  P  ++F++M +GDLHE L       +RS  +  + S D      L + + + IA QIA+GMEYLSS  FVHRDLAARN+L+G+NL  KISD GL +D YSSDYYR    +L LP+RWM+PE+I FG+FTVESDVW++GV+LWEI+S GLQP+YG+SN EV+E++R+RQIL CP++CP+++Y LM+ CWNEM   RP FK+IH R+R+W  E
Sbjct:   38 GHVQLNADMRNYTKYSGDTVRIDCDISGNPTPQYRWYKENVAISEDGDRRFHAKATHWGSRLRISDVTPMDSGQYTCEGFNQYGVQRVSGYLRVRSERNPNQKPDSGKDQDEDDEEENDPGYELHESGGFCQPYRGAACSKFLNDRSIFVMSKVQQGEMEGKLTAAVTVIAT--SSDLSQRCGEHVIKSLCFYAFPQCGQAMDGRAIPKKICRDECEILQNDLCRTEYLKAKTHPILGSQLV-LPDCQTLPPVGSPAARDCVRI----GIPTPKASNERHY-CYNSTGQTYRGTVSTTLSGYRCQKWTDMYPHHHFLTTANNPELGNHNFCRNP----GNREAAPWCFTTNDKVRTELCEIPKCGNQVDCSTFPAGSAAAENCLRNGIPPKASHEPAATDEGMKKILLILVPCIAVPIALALLLTIIC-ICKKTK---------------QVNGQHKPLGRPGQQLEMAAMTA-KMPLRAREFPISQVRFIQELGEGAFGKVYKGELLGY----PTENSISKVAVKTLKENASAKIQSDFRREVDLMTDLKHPNIVCLIGVCMKDEPMAMLFEYMSEGDLHEYLC------MRSPHSDVSVSDDEGASQVLDHGEMLHIAIQIAAGMEYLSSHHFVHRDLAARNVLVGDNLTVKISDFGLSRDVYSSDYYRVQSKSL-LPVRWMAPESILFGKFTVESDVWSFGVVLWEIYSFGLQPYYGYSNPEVIEMIRARQILPCPEDCPSRIYSLMVVCWNEMLTRRPSFKDIHQRLRMWMME 774          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A4W5REF5 (Receptor tyrosine kinase-like orphan receptor 1 OS=Hucho hucho OX=62062 PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 1.582e-142
Identity = 269/751 (35.82%), Postives = 406/751 (54.06%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYI---SIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            +L+L   + N+T  +G+   L C +SG P PT+ W K   P+V    +I  R + +GS L+I +LD +D G++ C A N++G  +TT  +        +  +P+            S +KG+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S      C +  +   CH  F  C       KPR LC+++CE +    C   Y       ++L++LK      +P CE L  +       C R      +PV  +P  K + C+N +G  Y GTVS+T  G  C  W +            + ++   ++YCRN    P  +Q+ PWCFT   G R E+C +  C       + +N+   N   +YI   S+   +   ++   IC +C+ ++             R       KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P    + +V +KTL   SS    GEF+QEA +M+EL H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + +A Q+A+GMEYL+S  FVH+DLAARNIL+GE L  KISD+GL ++ Y+SDYYR     L LPIRWM PE+IA+G+FT ESD+WA+GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP +V+ LM ECW E P  RP+FK+IH R+R W+
Sbjct:   18 FLRLEAPMNNITTSLGQTAELLCRVSGNPLPTVRWLKNDAPVVQEPRRISYRPTPYGSRLRIRNLDTTDTGYFQCVATNSYGTVSTTGVLF-------VKFVPM------------SMNKGFCQPYRGVACSRFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNHLSDRCSQFAIPSLCHFAFPTCDRSSGVDKPRDLCKDECEILENDLCKTEYIIARSNPIILKRLK------LPNCEDLAAHDSPEAAICMRI----GIPV-AEPINKNHKCFNSSGSAYRGTVSKTKSGRQCQPWNSQYPHSHTYLAVSYPELSGGHSYCRN----PGNKQEGPWCFTLDEGVRMELCDIPIC------DYKENRGGSNMEILYILVPSVAIPLAIALLFFFIC-VCRNNQKA----------ARPPAPRQPKPVRG--QNVEMSMLTNYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMEQAQLVAIKTLKDYSSPGQWGEFQQEASVMAELHHPNVVCLLGVVTQEQPVCMLFEFLNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHLALQVAAGMEYLASHFFVHKDLAARNILVGEQLHVKISDLGLSREIYTSDYYRVQPKAL-LPIRWMPPESIAYGKFTSESDIWAFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRVFGLMTECWQEGPTRRPRFKDIHGRLRAWE 701          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A4W5RQJ1 (Receptor tyrosine kinase-like orphan receptor 1 OS=Hucho hucho OX=62062 PE=3 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 1.205e-141
Identity = 267/751 (35.55%), Postives = 404/751 (53.79%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYI---SIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            +L+L   + N+T  +G+   L C +SG P PT+ W K   P+V    +I  R + +GS L+I +LD +D G++ C A N++G  +TT  +        +   P+           +   +G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S      C +  +   CH  F  C       KPR LC+++CE +    C   Y       ++L++LK      +P CE L  +       C R      +PV  +P  K + C+N +G  Y GTVS+T  G  C  W +            + ++   ++YCRNP      +Q+ PWCFT   G R E+C +  C       + +N+   N   +YI   S+   +   ++   IC +C+ ++             R       KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P    + +V +KTL   SS    GEF+QEA +M+EL H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + +A Q+A+GMEYL+S  FVH+DLAARNIL+GE L  KISD+GL ++ Y+SDYYR     L LPIRWM PE+IA+G+FT ESD+WA+GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP +V+ LM ECW E P  RP+FK+IH R+R W+
Sbjct:   18 FLRLEAPMNNITTSLGQTAELLCRVSGNPLPTVRWLKNDAPVVQEPRRISYRPTPYGSRLRIRNLDTTDTGYFQCVATNSYGTVSTTGVLF-------VKFDPLLTPLPGRPSANDFDEEGFCQPYRGVACSRFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNHLSDRCSQFAIPSLCHFAFPTCDRSSGVDKPRDLCKDECEILENDLCKTEYIIARSNPIILKRLK------LPNCEDLAAHDSPEAAICMRI----GIPV-AEPINKNHKCFNSSGSAYRGTVSKTKSGRQCQPWNSQYPHSHTYLAVSYPELSGGHSYCRNP----GNKQEGPWCFTLDEGVRMELCDIPIC------DYKENRGGSNMEILYILVPSVAIPLAIALLFFFIC-VCRNNQKAA----------RPPAPRQPKPVRG--QNVEMSMLTNYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMEQAQLVAIKTLKDYSSPGQWGEFQQEASVMAELHHPNVVCLLGVVTQEQPVCMLFEFLNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHLALQVAAGMEYLASHFFVHKDLAARNILVGEQLHVKISDLGLSREIYTSDYYRVQPKAL-LPIRWMPPESIAYGKFTSESDIWAFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRVFGLMTECWQEGPTRRPRFKDIHGRLRAWE 713          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A1S3P9H9 (tyrosine-protein kinase transmembrane receptor ROR1-like isoform X4 OS=Salmo salar OX=8030 GN=LOC106584030 PE=3 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 2.869e-141
Identity = 266/751 (35.42%), Postives = 404/751 (53.79%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYI---SIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            +L+L+  + N+T  +G+   L C +SG P PT+ W K   P+V    +I  R + +GS L+I +LD +D G++ C A N++G  +TT  +        +   P+          ++   +G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S      C +  +   CH  F  C       KPR LC+++CE +    C   Y       ++L++LK      +P CE L  +       C R     A P+      K + C+N +G  Y GTVS+T  G  C  W +            + ++   ++YCRNP      +Q+ PWCFT   G R E+C +  C       + +N+   N   +YI   S+   +   ++   IC +C+ ++             R       KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P    + +V +KTL   SS    GEF+QEA +M+EL H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + +A Q+A+GMEYL+S  FVH+DLAARNIL+GE L  KISD+GL ++ Y+SDYYR     L LPIRWM PE+IA+G+FT ESD+WA+GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP +V+ LM ECW E P  RP+FK+IH R+R W+
Sbjct:   12 FLRLDAPMNNITTSLGQTAELLCRVSGNPLPTVRWLKNDAPVVQEPRRISFRPTPYGSRLRIRNLDTTDTGYFQCVATNSYGTVSTTGVLF-------VKFDPLLTPLPGRPSADDFDEEGFCQPYRGVACSRFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNHLSDRCSQFAIPSLCHFAFPTCDRSSGVDKPRDLCKDECEILENDLCKTEYIIARSNPIILKRLK------LPNCEDLAAHDSPEAAICMRIGIPMAEPID-----KNHKCFNSSGSAYRGTVSKTRSGRQCQPWNSQYPHSHTYLALRYPELSGGHSYCRNP----GNKQEGPWCFTLDEGVRMELCDIPIC------DYKENRGGSNMEILYILVPSVAIPLAIALLFFFIC-VCRNNQKAA----------RPPAPRQPKPVRG--QNVEMSMLTNYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMEQAQLVAIKTLKDYSSPGQWGEFQQEASVMAELHHPNVVCLLGVVTQEQPVCMLFEFLNQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHLALQVAAGMEYLASHFFVHKDLAARNILVGEQLHVKISDLGLSREIYTSDYYRVQPKAL-LPIRWMPPESIAYGKFTSESDIWAFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRVFGLMTECWQEGPTRRPRFKDIHGRLRAWE 707          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: ror1 (receptor tyrosine kinase-like orphan receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6104])

HSP 1 Score: 450.669 bits (1158), Expect = 3.113e-143
Identity = 265/741 (35.76%), Postives = 400/741 (53.98%), Query Frame = 3
Query:  372 LTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            + N+T  +G+   L C +SG P PT+ W K   P+     ++  +Q+ +GS L+I +LD +D G++ C A N++G  +TT  + V       D +P         ++ +   +G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S      C +  +   CH  F  C       KPR LC+++CE +    C   Y       ++L++LK      +P CE L  +       C R     A  +      K + C+N +G +Y GT S T  G  C  W +            + ++   ++YCRNP      + +APWCFT     R E+C + QC  D       +      L   ++I   IG +   I +C   +K+             +R       KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   SS +  G+F+QEA +++EL H NV+ L+GV  ++ P C++F+F+  GDLHE LI      +RS  +    S D  G V  +L + D + +A Q+A+GMEYLS R FVH+DLAARNIL+GE L  KISD+GL ++ YSSDYYR   +TL LPIRWMSPEAIA+G+FT +SD+WA+GV+LWEI+S GLQPFYG SN EVME+VR RQ+L CP++CP ++Y LM ECW E P  RP+FK+IH+R+R W+
Sbjct:    1 MNNITTSLGQTAELHCHVSGNPPPTVRWLKNDAPVAPEARRVSYKQTQYGSRLRIRNLDTTDTGYFQCVATNSYGTVSTTGILFV-----KFDPLPTPQSGRPSPDDFDE--EGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNHLSDRCSQFAIPSLCHFAFPTCDRSSGIDKPRDLCKDECEILENDLCKTEYIIARSNPIILKRLK------LPNCEDLAASDSPEAANCMRIGIPMAESIN-----KNHKCFNSSGADYRGTTSVTKSGRQCQPWNSQYPHSHNFLALRYPELNGGHSYCRNP----GNKHEAPWCFTLDDSVRMELCGIPQC--DSKEQRGGSVQILYILVPSVAIPLAIGLLFFFICVCRNNQKA-------------SRPPAQRQPKPVRG--QNVEMSMLPAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMEHAQLVAIKTLKDFSSAQQWGDFQQEASVLTELHHPNVVCLLGVVTQEQPVCMLFEFLALGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHLATQVAAGMEYLSGRFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYRVQPNTL-LPIRWMSPEAIAYGKFTTDSDIWAFGVVLWEIFSFGLQPFYGFSNQEVMEMVRKRQLLPCPEDCPPRMYALMTECWQEGPARRPRFKDIHARLRAWE 688          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: ror1 (receptor tyrosine kinase-like orphan receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6104])

HSP 1 Score: 450.284 bits (1157), Expect = 3.316e-143
Identity = 264/741 (35.63%), Postives = 397/741 (53.58%), Query Frame = 3
Query:  372 LTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQ---KPRRLCQEDCEDVTKKRCNYTY------KLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            + N+T  +G+   L C +SG P PT+ W K   P+     ++  +Q+ +GS L+I +LD +D G++ C A N++G  +TT  +        +  + V    +    N     +G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S      C +  +   CH  F  C       KPR LC+++CE +    C   Y       ++L++LK      +P CE L  +       C R     A  +      K + C+N +G +Y GT S T  G  C  W +            + ++   ++YCRNP      + +APWCFT     R E+C + QC     P           L   ++I   IG +   I +C   +K+             +R       KP +   +  E S++   K K  + + PLS +RF E++GE  FG +YK  L       P   ++ +V +KTL   SS +  G+F+QEA +++EL H NV+ L+GV  ++ P C++F+F+  GDLHE LI      +RS  +    S D  G V  +L + D + +A Q+A+GMEYLS R FVH+DLAARNIL+GE L  KISD+GL ++ YSSDYYR   +TL LPIRWMSPEAIA+G+FT +SD+WA+GV+LWEI+S GLQPFYG SN EVME+VR RQ+L CP++CP ++Y LM ECW E P  RP+FK+IH+R+R W+
Sbjct:    1 MNNITTSLGQTAELHCHVSGNPPPTVRWLKNDAPVAPEARRVSYKQTQYGSRLRIRNLDTTDTGYFQCVATNSYGTVSTTGILF-------VKFVQVSPSTKSRGYNRSLMREGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNHLSDRCSQFAIPSLCHFAFPTCDRSSGIDKPRDLCKDECEILENDLCKTEYIIARSNPIILKRLK------LPNCEDLAASDSPEAANCMRIGIPMAESIN-----KNHKCFNSSGADYRGTTSVTKSGRQCQPWNSQYPHSHNFLALRYPELNGGHSYCRNP----GNKHEAPWCFTLDDSVRMELCGIPQC--GEKPYIKVKVKILYILVPSVAIPLAIGLLFFFICVCRNNQKA-------------SRPPAQRQPKPVRG--QNVEMSMLPAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLY-----LPGMEHAQLVAIKTLKDFSSAQQWGDFQQEASVLTELHHPNVVCLLGVVTQEQPVCMLFEFLALGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHLATQVAAGMEYLSGRFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYRVQPNTL-LPIRWMSPEAIAYGKFTTDSDIWAFGVVLWEIFSFGLQPFYGFSNQEVMEMVRKRQLLPCPEDCPPRMYALMTECWQEGPARRPRFKDIHARLRAWE 688          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: ror2 (receptor tyrosine kinase like orphan receptor 2 [Source:NCBI gene;Acc:103027416])

HSP 1 Score: 436.417 bits (1121), Expect = 2.954e-137
Identity = 263/733 (35.88%), Postives = 387/733 (52.80%), Query Frame = 3
Query:  375 TNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQK---PRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEY-DCYNGTGREYVGTVSQTIHGTPCVTWK-NVPG--------FEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            +N+T   G+  TL C +SG PRPTI W K   P+V    +I IR++ +GS L+I+DLD +D G+Y C A N  G    TA   +     +I  +              +  KG+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S Q   +C +  +   CH  F +C E  +    R+LC+++CE +    C   Y +          + +P C  L      +   C R      VP++    L+ Y +CYNG+G  Y GTVS T  G  C +W    P         + ++   +N+CRNP      Q ++PWCFT     R +VC VR C     P  +  K     L   I+I  VI  +   + +C    K K   +     N LT      +  P  N   K ++ L ++N          LS +RF E++GE  FG VYK  L G+         + +V +KT+       L+ EF+ EA + S L+H N++ L+GV  ++ P  +IF +   GDLHE L+  +       S V +   D      L   D + I  Q+A+GMEYLSS   VH+DLAARNIL+ + L  KI D+GL +D YS+DYY+  GS+   PIRWMSPEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+ G+SN +V+E+VR+RQ+LSCPD+CP+ +Y LMLECWNE P  RP+FK+IH+R+R W+
Sbjct:   77 SNMTIMQGQTATLHCKVSGNPRPTIRWLKNDAPVVQEQGRISIRKTEFGSKLRIQDLDTTDTGYYQCVASN--GLKVITATGVLYVRLGNITHL--------------TYEKGFCQPYRGIACARFIGNRSIYVESLQMQGESENRITAAFTMIGT--STQLSDQCSQFAIPSFCHYVFPLCEEGSRGPRQRQLCRDECEALENDLCRTEYTIARSNPLILMQLELPNCHLLPHPGSPDAASCMRI----GVPIER---LETYHNCYNGSGTNYRGTVSVTKSGYQCQSWSAQYPHSHHLTPLEYPELRGGHNFCRNP----GGQMESPWCFTLDPRVRVDVCEVRAC----KPPENVKKEILYILIPSIAIPLVIACLFFLVCMCR--NKQKESVDSPPRRN-LTASPSQDMEMPLLNQ-HKHQAKLREVN----------LSAVRFMEELGEDRFGKVYKGHLYGTAPGE----QTQVVAIKTVKDKDEGSLREEFRHEAMLRSRLQHPNIVCLLGVVTKEQPMSMIFSYSGHGDLHEFLVMRSPH-----SDVGSSDDDKTVKSALEQADFLHIVTQVAAGMEYLSSHHVVHKDLAARNILVCDKLNVKILDLGLFRDVYSADYYKLMGSS-PFPIRWMSPEAIMYGKFSTDSDIWSYGVVLWEIFSYGLQPYCGYSNQDVIEMVRNRQVLSCPDDCPSWIYTLMLECWNEFPARRPRFKDIHARLRTWE 752          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: ror2 (receptor tyrosine kinase like orphan receptor 2 [Source:NCBI gene;Acc:103027416])

HSP 1 Score: 436.417 bits (1121), Expect = 3.178e-137
Identity = 267/756 (35.32%), Postives = 395/756 (52.25%), Query Frame = 3
Query:  309 IKQTDSKQPPQFEG-YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQK---PRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEY-DCYNGTGREYVGTVSQTIHGTPCVTWK-NVPG--------FEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            + +  S   P  EG  L+  +  +N+T   G+  TL C +SG PRPTI W K   P+V    +I IR++ +GS L+I+DLD +D G+Y C A N       T  + V   +S                 + +  KG+CQ ++  +C +++    +YV   ++Q E E RI +    I +  S Q   +C +  +   CH  F +C E  +    R+LC+++CE +    C   Y +          + +P C  L      +   C R      VP++    L+ Y +CYNG+G  Y GTVS T  G  C +W    P         + ++   +N+CRNP      Q ++PWCFT     R +VC VR C     P  +  K     L   I+I  VI  +   + +C    K K   +     N LT      +  P  N   K ++ L ++N          LS +RF E++GE  FG VYK  L G+         + +V +KT+       L+ EF+ EA + S L+H N++ L+GV  ++ P  +IF +   GDLHE L+  +       S V +   D      L   D + I  Q+A+GMEYLSS   VH+DLAARNIL+ + L  KI D+GL +D YS+DYY+  GS+   PIRWMSPEAI +G+F+ +SD+W+YGV+LWEI+S GLQP+ G+SN +V+E+VR+RQ+LSCPD+CP+ +Y LMLECWNE P  RP+FK+IH+R+R W+
Sbjct:   46 LAEAQSGGLPASEGNLLEFVEPPSNMTIMQGQTATLHCKVSGNPRPTIRWLKNDAPVVQEQGRISIRKTEFGSKLRIQDLDTTDTGYYQCVASNGLKVITATGVLYVRLGQSPTHG-----------PGDATYEKGFCQPYRGIACARFIGNRSIYVESLQMQGESENRITAAFTMIGT--STQLSDQCSQFAIPSFCHYVFPLCEEGSRGPRQRQLCRDECEALENDLCRTEYTIARSNPLILMQLELPNCHLLPHPGSPDAASCMRI----GVPIER---LETYHNCYNGSGTNYRGTVSVTKSGYQCQSWSAQYPHSHHLTPLEYPELRGGHNFCRNP----GGQMESPWCFTLDPRVRVDVCEVRAC----KPPENVKKEILYILIPSIAIPLVIACLFFLVCMCR--NKQKESVDSPPRRN-LTASPSQDMEMPLLNQ-HKHQAKLREVN----------LSAVRFMEELGEDRFGKVYKGHLYGTAPGE----QTQVVAIKTVKDKDEGSLREEFRHEAMLRSRLQHPNIVCLLGVVTKEQPMSMIFSYSGHGDLHEFLVMRSPH-----SDVGSSDDDKTVKSALEQADFLHIVTQVAAGMEYLSSHHVVHKDLAARNILVCDKLNVKILDLGLFRDVYSADYYKLMGSS-PFPIRWMSPEAIMYGKFSTDSDIWSYGVVLWEIFSYGLQPYCGYSNQDVIEMVRNRQVLSCPDDCPSWIYTLMLECWNEFPARRPRFKDIHARLRTWE 749          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: MUSK (muscle associated receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:7525])

HSP 1 Score: 293.508 bits (750), Expect = 1.822e-86
Identity = 201/635 (31.65%), Postives = 308/635 (48.50%), Query Frame = 3
Query:  705 SKGYCQTFQSSSC-GKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYL-----VSVPKCEKLHNNQGCFRFNELPAVP-VKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEP------TQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSD------NKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSN----GLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSIS--TVPADSMDAYGDVT-LSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIH 2495
            S GYC T++   C G      +V+        E  +    L+A  S      A   C      L CH+ F  CS       P+ LC+E C  V +  C   ++   ++  +  +     +++  C KL + Q     +   AV  V  K       CYN  GR Y G ++ T  G PC  W           V    ++    NYCRNP  E       T      W +  V    E  ++ +      P  S+         + N +   I+    + F+ + I +C   +K+                L  +  L    P           L  L   K+ + +YP + I +   IGEG FG V++A   G   + P T    +V VK L   +S  +Q +F++EA +M+E  H N++ L+GV     P CL+F++M  GDL+E L   +  + RS+S  ++   S  +  D T LS  +++ ++ Q+A+GM YLS R FVHRDLA RN L+GE+L+ KI+D GL ++ Y++DYY+ + +   +PIRWM PE+I + R+T ESDVWAYGV+LWEI+S+G+QP+YG ++ EV+  VR   +L+CP+NCP ++Y+LM  CW+  P  RP F +IH
Sbjct:   49 SAGYCSTYRGEVCDGALRQNALVFFNFSLPDPENAQE---LLARASWSELDWASPLCRPAARSLLCHNAFQDCSPSGLGPSPKPLCREHCVAVKELYCYKEWRASEERSHRGVMSPGLSIALTDCRKLPSLQA--DPDSCTAVDYVGMKKDQITTTCYNNRGRFYQGALNVTASGIPCQRWDQQDPHPHRLPVDVIPELSNAENYCRNPGGESDRPWCYTSSPRVRWEYCLVPKCGEAVTIVRAASAPKPPPSNPIAAVSTAYYMNVIIFIIAGFAGVAFLTILILMCHKRRKTWKRRRSRVMKTPTLTALPSELLLDRLHP-----NPMYQRLPLLLNSKLLTLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPHEPFT----MVAVKMLKEEASADMQNDFQREAALMAEFDHPNIVRLLGVCAVGKPMCLMFEYMAHGDLNEFLRRRSPAQQRSLSQGSLTDQSFASESDPTPLSCLEKLSMSKQVAAGMAYLSERKFVHRDLATRNCLVGEDLVVKIADFGLSRNIYAADYYKASEND-AIPIRWMPPESIFYNRYTSESDVWAYGVVLWEIFSHGMQPYYGMAHEEVIYYVRDGHVLACPENCPLELYNLMRLCWSRHPNDRPSFASIH 668          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 235.343 bits (599), Expect = 3.913e-71
Identity = 112/247 (45.34%), Postives = 162/247 (65.59%), Query Frame = 3
Query: 1788 SVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGD--VTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNI-HSRIRVWQQ 2519
            S  +Q  F +EA +M+E  H N++ L+GV     P+CL+F+FM  GDL+E L   ++    + S+ PA +  + G   V+L   D++F+A Q+A+GM YL+ R FVHRDLA RN L+G  L+ KISD GL +  Y++DYY+   +   +PIRWM PE+I + R+T ESDVWA+GV+LWEI+S+GLQP++G S+ EV+  VR   +L+CPD CP  +Y+LM  CW   P  RP F ++ H   R+  Q
Sbjct:    1 SPDMQANFHREAALMAEFTHPNIVKLLGVCAVGKPFCLLFEFMPHGDLNEYLRRCSSEAGLAASSPPARAPTSSGSEPVSLCCADKLFVATQVAAGMAYLAERKFVHRDLATRNCLVGNRLVVKISDFGLSQSIYAADYYKANEND-AIPIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSHGLQPYFGMSHEEVIYFVRDGNVLACPDGCPLDLYNLMRLCWAHAPADRPSFASVQHVLARMHAQ 246          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: NTRK2 (neurotrophic receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:8032])

HSP 1 Score: 214.157 bits (544), Expect = 5.159e-62
Identity = 111/279 (39.78%), Postives = 170/279 (60.93%), Query Frame = 3
Query: 1668 QIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRI 2504
            ++GEG FG VY AE     ++  +     +V  KTL   S    + +F +EA++++ L+H +++   GV +   P  ++F++M+ GDL      N  + +R    V            LS    + + +QIA+GM YL+S+ FVHRDLA RN L+G  L+ KI D G+ +D YS+DYYR  G T MLPIRWM PE+I + +FT +SDVW+ GV+LWEI++ G QP+Y  SN EV++ +   ++L  P +CP +VY+LML CW+  P++R   K+I +R+
Sbjct:   81 ELGEGAFGKVYLAEC----SSLDVGQEPMLVAAKTLKDLSD-GARKDFYREAELLTNLQHEHIVRFYGVCVEGEPLIMVFEYMKNGDL------NKFLRLRGPDAVFMGDAPQAEPRLLSQAQMLNMGSQIAAGMAYLASQHFVHRDLATRNCLVGAGLVVKIGDFGMSRDVYSTDYYRVGGHT-MLPIRWMPPESIMYRKFTADSDVWSLGVVLWEIFTYGKQPWYQLSNTEVIDCICQGRVLERPRSCPMEVYELMLGCWHREPQHRLGIKDILARL 347          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 3.067e-55
Identity = 102/289 (35.29%), Postives = 160/289 (55.36%), Query Frame = 3
Query: 1650 QIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLIS--------NTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNI 2492
            +++   ++G+G FG VY+    G         + + V +KT++  ++++ + EF  EA +M      +V+ L+GV  +  P  +I + M +GDL   L S          T+ +    T P  S+           + + +A +IA GM YL+++ FVHRDLAARN ++ E+   KI D G+ +D Y +DYYR  G  L LP+RWMSPE++  G FT  SDVW++GV+LWEI +   QP+ G SN +V++ V    +L  P  CP ++ +L+ +CW   PR RP F  I
Sbjct:   12 KVKMMRELGQGTFGMVYEGLARGIVKGE----DETRVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQAQPILVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSL----------PEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGL-LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 285          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 4.565e-54
Identity = 113/348 (32.47%), Postives = 180/348 (51.72%), Query Frame = 3
Query: 1449 FVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNI 2492
            FV + + +C +C       N +   NG+   S    Y     D   ++   V+ +K+K+              ++G+G FG VY+    G         + + V +KT++  ++++ + EF  EA +M      +V+ L+GV  +  P  +I + M +GDL   L S      +  +  P+           S  + + +A +IA GM YL+++ FVHRDLAARN ++ E+   KI D G+ +D Y +DYYR  G  L LP+RWMSPE++  G FT  SDVW++GV+LWEI +   QP+ G SN +V++ V    +L  P  CP ++ +L+ +CW   PR RP F  I
Sbjct:   10 FVFIALCVCILC----LNRNEAAVPNGVLYASVNPEYF-STADVYIADEWEVERDKVKM------------MRELGQGTFGMVYEGLARGIVKGE----DETRVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQAQPILVIMELMTRGDLKSYLRSLRPDAEKKPTRPPS-----------SLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGL-LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 324          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 192.2 bits (487), Expect = 3.008e-53
Identity = 109/322 (33.85%), Postives = 176/322 (54.66%), Query Frame = 3
Query: 1548 LGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGL---IKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRI 2504
            + + KPC         + + L+   +   + P + I+ Q+++G G+FG V++           +  NS++V VKTL  G+  K   EF  EAQ+M +L+H N++ L  V  ++ P  +I + M  G L + L      ++++   V                    +A QIA+GM YL S++++HRDLAARNIL+GE  +CK++D GL   IK  Y  +Y    G+ +  PI+W +PEA+ F RF+V+SDVW++G+LL+E+ + G  P+    N EV++ +     +  PDNCP   Y +MLECWN+    RP F+ +  R+
Sbjct:  157 MALQKPC---VVIEAPTTIGLSYNTVDKWEIPRASIQLQKRLGAGMFGEVWQG----------LWNNSTLVAVKTLKPGAMKK--EEFIGEAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVD-------------------MARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYEGKAGAKV--PIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECWNKKEEERPTFETLQWRL 442          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 83.5741 bits (205), Expect = 2.120e-17
Identity = 69/263 (26.24%), Postives = 115/263 (43.73%), Query Frame = 3
Query: 1626 TSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQG--EFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCP 2408
            TS  Y LS  +    +G G FG V+   L+ SN+N           +KTL   + VKL+       E +M+S + H  ++ + G         ++ D++E G+L  LL        R     P                  F AA++   +EYL S+  ++RDL   NIL+ +N   KI+D G  K      Y      TL     +++PE ++   +    D W++GVL++E+ + G  PFY  +  +  E + + ++   P
Sbjct:   79 TSGKYSLSDFQILRTLGTGSFGRVH---LIRSNHNG------RFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLL--------RKSQRFPNPVAK-------------FYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAK------YVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLA-GYTPFYNSNTMKTYENILNAELKFPP 304          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 85.1149 bits (209), Expect = 4.011e-17
Identity = 67/273 (24.54%), Postives = 126/273 (46.15%), Query Frame = 3
Query: 1587 SESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVY------KAELVGSNN-NSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFI---AAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGR-FTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVM 2372
            +E+ +V +NK K +  +Y        E IG+G FGAVY        E++       P   + +  I+ T+ A          + E   + +L H+N++  +G   +   + L  +++  G +  L+                     YG       D+  I     Q+  G+ YL S+  +HRD+ A N+L+ ++ +CKISD G+ +   S D Y  +  T+   + WM+PE +   + ++ + D+W+ G ++ E+++ G +P+   SN EV+
Sbjct: 1153 TENHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEA---------LRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLI-------------------RMYGRF-----DEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRK--SKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPW---SNLEVV 1386          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: CTK1 (Catalytic (alpha) subunit of C-terminal domain kinase I (CTDK-I); phosphorylates both RNA pol II subunit Rpo21p to affect transcription and pre-mRNA 3' end processing, and ribosomal protein Rps2p to increase translational fidelity; required for H3K36 trimethylation but not dimethylation by Set2p; suggested stimulatory role in 80S formation during translation initiation; similar to the Drosophila dCDK12 and human CDK12 and probably CDK13 [Source:SGD;Acc:S000001622])

HSP 1 Score: 76.2554 bits (186), Expect = 1.096e-14
Identity = 73/269 (27.14%), Postives = 118/269 (43.87%), Query Frame = 3
Query: 1668 QIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFK-------QEAQMMSELKHVNVLSLVGVSIR-QIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFG--RFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCP--DNCPTKVYDL 2438
            Q+GEG +G VYKA+          T    +V +K L      +LQGE +       +E +++    H NV ++  + +  Q    +IF++ +  DL  LL++                     +V +S++    +  Q+  GMEYL     +HRD+   NILI      KI+D GL +   S   Y     TL     W  P  +  G   +  E D+W  G LL E++ N    F G +  E +E +   +I+  P  ++ PT +YD+
Sbjct:  188 QVGEGTYGKVYKAK---------NTNTEKLVALKKL------RLQGEREGFPITSIREIKLLQSFDHPNVSTIKEIMVESQKTVYMIFEYAD-NDLSGLLLNK--------------------EVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLARKMNSRADYTNRVITL-----WYRPPELLLGTTNYGTEVDMWGCGCLLVELF-NKTAIFQGSNELEQIESI--FKIMGTPTINSWPT-LYDM 411          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 73.9442 bits (180), Expect = 3.263e-14
Identity = 65/265 (24.53%), Postives = 112/265 (42.26%), Query Frame = 3
Query: 1620 KITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQG--EFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCP 2408
            ++TS  Y L   +    +G G FG V+   L+ S +N           +K L     V+L+       E  M+S + H  ++ + G         +I D++E G+L  LL        R     P                  F AA++   +EYL S+  ++RDL   NIL+ +N   KI+D G  K      Y      TL     +++PE ++   +    D W++G+L++E+ + G  PFY  +  +  E + + ++   P
Sbjct:   76 RVTSGKYSLQDFQILRTLGTGSFGRVH---LIRSRHNG------RYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLL--------RKSQRFPNPVAK-------------FYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAK------YVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLA-GYTPFYDSNTMKTYEKILNAELRFPP 303          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 74.7146 bits (182), Expect = 5.117e-14
Identity = 63/292 (21.58%), Postives = 132/292 (45.21%), Query Frame = 3
Query: 1551 GIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQ-IRFQEQIGEGIFGAVYKAE------------LVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIP--WCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELV 2381
            G+ KP +   + + S+   ++K+K  + +   SQ  +  E+ G+G  G+VY AE            L+ ++ + P  G+   +    LS     +L      E  +M + +H N+++ +   +R     W ++ +FME G L +++ ++ T +         +S     +  ++Y     I  +   G+++L  +  +HRD+ + N+L+      KI+D G    C      R+  +T++    WM+PE +    +  + DVW+ G++  E+   G  P+      + + L+
Sbjct:  512 GVAKP-KKPARPTMSTAEIMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKEL---IVNEILVMKDSRHKNIVNFLEAYLRTDDDLW-VVMEFMEGGSLTDIIENSPTND---------NSHSPLTEPQIAY-----IVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGF---CARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLE-GEPPYLNEDPLKALYLI 780          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO48215 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA9])

HSP 1 Score: 315.079 bits (806), Expect = 5.211e-95
Identity = 226/741 (30.50%), Postives = 359/741 (48.45%), Query Frame = 3
Query:  372 LTNVTGKVGKKITLECDISGKPRPTISWKKAKLPL-VDINYKIKIR---QSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHM-VYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSE---DQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYL--VSVPKCEKLHNN---QG--CFRFN--ELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK-NVPGFE--------DMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQ-IRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRV 2510
            + N TG +G+KI+L+C +SG  +  I+W K  + L  D   ++ I+   +   GS LKI+ L  SD G Y C A +                  S +   V            +   GYC  +    C K ++    V+++    Q   E+++      IS   S++    C  +++ L CH  F  C +     +PR LC ++C+ + K  C+  YK    +++K+ L  V  P CE+L +    QG  C R       A P ++K  L    C+NGTG  Y G +S T  G  C  W    P F         ++   +NYCRNP      ++  PWCFT+    R + C + +C  D  P           +P  +     + F  + I  CW C K                     IY   Q D   +   L+ +  +K TS    + + +R  +++GEG +G VY  E+   +    +   ++ V+V +L     V ++ EF ++A+  S+L+H N++++VG+  + +P C++++++E G LHE L+ N  ++        AD +   G ++++Y        Q+A+GM YLSS + VH DLA RN ++G     KI+D+ L +  YS DYYR       LP+RWM+PEAI   RFT E+D+W++GVLLWE++S G QP +G SN +VM  +R   +L CP +CP  VY LM ECW+ +P  RP+F  IH+ + V
Sbjct:    1 MDNETGIIGRKISLKCVVSGIVQANITWYKNGIALDSDKKGRVSIKSLDKEKEGSRLKIKSLRLSDAGIYKCTAWSGL------------LLAVSNNAFLVSLLGPLLNYPGPTTRPGYCVRYTGHICSKSINHKKSVFISAVNQQGSIEKKLEIAFNTISR--SKKLSDSCQPYVLPLLCHYLFPYCDDAASQPQPRPLCYDECDLLRKDVCSEEYK----EVQKESLSVVLFPDCERLPSRDSVQGKKCIRLGIQTRRAWPKESKGDL----CFNGTGEHYNGNISVTEKGFGCQRWNVTTPHFHLMSPATYHELRGGHNYCRNP----GGKKQRPWCFTTDPRQRYDYCDIAKC--DEPPVIHVVSILYTVIPCLL---IAVIFFSVVIFFCWRCDKQI-------------------IY---QADESAAPMPLMPV-IVKTTSKIREIKESLRLLKELGEGDYGKVYFGEITTKSEGRLM---ATSVLVVSLRESHEVDVRDEFFEKAEAWSKLQHPNIITIVGMCNKSVPTCVLYEYLEYGTLHEYLVRNAPIDDPEAEEEIADPLWCDGLISIAY--------QVAAGMNYLSSNNIVHGDLATRNCMVGPGRTVKITDVALTRLGYSHDYYRQLHRR-PLPVRWMAPEAILSYRFTPETDIWSFGVLLWELFSYGAQPHFGFSNEDVMFRLRECILLPCPVDCPASVYRLMKECWDILPPSRPRFSTIHTHLGV 675          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO43993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX97])

HSP 1 Score: 247.284 bits (630), Expect = 6.017e-72
Identity = 175/576 (30.38%), Postives = 284/576 (49.31%), Query Frame = 3
Query:  717 CQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQK---PRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNN-----QGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWK-NVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFI---AAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCP 2408
            C+ ++ + C KYL G  VYV       ++++ + + VA +  +L++     C ++++   C+     C++D K   P R C++DCE +    C    KL     K+ +   +P C  L        + C R        V  K    +Y CYNGTG +Y+G ++ T +G PC++WK N P ++     +N+CRNPR     Q +APWC+       E C + +C +                   I    ++ FV + + +    ++S         S  +++ +   + +P  +D K+S               D    +++F E +GEG F  V KA L+   N +  T     + +K L      ++   FK E  ++  L+ +NVL LVGVS  + P  ++F++ E  D+H  L     + + S    PA   D   D  +   D++     A Q+ASGM YL+  +F+HRDLAARN  I E+ + KIS++G+    Y +DY    GS+L LP+RWM PEA+    FT  SDVW++GV+LWEI+S G QP+ G++N E +E +R+ Q+L CP
Sbjct:    1 CEPYKGTFCSKYLKGKNVYVK------DRQQNVENKVATLIGILNRHVTDRCKEYVIPTLCNYIIPPCAKDSKKPRPIRFCRDDCEVLQNTVC----KLEFHYAKQRFAKMLPDCSVLPGPGSPEYKTCIR--------VTMKGEDNQY-CYNGTGEDYIGRLNVTKYGMPCLSWKSNDPVYK---LSHNFCRNPR----GQHEAPWCYVD-KNTYEYCVIPKCSEASDA---------------IMAVLILAFVSIIVYLKVQHRRSTLPNRDHSSSGSISKSTQSTLQQP-SSDFKQS------------LIDDANQGKVKFLELLGEGGFAKVCKAALM--RNETEYT--DVRLAIKRLKPNVPPQVVENFKNEISVLMGLQDINVLCLVGVSAGEEPLFMVFEYFEDMDMHRYL----NLHIPS----PAQLQDDLRDDCMHDPDEVLFLDFALQVASGMAYLAENNFIHRDLAARNCFITEDNIVKISNLGIGSCRYPADYSWVHGSSL-LPVRWMPPEALNSLHFTHRSDVWSFGVVLWEIYSYGRQPYSGYNNQEAIECIRNMQMLPCP 508          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO45490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSX1])

HSP 1 Score: 217.238 bits (552), Expect = 9.697e-65
Identity = 104/235 (44.26%), Postives = 154/235 (65.53%), Query Frame = 3
Query: 1755 IVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNE 2459
            IV VKTL  G S +++  F QE  +M+ L H N++ L+ VS  + P+ +IF+FM +GDL      N  M  R   ++  +        +L+  D + I+ Q++SGME+L S  FVHRDLA RN L+G+ L+ KI+D G+ +D Y+SDYY+  G  +M PIRWM PEA+ +GRFTVESDV+++GVLLWE+++  LQP+YG++N EV   ++    L  P++CP  +YD+M  CWN+
Sbjct:    3 IVAVKTLKQGCSNEMKTSFLQEVTLMAVLHHPNIVELLAVSTEEEPYGMIFEFMSQGDL------NQYMRKRGPYSLEEEK-------SLTQEDLLSISLQVSSGMEHLQSMRFVHRDLATRNCLVGDGLVVKIADFGMSRDVYASDYYKVEGQAVM-PIRWMPPEALLYGRFTVESDVYSFGVLLWEVYAFALQPYYGYTNEEVCGFIKKGVHLGKPEDCPDHIYDVMKSCWNK 223          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO39761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S933])

HSP 1 Score: 214.542 bits (545), Expect = 1.135e-63
Identity = 106/230 (46.09%), Postives = 149/230 (64.78%), Query Frame = 3
Query: 1818 EAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIR 2507
            +  +MS L H NV+ L+ VS  + P+ +IF+FM +GDL+  L S    E  S    P D+ D  G           IA Q+A+GMEY++S  FVHRDLA RN L+G +++ KI+D G+ +D Y SDYY+ +  T MLPIRW++PEA  +G+FTV+SDV++YGVLLWEI++ GLQP+YG++N EV E ++    L  PD+CP  VY +M +CW+  P  R  F  I  R+R
Sbjct:   11 QVALMSILDHPNVVKLLAVSTEEEPYGMIFEFMGEGDLNHYLRSAKPAE-SSAYKGPDDAKDLVG-----------IAEQVAAGMEYVASLRFVHRDLATRNCLVGTDMVVKIADFGMSRDVYGSDYYKMSRET-MLPIRWLAPEAFLYGKFTVKSDVYSYGVLLWEIFTFGLQPYYGYTNKEVTEFIKKGIHLGRPDDCPQFVYLIMKDCWSREPEERVDFGLIQKRLR 227          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 207.223 bits (526), Expect = 4.761e-60
Identity = 112/290 (38.62%), Postives = 166/290 (57.24%), Query Frame = 3
Query: 1635 DYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRI 2504
            + P  +I+   ++G G FG VY+ E      N P       V VKT+S  +S++ + EF QEA +M   +  +V+ L+GV     P  ++ + M+ GDL   L S+   EV   S  P  ++             + +A +IA GM YL++R FVHRDLAARN ++  NL  KI D G+ +D Y +DYYR  G  L LP+RWM+PE++  G FT  SDVW++GV++WE+ +   QP+ G SN EV++ V    ++  PD+CP +++DLM  CW   P+ RP F +I S I
Sbjct:   12 EVPREKIKLIRELGNGSFGMVYEGEATDIVPNKP----KCKVAVKTVSENASIRDRIEFLQEASIMKAFQCNHVVRLLGVVSDGQPTLVVMELMDNGDLKNFLRSHRP-EVTMESDEPPPTL----------QQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNANLTVKIGDFGMTRDIYETDYYRKGGKGL-LPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQPYPGKSNEEVLKYVVDGGVMPKPDDCPDRLFDLMTLCWQFSPKARPTFLSIISLI 285          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ror1 (receptor tyrosine kinase like orphan receptor 1 [Source:NCBI gene;Acc:101166863])

HSP 1 Score: 441.81 bits (1135), Expect = 4.557e-139
Identity = 270/777 (34.75%), Postives = 408/777 (52.51%), Query Frame = 3
Query:  246 LIIIVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            LI+      L Q  S   A  + +T S        +++++  + N+T  +G+   L C +SG P+P + W K   P+V    ++ IR   +GS L+I +LD +D G++ C A N+ G  +TT  + V       D  P         + +     G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S Q    C +  +   CH  F  C   S   KPR LC+++CE +    C   Y +          + +P CE+L  +       C R      +P+  +P  K + CYN +G +Y GTVS T  G  C  W +            + ++   ++YCRNP      + +APWCFT   G R E+C +  C  DH+   S N      L   ++I   I  +   I +C   + S      +     L R   L I            S L    K K  + + PLS +RF E++GE  FG +YK  L       P    + +V +KTL   S+ K   +F+QE+ +++EL+H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + IA Q+++GMEYL+S  ++H+DLAARNIL+GE L  KISD+GL ++ YSSDYY     TL LPIRWM PEAIA+G+FT +SD+W++GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP + Y LM ECW E P  RP+FK+IH+R+R W+
Sbjct:   29 LILSATGAELPQEPSMLAATSLNKTGSP-------FIRIDAPMNNITTSLGQTAELLCRVSGNPQPEVRWLKNDAPVVQEPRRVSIRSMPYGSRLRIRNLDTTDTGYFQCMASNSKGSVSTTGVLFV-----KFDPHPTPLPGRPMDDFD---EDGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNQLSDRCSQFAIPSLCHFAFPTCDRSSGSDKPRDLCKDECEILENDLCKTEYIIARSNPHILKRLKLPNCEELAASDSPEAANCLRI----GIPMP-EPINKNHKCYNSSGVDYRGTVSVTKSGRQCQPWNSQYPHSHTYLAVRYPELNGGHSYCRNP----GNKHEAPWCFTLDEGVRMELCDISIC--DHNEKASGNMEILYILVPSVAIPLAIALLFFFICVCRNNQMS--ARPPAPRQPKLVRGQNLEI------------SVLNTAYKSKGKAKELPLSAVRFMEELGECNFGKIYKGHLY-----LPGMDQAQLVAIKTLKDVSNTKQWADFQQESAVLAELQHPNVVCLLGVVTQEHPVCMLFEFLPQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQVSAGMEYLASHFYIHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYCIQPKTL-LPIRWMPPEAIAYGKFTTDSDIWSFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRFYGLMTECWQEGPARRPRFKDIHTRLRAWE 751          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ror1 (receptor tyrosine kinase like orphan receptor 1 [Source:NCBI gene;Acc:101166863])

HSP 1 Score: 441.81 bits (1135), Expect = 4.557e-139
Identity = 270/777 (34.75%), Postives = 408/777 (52.51%), Query Frame = 3
Query:  246 LIIIVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            LI+      L Q  S   A  + +T S        +++++  + N+T  +G+   L C +SG P+P + W K   P+V    ++ IR   +GS L+I +LD +D G++ C A N+ G  +TT  + V       D  P         + +     G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S Q    C +  +   CH  F  C   S   KPR LC+++CE +    C   Y +          + +P CE+L  +       C R      +P+  +P  K + CYN +G +Y GTVS T  G  C  W +            + ++   ++YCRNP      + +APWCFT   G R E+C +  C  DH+   S N      L   ++I   I  +   I +C   + S      +     L R   L I            S L    K K  + + PLS +RF E++GE  FG +YK  L       P    + +V +KTL   S+ K   +F+QE+ +++EL+H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + IA Q+++GMEYL+S  ++H+DLAARNIL+GE L  KISD+GL ++ YSSDYY     TL LPIRWM PEAIA+G+FT +SD+W++GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP + Y LM ECW E P  RP+FK+IH+R+R W+
Sbjct:   29 LILSATGAELPQEPSMLAATSLNKTGSP-------FIRIDAPMNNITTSLGQTAELLCRVSGNPQPEVRWLKNDAPVVQEPRRVSIRSMPYGSRLRIRNLDTTDTGYFQCMASNSKGSVSTTGVLFV-----KFDPHPTPLPGRPMDDFD---EDGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNQLSDRCSQFAIPSLCHFAFPTCDRSSGSDKPRDLCKDECEILENDLCKTEYIIARSNPHILKRLKLPNCEELAASDSPEAANCLRI----GIPMP-EPINKNHKCYNSSGVDYRGTVSVTKSGRQCQPWNSQYPHSHTYLAVRYPELNGGHSYCRNP----GNKHEAPWCFTLDEGVRMELCDISIC--DHNEKASGNMEILYILVPSVAIPLAIALLFFFICVCRNNQMS--ARPPAPRQPKLVRGQNLEI------------SVLNTAYKSKGKAKELPLSAVRFMEELGECNFGKIYKGHLY-----LPGMDQAQLVAIKTLKDVSNTKQWADFQQESAVLAELQHPNVVCLLGVVTQEHPVCMLFEFLPQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQVSAGMEYLASHFYIHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYCIQPKTL-LPIRWMPPEAIAYGKFTTDSDIWSFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRFYGLMTECWQEGPARRPRFKDIHTRLRAWE 751          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ror1 (receptor tyrosine kinase like orphan receptor 1 [Source:NCBI gene;Acc:101166863])

HSP 1 Score: 431.024 bits (1107), Expect = 1.254e-135
Identity = 262/735 (35.65%), Postives = 394/735 (53.61%), Query Frame = 3
Query:  372 LTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMC---SEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQG-----CFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKN---------VPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDV--TLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQ 2516
            + N+T  +G+   L C +SG P+P + W K   P+V    ++ IR   +GS L+I +LD +D G++ C A N+ G  +TT  + V        K P    +  + ++ +    G+CQ ++  +C +++    ++V   ++Q E E +I +    I +  S Q    C +  +   CH  F  C   S   KPR LC+++CE +    C   Y +          + +P CE+L  +       C R      +P+  +P  K + CYN +G +Y GTVS T  G  C  W +            + ++   ++YCRN    P  + +APWCFT   G R E+C +  C  DH+   S N      L   ++I   I  +   I +C   + S      +     L R   L I            S L    K K  + + PLS +RF E++GE  FG +YK  L       P    + +V +KTL   S+ K   +F+Q A +++EL+H NV+ L+GV  ++ P C++F+F+ +GDLHE LI      +RS  +    S D  G V  +L + D + IA Q+++GMEYL+S  ++H+DLAARNIL+GE L  KISD+GL ++ YSSDYY     TL LPIRWM PEAIA+G+FT +SD+W++GV+LWEI+S GLQP+YG SN EVME+VR RQ+L CP++CP + Y LM ECW E P  RP+FK+IH+R+R W+
Sbjct:    1 MNNITTSLGQTAELLCRVSGNPQPEVRWLKNDAPVVQEPRRVSIRSMPYGSRLRIRNLDTTDTGYFQCMASNSKGSVSTTGVLFVKFG----KKTPPPPTKSGYWDDFD--EDGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGT--SNQLSDRCSQFAIPSLCHFAFPTCDRSSGSDKPRDLCKDECEILENDLCKTEYIIARSNPHILKRLKLPNCEELAASDSPEAANCLRI----GIPMP-EPINKNHKCYNSSGVDYRGTVSVTKSGRQCQPWNSQYPHSHTYLAVRYPELNGGHSYCRN----PGNKHEAPWCFTLDEGVRMELCDISIC--DHNEKASGNMEILYILVPSVAIPLAIALLFFFICVCRNNQMS--ARPPAPRQPKLVRGQNLEI------------SVLNTAYKSKGKAKELPLSAVRFMEELGECNFGKIYKGHLY-----LPGMDQAQLVAIKTLKDVSNTKQWADFQQSA-VLAELQHPNVVCLLGVVTQEHPVCMLFEFLPQGDLHEFLI------MRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQVSAGMEYLASHFYIHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYCIQPKTL-LPIRWMPPEAIAYGKFTTDSDIWSFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDCPPRFYGLMTECWQEGPARRPRFKDIHTRLRAWE 689          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ror2 (receptor tyrosine kinase like orphan receptor 2 [Source:NCBI gene;Acc:101175048])

HSP 1 Score: 428.328 bits (1100), Expect = 3.259e-134
Identity = 262/743 (35.26%), Postives = 394/743 (53.03%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINY-KIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTW--------KNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLV----QLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            +L+  + + N+T   G+  TL C ++G PRP I W K   P VD++  +I IR++  GS L+I++LD +D G+Y C A N+F   + T  + V      +  IP    ++         +KG+CQ ++  +C ++L    +YV   + Q E+E RI +    I +  S Q   +C K  +   C+  F +C E    Q+ R+LC+++CE +    C+  Y +          + +P+C  L          C R    P     + P   ++ CYNG+G +Y GTVS T  G  C  W        ++   + ++ A +N+CRNP      Q +APWCFT     R ++C +  C    SP     K     L   +SI  V+  +   +  C   K     ++G+ HS+               N C   E  L     Q N  K+   +  +S +RF E++GE  FG VYK  L G+   +P   N  IV +KTL+  + + L  EF+ EA     L+H N++SL+GV  ++ P  +IF +   GDLHE L+ ++       S V +   D     T+   D + I  QIA+GMEYLSS   VH+DLAARNIL+ + L  KI D+GL++D YS+DYY     T   PIRWMSPEAI +G+F+ +SD+W+YGVLLWE +S GLQP+ G+SN +V+E+VRS Q+L CP++CPT +Y LMLECW+E+P  RP+FK+IH+R+  W
Sbjct:   50 FLEFLEPVNNITHFQGQTATLHCKVAGNPRPLIQWLKNDAP-VDLDLGRITIRKTEAGSKLRIQELDTTDTGYYQCVASNSFKVISATGVLYV-----KLGLIPTHGPDKP------KNNKGFCQPYRGIACARFLGNQSIYVESLQTQGERENRITAAFTMIGT--STQLSDQCSKFAIPSFCYYVFPLCDESWRSQRQRQLCRDECEALENDLCHVEYTIARSNPMILMQLELPRCHLLPRPGTPEAASCIRIGVPPERLGSSSP--SDHSCYNGSGADYRGTVSTTRSGRSCQPWSLQLPHSHRSTQEYPELWASHNFCRNP----GGQMEAPWCFTLDPEMRMDLCDIPPCKPPESP----GKEILLILIPAVSIPLVVACLFFLVCTCR-SKHKASSSSGAPHSH--------------LNTCANQEVQLSLLSPQKNPTKLREIN--MSTVRFMEELGEDRFGKVYKGHLYGT---APGEQNQ-IVAIKTLNDKADLTLCEEFRHEASTRCLLQHQNIVSLIGVVTKEQPMSMIFTYSSLGDLHEYLVMHSPN-----SDVGSSDDDRTTKSTVEQADFLSIITQIAAGMEYLSSHQVVHKDLAARNILVFDKLNIKILDLGLLRDVYSADYYNLM-RTSPFPIRWMSPEAIVYGKFSTDSDIWSYGVLLWETYSYGLQPYCGYSNLDVIEMVRSHQLLPCPEDCPTWIYALMLECWSELPVRRPRFKDIHARLLSW 741          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: ror2 (receptor tyrosine kinase like orphan receptor 2 [Source:NCBI gene;Acc:101175048])

HSP 1 Score: 425.631 bits (1093), Expect = 1.891e-133
Identity = 259/742 (34.91%), Postives = 396/742 (53.37%), Query Frame = 3
Query:  351 YLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINY-KIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSR---SKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSED---QKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLH-----NNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTW--------KNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNR-EVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVW 2513
            +L+  + + N+T   G+  TL C ++G PRP I W K   P VD++  +I IR++  GS L+I++LD +D G+Y C A N+F             + + +  + +  +  E     + R   +KG+CQ ++  +C ++L    +YV   + Q E+E RI +    I +  S Q   +C K  +   C+  F +C E    Q+ R+LC+++CE +    C+  Y +          + +P+C  L          C R      VP +      ++ CYNG+G +Y GTVS T  G  C  W        ++   + ++ A +N+CRNP      Q +APWCFT     R ++C +  C    SP     K     L   +SI  V+  +   +  C   K     ++G+ HS+  T          C N  ++ + SL+   K      +  +S +RF E++GE  FG VYK  L G+   +P   N  IV +KTL+  + + L  EF+ EA     L+H N++SL+GV  ++ P  +IF +   GDLHE L+ ++       S V +   D     T+   D + I  QIA+GMEYLSS   VH+DLAARNIL+ + L  KI D+GL++D YS+DYY     T   PIRWMSPEAI +G+F+ +SD+W+YGVLLWE +S GLQP+ G+SN +V+E+VRS Q+L CP++CPT +Y LMLECW+E+P  RP+FK+IH+R+  W
Sbjct:   25 FLEFLEPVNNITHFQGQTATLHCKVAGNPRPLIQWLKNDAP-VDLDLGRITIRKTEAGSKLRIQELDTTDTGYYQCVASNSF----------KVISATGVLYVKLGKDGGEIEHGADDRCRNNKGFCQPYRGIACARFLGNQSIYVESLQTQGERENRITAAFTMIGT--STQLSDQCSKFAIPSFCYYVFPLCDESWRSQRQRQLCRDECEALENDLCHVEYTIARSNPMILMQLELPRCHLLPRPGTPEAASCIRI----GVPPERLASPSDHSCYNGSGADYRGTVSTTRSGRSCQPWSLQLPHSHRSTQEYPELWASHNFCRNP----GGQMEAPWCFTLDPEMRMDLCDIPPCKPPESP----GKEILLILIPAVSIPLVVACLFFLVCTCR-SKHKASSSSGAPHSHLNT----------CAN--QEVQLSLLSPQKNPTKLREINMSTVRFMEELGEDRFGKVYKGHLYGT---APGEQNQ-IVAIKTLNDKADLTLCEEFRHEASTRCLLQHQNIVSLIGVVTKEQPMSMIFTYSSLGDLHEYLVMHSPN-----SDVGSSDDDRTTKSTVEQADFLSIITQIAAGMEYLSSHQVVHKDLAARNILVFDKLNIKILDLGLLRDVYSADYYNLM-RTSPFPIRWMSPEAIVYGKFSTDSDIWSYGVLLWETYSYGLQPYCGYSNLDVIEMVRSHQLLPCPEDCPTWIYALMLECWSELPVRRPRFKDIHARLLSW 718          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000041792.1 (SMESG000041792.1)

HSP 1 Score: 1715.28 bits (4441), Expect = 0.000e+0
Identity = 866/868 (99.77%), Postives = 868/868 (100.00%), Query Frame = 3
Query:  222 MLKCSKKLLIIIVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGXXXXXXXXXXXXXXSSIDKIPVXXXXXXXXXXXXSRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEINPNCIGAGSARXXXXXXXXXXXXXXXEMCSDHSHLLTGYSPATCQTNQDPSTNGIVNNITFNQQFDPPSLLSQSGPMHFSRLPNTNTIYLPELSHIV 2825
            MLKCSKKLLIIIVY++FLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGYTNTTAYVTVTKTKSSIDKIPVENEEEEFIENEESRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEINPNCIGAGSARSVSHSGGSKHTTSSTEMCSDHSHLLTGYSPATCQTNQDPSTNGIVNNITFNQQFDPPSLLSQSGPMHFSRLPNTNTIYLPELSHIV
Sbjct:    1 MLKCSKKLLIIIVYLIFLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKILTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWGSTLKIEDLDFSDEGFYTCQAENTFGYTNTTAYVTVTKTKSSIDKIPVENEEEEFIENEESRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIASLVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDVTKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQGCFRFNELPAVPVKTKPPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYCRNPRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPVYISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQNDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEINPNCIGAGSARSVSHSGGSKHTTSSTEMCSDHSHLLTGYSPATCQTNQDPSTNGIVNNITFNQQFDPPSLLSQSGPMHFSRLPNTNTIYLPELSHIV 868          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000042606.1 (SMESG000042606.1)

HSP 1 Score: 190.66 bits (483), Expect = 1.696e-49
Identity = 103/301 (34.22%), Postives = 167/301 (55.48%), Query Frame = 3
Query: 1647 SQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIR-----VWQQEDVEI 2534
            ++I  + Q+G G +G VY+A              S  V VKT+   + + +  +F +EA++M  L+H N++ L+GV  ++ P  +I +FME G+L E L        RS   +P   +             +++A QIA+GMEYL   +F+HRDLAARN L+G++ + K++D GL + C   D   T       PI+W +PE +A+ +F+ +SDVWA+GVLLWE+ + G+ P+ G    +V   +    I++ P  CP  +YD+M +CW   P  RP FK++H+ +      + +Q D+EI
Sbjct:  253 TEIMMKNQLGSGQYGIVYEAFW---------KKYSITVAVKTVK--TDITVADDFLEEARLMKSLQHPNLVRLLGVCTQEPPNYIIAEFMENGNLLEYL------RTRSKEDLPPPVL-------------LYMAIQIAAGMEYLEQHNFIHRDLAARNCLVGQDNIVKVADFGLAR-CMERDDTYTAHVGAKFPIKWTAPEGLAYNQFSTKSDVWAFGVLLWELATYGMTPYPGIELQDVYVYLEKGNIMNRPAGCPDNIYDIMKQCWQWFPESRPSFKDLHNELEKMLSNINEQIDLEI 522          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000056885.1 (SMESG000056885.1)

HSP 1 Score: 183.341 bits (464), Expect = 2.922e-47
Identity = 97/286 (33.92%), Postives = 158/286 (55.24%), Query Frame = 3
Query: 1647 SQIRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRI 2504
            S+I   +++G G +G VY+A     N          ++ VKTL    ++K++ +F +EA +M  L+H N++ L+GV I++ P+ LI +++ KG+L   L     +EV                     +  +++A QIA GM YL   +F+HRDLAARN L+G+N + K+ D GL +     D Y T       PI+W +PE +AF +F+ +SD+WA+GV+LWE+ + GL P+ G    +V  ++     +  P+ CP  VY +ML+CW   P  RP F  ++S++
Sbjct:  247 SEILMHQKLGGGQYGDVYEAVWKRYN---------VVIAVKTLKEDLNLKIE-DFLKEALVMKNLRHKNLVQLLGVCIKEPPFYLITEYISKGNLLHFLRKCNQLEVTP-------------------SILLYMATQIADGMTYLEENNFIHRDLAARNCLVGDNYLLKVGDFGLARYIQRDDSY-TAKIGAKFPIKWTAPEGLAFNKFSSKSDIWAFGVVLWELATYGLSPYPGIELHDVYHILEKGYRMDRPEGCPEIVYGIMLQCWQWDPLLRPSFAQLYSKL 502          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000016930.1 (SMESG000016930.1)

HSP 1 Score: 176.792 bits (447), Expect = 4.037e-46
Identity = 106/299 (35.45%), Postives = 153/299 (51.17%), Query Frame = 3
Query: 1653 IRFQEQIGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGLIKDCY-SSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIRVWQQEDVEINPNC 2546
            I   +++G G FG VY+           I   ++ V VKTL  G+  K   EF +EA++M  L H N++ L  V   + P  ++ + M KG L E L            T   + MD              + +QIA+GM YL    ++HRDLAARNILIGEN +CKI+D GL +    SSD Y         PI+W +PEA   G+FTV+SDVW+YG++L+EI ++G  PF   +N + ++ V     +  P NCP ++Y +ML CW  +P  RP FK +      +   +    P C
Sbjct:  360 IELLKKLGSGNFGEVYQG----------IWNKTTDVAVKTLKPGTMAK--EEFLKEARIMKRLNHSNLVRLYAVCSDE-PIYIVTELMTKGSLLEYL------REEGKHTELKELMD--------------MMSQIANGMAYLEKEGYIHRDLAARNILIGENNICKIADFGLTRVIQGSSDTYNARQGA-KFPIKWTAPEAALMGKFTVKSDVWSYGIVLYEIITHGQTPFPAMNNTQTLQQVEKGYRMPKPSNCPQELYKVMLYCWEALPENRPTFKYLSEFFDDFSSAECSYKPAC 624          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000077240.1 (SMESG000077240.1)

HSP 1 Score: 177.178 bits (448), Expect = 5.690e-45
Identity = 106/282 (37.59%), Postives = 153/282 (54.26%), Query Frame = 3
Query: 1671 IGEGIFGAVYKAELVGSNNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVGVSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVTLSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGL---IKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEIWSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRYRPQFKNIHSRIR 2507
            IG+G FG VY+  L    +         IV VK L  G+S K + +F  EA  M +  + NVL L GV      + +I +FM  G L   L     ++   ++T+    M                 + +A+GM+YLSS  F+HRDLAARNIL+ ENL+CK++D GL   + D  + D Y T      LPI+W +PEAI +G+F+  SDVW++GV+ WE+ S G +P++  SN EV++ ++S   L  P NCP  +++LML CWN     RP F +I   I 
Sbjct:  661 IGQGEFGHVYQGVLFVPEDER------KIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSNSYMIITEFMVNGSLLTFL----RIKKNELTTIQLLKM----------------LSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIY-TNKPDGKLPIKWTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIE 915          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ROR13.524e-13935.15receptor tyrosine kinase like orphan receptor 1 [S... [more]
ROR16.205e-13935.06receptor tyrosine kinase like orphan receptor 1 [S... [more]
ROR23.616e-13234.32receptor tyrosine kinase like orphan receptor 2 [S... [more]
ROR24.440e-11735.81receptor tyrosine kinase like orphan receptor 2 [S... [more]
MUSK5.508e-7741.19muscle associated receptor tyrosine kinase [Source... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cam-11.325e-6743.25Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-14.973e-6743.25Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-17.906e-6743.25Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
src-29.724e-4635.49Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
src-17.190e-4534.02Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ror9.953e-8946.60gene:FBgn0010407 transcript:FBtr0079978[more]
Nrk2.866e-7829.84gene:FBgn0020391 transcript:FBtr0087728[more]
Alk7.478e-5235.29gene:FBgn0040505 transcript:FBtr0087118[more]
Alk7.478e-5235.29gene:FBgn0040505 transcript:FBtr0331926[more]
Eph6.146e-4938.60gene:FBgn0025936 transcript:FBtr0301285[more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ror15.693e-14435.29receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ror17.070e-14435.29receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ror28.424e-13433.25receptor tyrosine kinase-like orphan receptor 2 [S... [more]
ror28.424e-13433.25receptor tyrosine kinase-like orphan receptor 2 [S... [more]
musk1.674e-9230.58muscle, skeletal, receptor tyrosine kinase [Source... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ROR13.643e-14434.77receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ROR14.011e-14435.70receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ROR12.122e-14334.59receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ROR13.219e-14335.58receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ROR17.584e-14335.70receptor tyrosine kinase-like orphan receptor 1 [S... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ror11.328e-13935.54receptor tyrosine kinase-like orphan receptor 1 [S... [more]
Ror21.106e-13233.96receptor tyrosine kinase-like orphan receptor 2 [S... [more]
Ror21.727e-13233.96receptor tyrosine kinase-like orphan receptor 2 [S... [more]
Musk3.610e-7737.80muscle, skeletal, receptor tyrosine kinase [Source... [more]
Musk4.129e-7736.17muscle, skeletal, receptor tyrosine kinase [Source... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z139|ROR1_MOUSE9.291e-13935.54Inactive tyrosine-protein kinase transmembrane rec... [more]
sp|Q01973|ROR1_HUMAN2.980e-13835.06Inactive tyrosine-protein kinase transmembrane rec... [more]
sp|Q9Z138|ROR2_MOUSE1.208e-13133.96Tyrosine-protein kinase transmembrane receptor ROR... [more]
sp|Q01974|ROR2_HUMAN1.737e-13134.32Tyrosine-protein kinase transmembrane receptor ROR... [more]
sp|Q8AXY6|MUSK_CHICK4.315e-9131.37Muscle, skeletal receptor tyrosine protein kinase ... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMI90.000e+099.88Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A1B1M0P62.366e-14335.26Tyrosine-protein kinase receptor OS=Platynereis du... [more]
A0A4W5REF51.582e-14235.82Receptor tyrosine kinase-like orphan receptor 1 OS... [more]
A0A4W5RQJ11.205e-14135.55Receptor tyrosine kinase-like orphan receptor 1 OS... [more]
A0A1S3P9H92.869e-14135.42tyrosine-protein kinase transmembrane receptor ROR... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ror13.113e-14335.76receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ror13.316e-14335.63receptor tyrosine kinase-like orphan receptor 1 [S... [more]
ror22.954e-13735.88receptor tyrosine kinase like orphan receptor 2 [S... [more]
ror23.178e-13735.32receptor tyrosine kinase like orphan receptor 2 [S... [more]
MUSK1.822e-8631.65muscle associated receptor tyrosine kinase [Source... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001705.13.913e-7145.34pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
NTRK25.159e-6239.78neurotrophic receptor tyrosine kinase 2 [Source:HG... [more]
ENSPMAT00000009485.13.067e-5535.29pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000009481.14.565e-5432.47pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
frk3.008e-5333.85fyn-related Src family tyrosine kinase [Source:ZFI... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK32.120e-1726.24cAMP-dependent protein kinase catalytic subunit; p... [more]
BCK14.011e-1724.54MAPKKK acting in the protein kinase C signaling pa... [more]
CTK11.096e-1427.14Catalytic (alpha) subunit of C-terminal domain kin... [more]
TPK13.263e-1424.53cAMP-dependent protein kinase catalytic subunit; p... [more]
CLA45.117e-1421.58Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO482155.211e-9530.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439936.017e-7230.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454909.697e-6544.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397611.135e-6346.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476524.761e-6038.62Tyrosine-protein kinase receptor [Source:UniProtK... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ror14.557e-13934.75receptor tyrosine kinase like orphan receptor 1 [S... [more]
ror14.557e-13934.75receptor tyrosine kinase like orphan receptor 1 [S... [more]
ror11.254e-13535.65receptor tyrosine kinase like orphan receptor 1 [S... [more]
ror23.259e-13435.26receptor tyrosine kinase like orphan receptor 2 [S... [more]
ror21.891e-13334.91receptor tyrosine kinase like orphan receptor 2 [S... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041792.10.000e+099.77SMESG000041792.1[more]
SMESG000042606.11.696e-4934.22SMESG000042606.1[more]
SMESG000056885.12.922e-4733.92SMESG000056885.1[more]
SMESG000016930.14.037e-4635.45SMESG000016930.1[more]
SMESG000077240.15.690e-4537.59SMESG000077240.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029811 ID=SMED30029811|Name=Tyrosine-protein kinase receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=2984bp
CAATTATTCATATTGCATACTAGCACAAATGAAATTTGTATCGAGTCAGC
CGAAAGCCGACTGGTAGATGTGTACAATTCTGCACCCGTACACAAGATGG
TATTTGATTCTCGATTTCTCTCTGGCAATTATTGTTTCTCAAATTGGTTC
TAAATTTTATTATTTTTAATTCTTCGAATTTTTTCAAGATTCAGAATAAA
TAAATTCCAGATATCAAAATTATGCTGAAATGTTCGAAGAAATTGCTGAT
AATTATCGTATATATGGTTTTCCTCAATCAGCCAATCTCCGGTTTCACTG
CCAAAGATATTAAACAAACAGATTCTAAACAGCCTCCTCAATTCGAAGGC
TACCTTAAATTAAATAAAATTCTTACAAATGTCACTGGAAAAGTCGGAAA
GAAAATAACTCTTGAATGTGATATCAGTGGCAAACCGAGGCCAACCATTT
CATGGAAAAAGGCCAAATTACCATTAGTAGATATCAATTATAAAATTAAA
ATTCGACAGAGCCTTTGGGGAAGCACACTTAAAATAGAGGATCTTGATTT
CAGTGATGAAGGTTTTTACACTTGTCAAGCAGAAAATACTTTTGGATACA
CAAATACGACCGCATATGTGACAGTCACAAAAACAAAATCTTCGATAGAT
AAGATACCAGTGGAAAATGAGGAAGAGGAGTTCATTGAAAATGAAGAATC
AAGATCCAAAGGATATTGTCAAACATTCCAAAGCAGCTCATGCGGAAAAT
ATCTCAGCGGGCACATGGTGTATGTAACGCATGGCCGCGTACAAGCTGAA
AAAGAAAGACGTATCGCATCCTTGGTGGCGGAAATATCTTCGGTCCTCTC
CCAGCAAGCTGATCAGGAATGTCTGAAGCATATAATGCGTTTGACGTGCC
ATGACAACTTTTTGATGTGCAGTGAAGACCAAAAACCGAGGCGGTTATGT
CAAGAAGACTGCGAGGATGTCACTAAGAAACGATGCAACTACACTTACAA
ACTCATGCTCCAGAAATTGAAAAAAGATTATCTAGTTTCTGTTCCGAAAT
GTGAAAAATTACACAATAATCAAGGGTGTTTCAGATTTAATGAATTACCA
GCTGTACCGGTTAAAACAAAACCACCATTAAAAGAATATGACTGTTACAA
CGGTACTGGTCGGGAGTATGTGGGAACCGTTTCTCAGACAATTCATGGAA
CACCTTGTGTGACATGGAAAAACGTTCCGGGATTCGAGGATATGGTTGCA
GATAATAATTACTGTCGTAATCCAAGACTCGAGCCTACCCAACAACAGGA
TGCTCCTTGGTGTTTTACGAGTGTCACTGGCAATAGGGAGGTGTGCTCAG
TTCGGCAGTGTATAAAAGATCATTCTCCAAGTTTCTCCGACAACAAATCT
TTTCGAAATTTTCTTCCAGTTTATATTTCAATCGGCTGCGTAATTGGGTT
CGTTATTATGACGATTTCAATCTGCTGGATTTGTAAGAAATCAAAATTCG
GTACAAACGGCTCCTGCCATTCGAATGGACTTACAAGAAAAAGCTACCTC
GGAATTTATAAACCTTGCCAAAATGATTGCAAAAAATCAGAAAGCTCTTT
AGTTCAGTTAAACAAAATAAAAATCACTTCCACAGATTATCCGCTAAGTC
AAATTCGGTTTCAAGAGCAAATTGGGGAAGGAATTTTCGGTGCCGTGTAC
AAAGCAGAATTAGTCGGCTCGAATAATAATTCTCCGATTACCGGAAATAG
TAGTATTGTTATTGTAAAAACCCTTTCGGCTGGAAGCAGCGTAAAATTGC
AGGGAGAATTCAAACAAGAAGCTCAAATGATGAGTGAACTAAAGCACGTA
AATGTTCTTTCATTAGTCGGAGTATCAATAAGACAAATTCCTTGGTGTTT
GATTTTCGACTTTATGGAAAAGGGCGACCTTCATGAACTGTTGATATCAA
ATACAACAATGGAAGTCAGGTCCATTTCGACAGTTCCAGCCGACTCCATG
GACGCTTACGGGGACGTTACATTGAGTTATACTGATCAAATTTTTATTGC
CGCTCAAATTGCGAGTGGCATGGAGTATTTATCTAGTCGCAGTTTCGTTC
ATCGAGATTTAGCCGCAAGAAATATATTAATCGGGGAAAATTTGATGTGC
AAAATAAGTGATATAGGATTGATAAAAGACTGTTACAGTTCGGATTATTA
TCGCACGACAGGCAGTACACTAATGCTTCCCATCAGATGGATGTCTCCAG
AAGCAATCGCATTTGGCAGGTTCACTGTCGAGTCTGATGTTTGGGCATAT
GGAGTGTTATTGTGGGAAATCTGGTCCAATGGATTGCAACCTTTCTATGG
TCACTCAAACGCTGAAGTTATGGAATTGGTTCGATCTCGACAAATTCTTT
CTTGTCCCGATAATTGTCCTACGAAAGTCTACGATTTGATGTTAGAATGT
TGGAATGAAATGCCAAGATATCGGCCACAATTCAAGAATATCCATTCCAG
AATTCGTGTTTGGCAGCAGGAAGACGTGGAAATCAATCCAAACTGCATCG
GGGCCGGCAGTGCAAGATCTGTCAGTCATTCTGGTGGTTCAAAACACACA
ACATCCAGCACGGAAATGTGTTCTGATCATAGTCACTTATTGACGGGCTA
TTCCCCAGCCACTTGTCAGACGAATCAAGATCCATCGACAAACGGAATCG
TAAATAATATAACATTTAATCAACAATTCGACCCCCCTTCATTGCTTTCT
CAGTCCGGTCCAATGCACTTCTCCAGGTTACCTAATACGAACACAATTTA
TTTGCCCGAACTCAGTCACATTGTCTAACTTGAAATTAATCCATTTATAC
ATATAAATTTTGTAAACCTATTATTTTGTCTATATTATATATATATATAA
ATATAATTTGATGAATTATTTTCCGGATATCCTTTGTAAATGTCTGTTGT
TTTAATGCTCGTTTGTTGATTTATGTACAGCGAC
back to top

protein sequence of SMED30029811-orf-1

>SMED30029811-orf-1 ID=SMED30029811-orf-1|Name=SMED30029811-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=869bp
MLKCSKKLLIIIVYMVFLNQPISGFTAKDIKQTDSKQPPQFEGYLKLNKI
LTNVTGKVGKKITLECDISGKPRPTISWKKAKLPLVDINYKIKIRQSLWG
STLKIEDLDFSDEGFYTCQAENTFGYTNTTAYVTVTKTKSSIDKIPVENE
EEEFIENEESRSKGYCQTFQSSSCGKYLSGHMVYVTHGRVQAEKERRIAS
LVAEISSVLSQQADQECLKHIMRLTCHDNFLMCSEDQKPRRLCQEDCEDV
TKKRCNYTYKLMLQKLKKDYLVSVPKCEKLHNNQGCFRFNELPAVPVKTK
PPLKEYDCYNGTGREYVGTVSQTIHGTPCVTWKNVPGFEDMVADNNYCRN
PRLEPTQQQDAPWCFTSVTGNREVCSVRQCIKDHSPSFSDNKSFRNFLPV
YISIGCVIGFVIMTISICWICKKSKFGTNGSCHSNGLTRKSYLGIYKPCQ
NDCKKSESSLVQLNKIKITSTDYPLSQIRFQEQIGEGIFGAVYKAELVGS
NNNSPITGNSSIVIVKTLSAGSSVKLQGEFKQEAQMMSELKHVNVLSLVG
VSIRQIPWCLIFDFMEKGDLHELLISNTTMEVRSISTVPADSMDAYGDVT
LSYTDQIFIAAQIASGMEYLSSRSFVHRDLAARNILIGENLMCKISDIGL
IKDCYSSDYYRTTGSTLMLPIRWMSPEAIAFGRFTVESDVWAYGVLLWEI
WSNGLQPFYGHSNAEVMELVRSRQILSCPDNCPTKVYDLMLECWNEMPRY
RPQFKNIHSRIRVWQQEDVEINPNCIGAGSARSVSHSGGSKHTTSSTEMC
SDHSHLLTGYSPATCQTNQDPSTNGIVNNITFNQQFDPPSLLSQSGPMHF
SRLPNTNTIYLPELSHIV*
back to top
Aliases
The feature 'Tyrosine-protein kinase receptor' has the following synonyms
Synonym
Smed_26962
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR038178Kringle_sf
IPR036179Ig-like_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000001Kringle
IPR003599Ig_sub
IPR003598Ig_sub2
IPR020635Tyr_kinase_cat_dom
IPR013783Ig-like_fold
IPR020067Frizzled_dom
IPR013098Ig_I-set
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR007110Ig-like_dom
IPR000719Prot_kinase_dom
IPR013806Kringle-like
IPR011009Kinase-like_dom_sf
IPR010636Cerato-ulmin_hydrophobin
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 619..637
score: 62.63
coord: 732..754
score: 45.97
coord: 562..575
score: 34.81
coord: 688..710
score: 54.37
coord: 669..679
score: 59.33
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 478..760
e-value: 2.3E-82
score: 276.2
IPR000001KringleSMARTSM00130KR_2coord: 306..382
e-value: 6.3E-10
score: 49.0
IPR000001KringlePFAMPF00051Kringlecoord: 308..380
e-value: 2.1E-9
score: 37.6
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 307..380
score: 15.011
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 478..761
e-value: 3.9E-109
score: 378.6
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 57..125
e-value: 8.2E-15
score: 65.2
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 51..136
e-value: 1.4E-12
score: 57.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 26..140
e-value: 1.3E-20
score: 75.4
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 47..135
e-value: 3.8E-17
score: 62.1
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 23..84
e-value: 1.0
score: 5.0
coord: 581..829
e-value: 1.1E-50
score: 170.4
coord: 57..171
e-value: 3.1E-4
score: 16.6
coord: 470..600
e-value: 0.096
score: 8.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 565..774
e-value: 3.7E-51
score: 175.3
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 470..564
e-value: 3.3E-22
score: 80.3
NoneNo IPR availablePANTHERPTHR24416:SF134INACTIVE TYROSINE-PROTEIN KINASE TRANSMEMBRANE RECEPTOR ROR1coord: 44..800
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 44..800
NoneNo IPR availableCDDcd00096Igcoord: 62..132
e-value: 4.20669E-15
score: 68.808
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.801
NoneNo IPR availableTMHMMTMhelixcoord: 398..420
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 163..289
e-value: 2.8E-19
score: 71.5
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 290..385
e-value: 1.7E-14
score: 55.7
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 484..516
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 625..637
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 39..136
score: 13.003
IPR020067Frizzled domainPROSITEPS50038FZcoord: 161..289
score: 11.137
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 478..761
score: 35.1
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 51..136
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 473..767
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 306..386