CIA30 domain-containing protein

Overview
NameCIA30 domain-containing protein
Smed IDSMED30029806
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CIA30 domain-containing protein (SMED30029806) t-SNE clustered cells

Violin plots show distribution of expression levels for CIA30 domain-containing protein (SMED30029806) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CIA30 domain-containing protein (SMED30029806) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CIA30 domain-containing protein (SMED30029806) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029806

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029806h1SMcG0011272 SmedASXL_013307SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30029806h1SMcG0011272 dd_Smed_v4_8887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029806h1SMcG0011272 dd_Smed_v4_8887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029806h1SMcG0011272 dd_Smed_v4_8887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CIA30 domain-containing protein vs. Ensembl Human
Match: NDUFAF1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:18828])

HSP 1 Score: 133.65 bits (335), Expect = 5.021e-35
Identity = 72/208 (34.62%), Postives = 110/208 (52.88%), Query Frame = 3
Query:  291 PVHHL---NCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYET 905
            P+H +     K++  F     E + +WTV++DKTI G S           + +  G L +     G   RSG   + S      F    +Y+++ FN + +R RGDGR + +NI +   F      +  + ++TRGGP WQ  KIPF+KFF +++GR  DVQHE     +  I  TL DK+ GPF+LEID+I +  +  + E+F+YE 
Sbjct:  112 PLHEVLLEQAKVVWQF--RGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYEN 317          
BLAST of CIA30 domain-containing protein vs. Ensembl Human
Match: NDUFAF1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:18828])

HSP 1 Score: 68.1662 bits (165), Expect = 2.851e-12
Identity = 43/150 (28.67%), Postives = 68/150 (45.33%), Query Frame = 3
Query:  291 PVHHL---NCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKF 731
            P+H +     K++  F     E + +WTV++DKTI G S           + +  G L +     G   RSG   + S      F    +Y+++ FN + +R RGDGR + +NI +   F      +  + ++TRGGP WQ  K    K 
Sbjct:  112 PLHEVLLEQAKVVWQF--RGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKATLLKL 259          
BLAST of CIA30 domain-containing protein vs. Ensembl Celegans
Match: nuaf-1 (Probable complex I intermediate-associated protein 30, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q18726])

HSP 1 Score: 134.035 bits (336), Expect = 1.810e-35
Identity = 73/189 (38.62%), Postives = 105/189 (55.56%), Query Frame = 3
Query:  345 EQISRWTVSTDKTI-NGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E++  W +  D     G ST S V + + GT +FSGN+ T ++  G   R+G  ++K  D+ +         + +F+ +L++ RGDGRSY + +H     DF   D    PL+T GGP WQ EKIPF+KFF T  GR  D Q+         I + LMD+I G F LEIDYI +  ++ + E F+YETY
Sbjct:  143 EKLDLWKIGCDSDWKEGFSTCSLV-NSDRGTAVFSGNISTKVLKDGRVERAGWASMKLEDRKAFNRKKFLSKWRNFSHLLLKVRGDGRSYKIMLHSPLSMDFTWGDSFSHPLHTHGGPYWQYEKIPFSKFFHTVAGRIQDRQYRVNLEDTSSIGIVLMDRIDGDFRLEIDYIGVYNDTTHVEDFAYETY 330          
BLAST of CIA30 domain-containing protein vs. Ensembl Fly
Match: CIA30 (gene:FBgn0039689 transcript:FBtr0085473)

HSP 1 Score: 133.65 bits (335), Expect = 1.213e-35
Identity = 71/190 (37.37%), Postives = 104/190 (54.74%), Query Frame = 3
Query:  351 ISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQR--ISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETYFT 914
            + +WTV+TD       + + ++    G G+F G + +     G   R+G  N+++      F    TY++  +N ++++ RGDGRSY +N+H    FD    DI  + LYTRGGP WQ  KIPF+KFFL+SKGR  D Q     + V     SV     + GPF LEIDY+ L  +  + E+F+YE Y T
Sbjct:  100 LDKWTVTTDADHGEGKSTATLELSAAGAGLFHGQVNSDHTKDGIIKRTGYANIRTKRVRKSFKRETTYDWTQYNMLVMKVRGDGRSYLINLHTEGYFDLMWNDIYHYVLYTRGGPHWQIAKIPFSKFFLSSKGRVQDRQGAIPLNRVTHFGFSVAAKKGMDGPFGLEIDYVGLEYDPSHREEFAYEMYQT 289          
BLAST of CIA30 domain-containing protein vs. Ensembl Zebrafish
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:ZFIN;Acc:ZDB-GENE-050306-9])

HSP 1 Score: 135.961 bits (341), Expect = 2.591e-36
Identity = 73/188 (38.83%), Postives = 103/188 (54.79%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E ++ W VS+D+ I G S A         T +  G L +T    G    SG  +++S    + F   + Y+++ FN + +R RGDGR + +N+     F  +  DI  + LYTRGGP WQ  KIPF+KFFL+S+GR  D QH      +  I  TL DK  GPF LEID+I L  +  + E+F+YE Y
Sbjct:  113 ESLNEWIVSSDQEIGGRSVAYVSLGKNNTTCLLYGTLSSTPPRDGETRYSGYCSMRSKPPKASFDRKKHYDWSSFNTLHLRIRGDGRPWMINVSAETYFSHQRDDIYSYFLYTRGGPYWQDVKIPFSKFFLSSRGRIQDSQHPLWLDKINTIGFTLGDKADGPFQLEIDFIGLNNDCAHTEEFAYELY 300          
BLAST of CIA30 domain-containing protein vs. Ensembl Zebrafish
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:ZFIN;Acc:ZDB-GENE-050306-9])

HSP 1 Score: 135.961 bits (341), Expect = 2.591e-36
Identity = 73/188 (38.83%), Postives = 103/188 (54.79%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E ++ W VS+D+ I G S A         T +  G L +T    G    SG  +++S    + F   + Y+++ FN + +R RGDGR + +N+     F  +  DI  + LYTRGGP WQ  KIPF+KFFL+S+GR  D QH      +  I  TL DK  GPF LEID+I L  +  + E+F+YE Y
Sbjct:  113 ESLNEWIVSSDQEIGGRSVAYVSLGKNNTTCLLYGTLSSTPPRDGETRYSGYCSMRSKPPKASFDRKKHYDWSSFNTLHLRIRGDGRPWMINVSAETYFSHQRDDIYSYFLYTRGGPYWQDVKIPFSKFFLSSRGRIQDSQHPLWLDKINTIGFTLGDKADGPFQLEIDFIGLNNDCAHTEEFAYELY 300          
BLAST of CIA30 domain-containing protein vs. Ensembl Zebrafish
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:ZFIN;Acc:ZDB-GENE-050306-9])

HSP 1 Score: 124.405 bits (311), Expect = 3.911e-32
Identity = 68/173 (39.31%), Postives = 94/173 (54.34%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIAL 863
            E ++ W VS+D+ I G S A         T +  G L +T    G    SG  +++S    + F   + Y+++ FN + +R RGDGR + +N+     F  +  DI  + LYTRGGP WQ  KIPF+KFFL+S+GR  D QH      +  I  TL DK  GPF LEID+I L
Sbjct:  113 ESLNEWIVSSDQEIGGRSVAYVSLGKNNTTCLLYGTLSSTPPRDGETRYSGYCSMRSKPPKASFDRKKHYDWSSFNTLHLRIRGDGRPWMINVSAETYFSHQRDDIYSYFLYTRGGPYWQDVKIPFSKFFLSSRGRIQDSQHPLWLDKINTIGFTLGDKADGPFQLEIDFIGL 285          
BLAST of CIA30 domain-containing protein vs. Ensembl Xenopus
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:NCBI gene;Acc:549907])

HSP 1 Score: 141.354 bits (355), Expect = 2.766e-38
Identity = 73/188 (38.83%), Postives = 106/188 (56.38%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E + +WT+S+D+ I G S  S        T +F G L T +   G    SG   +KS   L  F+    Y++++FN + +R RGDGR + +NI   + F  +  D+  + +YT+GGP WQ  KIPF+KFFL+S+GR  D QH      +  +  TL DK  GPF LEID+I L  +  + E+F+YE Y
Sbjct:  102 EDLDKWTLSSDQEIGGKSQVSLKLGRNNQTALFYGTLNTEVPRDGETRYSGYCTMKSKTPLGAFNRKLHYDWSNFNTLYLRVRGDGRPWMVNIKSDSYFSQQRDDLYNYFIYTQGGPYWQDIKIPFSKFFLSSRGRIQDNQHPLWTDKITAVGFTLGDKANGPFQLEIDFIGLCNDRAHTEEFAYEKY 289          
BLAST of CIA30 domain-containing protein vs. Ensembl Mouse
Match: Ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:MGI Symbol;Acc:MGI:1916952])

HSP 1 Score: 122.479 bits (306), Expect = 4.759e-31
Identity = 64/189 (33.86%), Postives = 101/189 (53.44%), Query Frame = 3
Query:  339 DNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYET 905
            + E + +W V++DKTI G S           + +  G L +     G   +SG   + S      F    +Y+++ FN + +R RGDGR + +NI +   F   +  +  + ++TRGGP WQ  KIPF+KFF +++GR  DVQ       +  I  TL DK+ GPF+LEID+I +  +  + E+F+YE 
Sbjct:  132 EKEDLDKWIVTSDKTIGGRSEIFLKMSKNNRSALLYGTLSSEPPQDGDSRQSGYCAMISRIPRGAFERKLSYDWSQFNTLYLRVRGDGRPWMVNIRQDTEFIQRKNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNQGRVRDVQGPLVLDKISSIGFTLSDKVDGPFFLEIDFIGVFTDPAHTEEFAYEN 320          
BLAST of CIA30 domain-containing protein vs. Ensembl Mouse
Match: Ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:MGI Symbol;Acc:MGI:1916952])

HSP 1 Score: 122.479 bits (306), Expect = 4.768e-31
Identity = 64/189 (33.86%), Postives = 101/189 (53.44%), Query Frame = 3
Query:  339 DNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYET 905
            + E + +W V++DKTI G S           + +  G L +     G   +SG   + S      F    +Y+++ FN + +R RGDGR + +NI +   F   +  +  + ++TRGGP WQ  KIPF+KFF +++GR  DVQ       +  I  TL DK+ GPF+LEID+I +  +  + E+F+YE 
Sbjct:  130 EKEDLDKWIVTSDKTIGGRSEIFLKMSKNNRSALLYGTLSSEPPQDGDSRQSGYCAMISRIPRGAFERKLSYDWSQFNTLYLRVRGDGRPWMVNIRQDTEFIQRKNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNQGRVRDVQGPLVLDKISSIGFTLSDKVDGPFFLEIDFIGVFTDPAHTEEFAYEN 318          
BLAST of CIA30 domain-containing protein vs. Ensembl Mouse
Match: Ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:MGI Symbol;Acc:MGI:1916952])

HSP 1 Score: 122.479 bits (306), Expect = 4.768e-31
Identity = 64/189 (33.86%), Postives = 101/189 (53.44%), Query Frame = 3
Query:  339 DNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYET 905
            + E + +W V++DKTI G S           + +  G L +     G   +SG   + S      F    +Y+++ FN + +R RGDGR + +NI +   F   +  +  + ++TRGGP WQ  KIPF+KFF +++GR  DVQ       +  I  TL DK+ GPF+LEID+I +  +  + E+F+YE 
Sbjct:  130 EKEDLDKWIVTSDKTIGGRSEIFLKMSKNNRSALLYGTLSSEPPQDGDSRQSGYCAMISRIPRGAFERKLSYDWSQFNTLYLRVRGDGRPWMVNIRQDTEFIQRKNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNQGRVRDVQGPLVLDKISSIGFTLSDKVDGPFFLEIDFIGVFTDPAHTEEFAYEN 318          
BLAST of CIA30 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0MQ83|CIA30_GORGO (Complex I intermediate-associated protein 30, mitochondrial OS=Gorilla gorilla gorilla OX=9595 GN=NDUFAF1 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.802e-35
Identity = 69/187 (36.90%), Postives = 103/187 (55.08%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYET 905
            E + +WTV++DKTI G S           + +  G L +     G   RSG   +KS      F    +Y+++ FN + +R RGDGR + +NI +   F      +  + ++TRGGP WQ  KIPF+KFF +++GR  DVQHE     +  I  TL DK+ GPF+LEID+I +  +  + E+F+YE 
Sbjct:  131 EDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMKSRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYEN 317          
BLAST of CIA30 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VAI1|CIA30_DROME (Complex I intermediate-associated protein 30, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CIA30 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.216e-34
Identity = 71/190 (37.37%), Postives = 104/190 (54.74%), Query Frame = 3
Query:  351 ISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQR--ISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETYFT 914
            + +WTV+TD       + + ++    G G+F G + +     G   R+G  N+++      F    TY++  +N ++++ RGDGRSY +N+H    FD    DI  + LYTRGGP WQ  KIPF+KFFL+SKGR  D Q     + V     SV     + GPF LEIDY+ L  +  + E+F+YE Y T
Sbjct:  100 LDKWTVTTDADHGEGKSTATLELSAAGAGLFHGQVNSDHTKDGIIKRTGYANIRTKRVRKSFKRETTYDWTQYNMLVMKVRGDGRSYLINLHTEGYFDLMWNDIYHYVLYTRGGPHWQIAKIPFSKFFLSSKGRVQDRQGAIPLNRVTHFGFSVAAKKGMDGPFGLEIDYVGLEYDPSHREEFAYEMYQT 289          
BLAST of CIA30 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0MQ84|CIA30_PANTR (Complex I intermediate-associated protein 30, mitochondrial OS=Pan troglodytes OX=9598 GN=NDUFAF1 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.221e-34
Identity = 72/208 (34.62%), Postives = 110/208 (52.88%), Query Frame = 3
Query:  291 PVHHL---NCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYET 905
            P+H +     K++  F     E + +WTV++DKTI G S           + +  G L +     G   RSG   + S      F    +Y+++ FN + +R RGDGR + +NI +   F      +  + ++TRGGP WQ  KIPF+KFF +++GR  DVQHE     +  I  TL DK+ GPF+LEID+I +  +  + E+F+YE 
Sbjct:  112 PLHEVLLEQAKVVWQF--RGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYEN 317          
BLAST of CIA30 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q18726|CIA30_CAEEL (Probable complex I intermediate-associated protein 30, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nuaf-1 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.302e-34
Identity = 73/189 (38.62%), Postives = 105/189 (55.56%), Query Frame = 3
Query:  345 EQISRWTVSTDKTI-NGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E++  W +  D     G ST S V + + GT +FSGN+ T ++  G   R+G  ++K  D+ +         + +F+ +L++ RGDGRSY + +H     DF   D    PL+T GGP WQ EKIPF+KFF T  GR  D Q+         I + LMD+I G F LEIDYI +  ++ + E F+YETY
Sbjct:  143 EKLDLWKIGCDSDWKEGFSTCSLV-NSDRGTAVFSGNISTKVLKDGRVERAGWASMKLEDRKAFNRKKFLSKWRNFSHLLLKVRGDGRSYKIMLHSPLSMDFTWGDSFSHPLHTHGGPYWQYEKIPFSKFFHTVAGRIQDRQYRVNLEDTSSIGIVLMDRIDGDFRLEIDYIGVYNDTTHVEDFAYETY 330          
BLAST of CIA30 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y375|CIA30_HUMAN (Complex I intermediate-associated protein 30, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF1 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 2.411e-34
Identity = 72/208 (34.62%), Postives = 110/208 (52.88%), Query Frame = 3
Query:  291 PVHHL---NCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYET 905
            P+H +     K++  F     E + +WTV++DKTI G S           + +  G L +     G   RSG   + S      F    +Y+++ FN + +R RGDGR + +NI +   F      +  + ++TRGGP WQ  KIPF+KFF +++GR  DVQHE     +  I  TL DK+ GPF+LEID+I +  +  + E+F+YE 
Sbjct:  112 PLHEVLLEQAKVVWQF--RGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYEN 317          
BLAST of CIA30 domain-containing protein vs. TrEMBL
Match: V4CHL1 (CIA30 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_95635 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 4.482e-43
Identity = 86/191 (45.03%), Postives = 115/191 (60.21%), Query Frame = 3
Query:  339 DNEQISRWTVSTDK-TINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            D E I +W V++DK  I G+S A F +  E  TG+F G L T  +  G +  +G  N++SP       GF  Y+F  FN +L++ RGDGR+Y L I +   +D + +D+  +PL+TRGGP WQT  IPF+KFFLTSKGR  D Q     S V  I ++  D   GPF+LEID IALL +S    +F YETY
Sbjct:   37 DPETIDKWIVTSDKDNIEGMSKAHF-QFSENKTGVFHGYLNTETVKDGFNRYAGYCNIRSPGNYE--SGFDVYDFDPFNTLLLKVRGDGRNYLLTIGQQKFYDVQNHDLYCYPLHTRGGPYWQTVMIPFSKFFLTSKGRLQDKQEPLNGSRVSNIGISCQDGFDGPFHLEIDSIALLYDSSQISEFDYETY 224          
BLAST of CIA30 domain-containing protein vs. TrEMBL
Match: A0A1D1V081 (CIA30 domain-containing protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_06920-1 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 7.911e-43
Identity = 82/229 (35.81%), Postives = 132/229 (57.64%), Query Frame = 3
Query:  237 YCKLLFESYSSKLKE-----PYMPVHHLNCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            Y +  F+ +  +++E     P   + H + KM+ +F + D E+  +W V+ D       +       +  TG+++GNL+T LI+ G    +G  N+++P K+  F+    YNF +F  ++ + RGDGRSY +N+     FD    D+  +PLYTRGGP WQ E++PF+KFF + KGR  D+Q       +  +S+T  D+I GPF LEIDYIA+  ++ + E+F+YE Y
Sbjct:   74 YYRREFQKFRQEVRETLRQDPLEYLQHGDVKMIFDF-RSDPEKNEQWMVTADSDYGHGKSRGHFHVTDRATGMWTGNLDTRLIEDGYTKAAGYCNLRAPYKMKSFNRDDLYNFTNFTHMIFKVRGDGRSYMINLQTKGHFDVYWNDLYQYPLYTRGGPYWQYERVPFSKFFFSHKGRIQDLQDPIELWRIDTVSITCADQIDGPFQLEIDYIAVEWDANHREEFAYELY 301          
BLAST of CIA30 domain-containing protein vs. TrEMBL
Match: A0A0R3TQ53 (CIA30 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9650 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.314e-40
Identity = 77/161 (47.83%), Postives = 105/161 (65.22%), Query Frame = 3
Query:  429 GTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGF-RTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            G G+F GN+ T + + G  VR+G  +++SP+    F GF + YNF  +  ILIRYRGDGR+Y  NIH    +D   +D+  FPLYTRGGP W   KIP + FF++++G  VD Q    +S V+ IS TL D++ GPF LEIDYIAL  +  +NE+F+YE Y
Sbjct:   36 GYGLFRGNISTRVPERGDLVRAGFAHLRSPEHT--FLGFLQEYNFNPYTHILIRYRGDGRTYKFNIHPKVEWDPFWFDMHQFPLYTRGGPYWSIAKIPLSAFFVSNRGSVVDRQGRISRSQVRMISFTLADRVPGPFALEIDYIALYYDQFHNEKFAYEQY 194          
BLAST of CIA30 domain-containing protein vs. TrEMBL
Match: A0A0R3UEE7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5369 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.725e-39
Identity = 74/158 (46.84%), Postives = 103/158 (65.19%), Query Frame = 3
Query:  435 GIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            G+F G + T + D G  VR+G  +++SP+  + F     YNF  +  ++IRYRGDGR+Y LNIH  + +D   +D+  FPLYTRGGP W   KIPF+ F+L++KG+ VD QH    ++V+ IS TL D+I GPF LEIDYI L  +  + E F+YE Y
Sbjct:   49 GLFRGQISTRVPDRGDLVRAGFAHLRSPEH-THFGFLAEYNFNPYTHLIIRYRGDGRTYRLNIHPRSDWDVFWFDMHQFPLYTRGGPYWTIAKIPFSAFYLSNKGQVVDRQHRLPLTNVRMISFTLADRIPGPFALEIDYIGLYYDMFHKEMFAYEQY 205          
BLAST of CIA30 domain-containing protein vs. TrEMBL
Match: A0A0N0U3Y3 (Putative complex I intermediate-associated protein 30, mitochondrial OS=Melipona quadrifasciata OX=166423 GN=WN51_03562 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.331e-39
Identity = 88/256 (34.38%), Postives = 133/256 (51.95%), Query Frame = 3
Query:  156 PAWFRTLPSTPKE--FYDRLKYSFTIFPKYCKLLFESYSSKLKEP-YMPVHHLNCKMLANFPKMDNEQ--ISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            P  +   P +PK   F  +L+ S+ +     KLL E    +LKE  Y+   +     +    K D  Q  + +W V+ DK  +   + + ++    GTGIF G L+T L   G    +G  N+ S  K   F     YN+ ++N +++R RGDGR Y LNI +  + D ++YD   + +YTRGGP WQ  +IPF+KF   +KG   + Q+    + +    +TL DK  GPF LEIDYI +   +   E+F+YETY
Sbjct:   32 PVIYDKKPESPKNLTFLQQLRNSYNLLKSETKLLLE----ELKEGFYLLPKNFALDEIDTVWKFDGTQKSLDQWIVNCDKDYHHGYSHATLELSSFGTGIFHGILDTRLPKDGKTTHAGYCNITSVQKFKAFGRRDYYNWVNYNELVLRIRGDGRCYMLNILQKGIMDLDQYDCHHYVMYTRGGPYWQVVRIPFSKFVFNTKGMINENQYPVCDAHITNFGITLADKKPGPFRLEIDYIGICANTNIREEFAYETY 283          
BLAST of CIA30 domain-containing protein vs. Ensembl Cavefish
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:NCBI gene;Acc:103039289])

HSP 1 Score: 140.198 bits (352), Expect = 5.157e-38
Identity = 84/227 (37.00%), Postives = 119/227 (52.42%), Query Frame = 3
Query:  234 KYCKLLFESYSSKLKEPYMP--VHHLNCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            K+  LL + +  +L+ P     + H+  + L  +     E + +W VS+DK I G S A         T +  G L +     G    SG   ++S   L  F   R ++++ FN + IR+RGDGR + +NI     F   + DI  + LYTRGGP WQ  KIPF+KFFL+S+GR  D QH      V  I  TL DK  GPF LEID+IAL  +  + E+F+YE +
Sbjct:   71 KHFGLLKDEFVGRLRGPEGRPLLDHMLEQTLVQWEFRGPESLDQWVVSSDKEIGGQSEAYLKLGKNNTTCMLYGTLCSVPPRDGETRYSGYCTLRSKQTLLSFDRKRHFDWSTFNTLYIRFRGDGRPWMINISAEMYFSHNKNDIYSYFLYTRGGPYWQEVKIPFSKFFLSSRGRIQDDQHCLWLDKVNNIGFTLGDKADGPFQLEIDFIALCIDRAHTEEFAYEKF 297          
BLAST of CIA30 domain-containing protein vs. Ensembl Cavefish
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:NCBI gene;Acc:103039289])

HSP 1 Score: 140.198 bits (352), Expect = 5.157e-38
Identity = 84/227 (37.00%), Postives = 119/227 (52.42%), Query Frame = 3
Query:  234 KYCKLLFESYSSKLKEPYMP--VHHLNCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            K+  LL + +  +L+ P     + H+  + L  +     E + +W VS+DK I G S A         T +  G L +     G    SG   ++S   L  F   R ++++ FN + IR+RGDGR + +NI     F   + DI  + LYTRGGP WQ  KIPF+KFFL+S+GR  D QH      V  I  TL DK  GPF LEID+IAL  +  + E+F+YE +
Sbjct:   71 KHFGLLKDEFVGRLRGPEGRPLLDHMLEQTLVQWEFRGPESLDQWVVSSDKEIGGQSEAYLKLGKNNTTCMLYGTLCSVPPRDGETRYSGYCTLRSKQTLLSFDRKRHFDWSTFNTLYIRFRGDGRPWMINISAEMYFSHNKNDIYSYFLYTRGGPYWQEVKIPFSKFFLSSRGRIQDDQHCLWLDKVNNIGFTLGDKADGPFQLEIDFIALCIDRAHTEEFAYEKF 297          
BLAST of CIA30 domain-containing protein vs. Ensembl Cavefish
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:NCBI gene;Acc:103039289])

HSP 1 Score: 103.605 bits (257), Expect = 8.469e-25
Identity = 65/197 (32.99%), Postives = 101/197 (51.27%), Query Frame = 3
Query:  198 YDRLKYSFTI----FPKYCKLLFESYSSKLKEPYMP--VHHLNCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQH 770
            ++++++ F+       K+  LL + +  +L+ P     + H+  + L  +     E + +W VS+DK I G S A         T +  G L +     G    SG   ++S   L  F   R ++++ FN + IR+RGDGR + +NI     F   + DI  + LYTRGGP WQ  KIPF+KFFL+S+GR  D QH
Sbjct:   55 WEKIRFDFSKGVEGIQKHFGLLKDEFVGRLRGPEGRPLLDHMLEQTLVQWEFRGPESLDQWVVSSDKEIGGQSEAYLKLGKNNTTCMLYGTLCSVPPRDGETRYSGYCTLRSKQTLLSFDRKRHFDWSTFNTLYIRFRGDGRPWMINISAEMYFSHNKNDIYSYFLYTRGGPYWQEVKIPFSKFFLSSRGRIQDDQH 251          
BLAST of CIA30 domain-containing protein vs. Ensembl Sea Lamprey
Match: ndufaf1 (NADH:ubiquinone oxidoreductase complex assembly factor 1 [Source:ZFIN;Acc:ZDB-GENE-050306-9])

HSP 1 Score: 129.413 bits (324), Expect = 1.058e-34
Identity = 67/188 (35.64%), Postives = 103/188 (54.79%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E +  W VS+D  + G S +         T +F G L+  +   G    SG   ++S  +    +  + +++ D N + +R RGDGR Y +NI     +   + D+  + L+TRGGP WQ  KIPF+KFFL S+GR  DVQH      V  +  TL ++  GPF LEID+I + ++  ++E+F+YETY
Sbjct:  113 ECLEDWLVSSDAEMGGRSRSFLSLSKNNKTLLFHGELDNYIPRDGKTKYSGYCTLRSKPRKGFMNKKKAFDWGDMNVLFLRVRGDGRPYMINISVDNYYTHMQNDLYHYFLFTRGGPTWQDVKIPFSKFFLASRGRINDVQHPIWTDRVGTLGFTLGEQADGPFQLEIDFIGVYKDPAHSEEFAYETY 300          
BLAST of CIA30 domain-containing protein vs. Ensembl Nematostella
Match: EDO40199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7X8])

HSP 1 Score: 114.775 bits (286), Expect = 3.474e-30
Identity = 69/184 (37.50%), Postives = 100/184 (54.35%), Query Frame = 3
Query:  315 MLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALL 866
            ML +F K   E + +W   TDK   GLSTA FV   + G  +F GNL T L        +G+  V+S  ++        Y+ ++++ I +R RGDGR+YALNI   ++      D+    +YTRGGP W+T ++PF+KF LT+ G   D  H+     ++   +TL D   GPF LEIDYI  +
Sbjct:    1 MLWDFKK--KETMDKWVTITDKQFGGLSTAEFVPS-KSGKAVFRGNLSTKLPKESEAKHTGVCAVRSQPQVDWKGRVVPYDTSEYDGIQMRIRGDGRTYALNIQPDSV---RSDDLHQAFMYTRGGPYWETIRMPFSKFILTNSGYLQD--HQMDIPRMRTFGITLADNNDGPFSLEIDYIKAV 176          
BLAST of CIA30 domain-containing protein vs. Ensembl Medaka
Match: ndufaf1 (complex I intermediate-associated protein 30, mitochondrial-like [Source:NCBI gene;Acc:111946835])

HSP 1 Score: 125.561 bits (314), Expect = 1.340e-32
Identity = 70/192 (36.46%), Postives = 102/192 (53.12%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEK----IPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E + +WT+S+D+ I G S           T +  G L +T    G    SG    +S   L+ F   + ++++ FN + +R RGDGR + +NI     F  ++ DI  + +YTRGGP WQ  K    IPF+KFFLT +GR  D QH      +  I  TL D   GPF LEID+I + ++  + E+F+YE Y
Sbjct:  107 ESLQQWTLSSDREIGGQSEIYMELGRNSTTCLLYGTLCSTPPRDGETRYSGYCTARSKQPLASFDRKKHHDWSSFNCLHLRIRGDGRPWMVNIATETYFSHQKDDIYNYFMYTRGGPYWQDVKASGIIPFSKFFLTHRGRIQDDQHPLWLDKINTIGFTLGDNADGPFQLEIDFIGVCKDYAHTEEFAYEKY 298          
BLAST of CIA30 domain-containing protein vs. Ensembl Medaka
Match: ndufaf1 (complex I intermediate-associated protein 30, mitochondrial [Source:NCBI gene;Acc:101170556])

HSP 1 Score: 124.405 bits (311), Expect = 4.198e-32
Identity = 69/192 (35.94%), Postives = 102/192 (53.12%), Query Frame = 3
Query:  345 EQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEK----IPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETY 908
            E + +WT+S+D+ I G S           + +  G L +T    G    SG    +S   L+ F   + ++++ FN + +R RGDGR + +NI     F  ++ DI  + +YTRGGP WQ  K    IPF+KFFLT +GR  D QH      +  I  TL D   GPF LEID+I + ++  + E+F+YE Y
Sbjct:  107 ESLQQWTLSSDREIGGQSEIYMELGRNSTSCLLYGTLCSTPPRDGETRYSGYCTARSKQPLASFDRKKHHDWSSFNCLHLRIRGDGRPWMVNIATETYFSHQKDDIYNYFMYTRGGPYWQDVKASGIIPFSKFFLTHRGRIQDDQHPLWLDKINTIGFTLGDNADGPFQLEIDFIGVCKDYAHTEEFAYEKY 298          
BLAST of CIA30 domain-containing protein vs. Planmine SMEST
Match: SMESG000077270.1 (SMESG000077270.1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 284/288 (98.61%), Postives = 285/288 (98.96%), Query Frame = 3
Query:   75 MALSTRINKKIFKSPIITHSKRTFDRDPAWFRTLPSTPKEFYDRLKYSFTIFPKYCKLLFESYSSKLKEPYMPVHHLNCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETYFTSMKGQRFK 938
            MALSTRINK  FKSPIITHSKRTFDRDPAWFRTLPSTPKEFYDRLKYSFTIFPKYCKLLFESYSSKLKEPYMPVHHLNCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPE GTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGF+TYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETYFTSMKGQRFK
Sbjct:    1 MALSTRINKNFFKSPIITHSKRTFDRDPAWFRTLPSTPKEFYDRLKYSFTIFPKYCKLLFESYSSKLKEPYMPVHHLNCKMLANFPKMDNEQISRWTVSTDKTINGLSTASFVKHPERGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDKLSLFHGFQTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFPLYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKITGPFYLEIDYIALLRESGYNEQFSYETYFTSMKGQRFK 288          
The following BLAST results are available for this feature:
BLAST of CIA30 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NDUFAF15.021e-3534.62NADH:ubiquinone oxidoreductase complex assembly fa... [more]
NDUFAF12.851e-1228.67NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nuaf-11.810e-3538.62Probable complex I intermediate-associated protein... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CIA301.213e-3537.37gene:FBgn0039689 transcript:FBtr0085473[more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ndufaf12.591e-3638.83NADH:ubiquinone oxidoreductase complex assembly fa... [more]
ndufaf12.591e-3638.83NADH:ubiquinone oxidoreductase complex assembly fa... [more]
ndufaf13.911e-3239.31NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufaf12.766e-3838.83NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ndufaf14.759e-3133.86NADH:ubiquinone oxidoreductase complex assembly fa... [more]
Ndufaf14.768e-3133.86NADH:ubiquinone oxidoreductase complex assembly fa... [more]
Ndufaf14.768e-3133.86NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of CIA30 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0MQ83|CIA30_GORGO3.802e-3536.90Complex I intermediate-associated protein 30, mito... [more]
sp|Q9VAI1|CIA30_DROME1.216e-3437.37Complex I intermediate-associated protein 30, mito... [more]
sp|Q0MQ84|CIA30_PANTR2.221e-3434.62Complex I intermediate-associated protein 30, mito... [more]
sp|Q18726|CIA30_CAEEL2.302e-3438.62Probable complex I intermediate-associated protein... [more]
sp|Q9Y375|CIA30_HUMAN2.411e-3434.62Complex I intermediate-associated protein 30, mito... [more]
back to top
BLAST of CIA30 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4CHL14.482e-4345.03CIA30 domain-containing protein (Fragment) OS=Lott... [more]
A0A1D1V0817.911e-4335.81CIA30 domain-containing protein OS=Ramazzottius va... [more]
A0A0R3TQ531.314e-4047.83CIA30 domain-containing protein OS=Rodentolepis na... [more]
A0A0R3UEE72.725e-3946.84Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0N0U3Y33.331e-3934.38Putative complex I intermediate-associated protein... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ndufaf15.157e-3837.00NADH:ubiquinone oxidoreductase complex assembly fa... [more]
ndufaf15.157e-3837.00NADH:ubiquinone oxidoreductase complex assembly fa... [more]
ndufaf18.469e-2532.99NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufaf11.058e-3435.64NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO401993.474e-3037.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ndufaf11.340e-3236.46complex I intermediate-associated protein 30, mito... [more]
ndufaf14.198e-3235.94complex I intermediate-associated protein 30, mito... [more]
back to top
BLAST of CIA30 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077270.10.000e+098.61SMESG000077270.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029806 ID=SMED30029806|Name=CIA30 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
TTTATTAAATAAGATATTTTGTTAATTAAATAAATCATTAAGATAATTCA
AAGTAAATATTTGTATAGAGTAACATGGCTTTAAGCACAAGAATTAACAA
AAAAATTTTTAAATCTCCAATTATTACACATTCTAAACGAACATTTGACC
GAGATCCAGCGTGGTTTAGAACTTTACCATCAACTCCTAAAGAATTTTAT
GATCGCTTAAAATATTCTTTTACTATTTTCCCAAAATATTGTAAACTGCT
ATTTGAAAGTTATTCGAGTAAATTGAAAGAACCATATATGCCGGTTCATC
ATTTAAATTGTAAAATGCTAGCAAATTTCCCTAAAATGGATAATGAACAG
ATTTCCCGATGGACAGTATCAACAGATAAAACAATTAATGGATTGAGCAC
AGCTTCTTTCGTAAAACATCCTGAACTTGGAACAGGGATTTTTTCCGGTA
ATCTCGAAACAACTCTCATTGACAGTGGAACTGATGTTCGAAGTGGAATG
GTTAATGTAAAATCCCCTGATAAACTTTCCCTGTTTCATGGATTTCGAAC
TTACAATTTCGCCGACTTTAATTTCATTTTAATCAGATATCGCGGCGACG
GACGATCTTATGCTTTAAATATTCATAAATTAGCGATGTTTGATTTTGAG
GAATATGATATCAGCATGTTCCCTTTATATACTCGTGGTGGACCTTTATG
GCAAACAGAAAAGATACCATTTAATAAATTTTTTTTAACTTCTAAAGGAC
GCCATGTAGATGTACAGCATGAATTTCGTAAATCCAGCGTTCAGCGTATT
TCGGTGACTTTAATGGATAAAATAACGGGTCCGTTTTATTTGGAAATTGA
TTATATTGCACTTCTACGAGAATCTGGCTACAATGAACAATTTTCCTATG
AAACTTATTTCACATCCATGAAGGGGCAAAGATTCAAATAGTATCTTATT
ATTCTATATTTGTTTTTGTGTTAGTTGGGTTTTTGTTTAAATACTGTTTG
CTAGATTATTCTGTGATATTATTTTTGGCGGTTGCCATGGTGCAAGGGTA
TTTGCTCACTGGAATATTCCGTTCAAGGCATTTAAAATTTTGCTATTGTA
TTCATACGAAAGAGTAAGTGTGATCTAAATAGGTTTTTATCATACTAGTT
GTGGAGAAATGAGGATCTGGAGTAAGTGGATTTGTGTCGACTTTAAGGAG
ATAGAGAGATACTTTCGGTTTGAAATGATTACGTTAATATTCATACGTAT
TATATTTCT
back to top

protein sequence of SMED30029806-orf-1

>SMED30029806-orf-1 ID=SMED30029806-orf-1|Name=SMED30029806-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=289bp
MALSTRINKKIFKSPIITHSKRTFDRDPAWFRTLPSTPKEFYDRLKYSFT
IFPKYCKLLFESYSSKLKEPYMPVHHLNCKMLANFPKMDNEQISRWTVST
DKTINGLSTASFVKHPELGTGIFSGNLETTLIDSGTDVRSGMVNVKSPDK
LSLFHGFRTYNFADFNFILIRYRGDGRSYALNIHKLAMFDFEEYDISMFP
LYTRGGPLWQTEKIPFNKFFLTSKGRHVDVQHEFRKSSVQRISVTLMDKI
TGPFYLEIDYIALLRESGYNEQFSYETYFTSMKGQRFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032981mitochondrial respiratory chain complex I assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039131NDUFAF1
IPR013857NADH-UbQ_OxRdtase-assoc_prot30
IPR008979Galactose-bd-like_sf
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013857NADH:ubiquinone oxidoreductase intermediate-associated protein 30PFAMPF08547CIA30coord: 90..258
e-value: 9.7E-32
score: 110.2
NoneNo IPR availablePANTHERPTHR13194:SF18COMPLEX I INTERMEDIATE-ASSOCIATED PROTEIN 30, MITOCHONDRIALcoord: 76..278
IPR039131Complex I intermediate-associated protein 30, mitochondrialPANTHERPTHR13194COMPLEX I INTERMEDIATE-ASSOCIATED PROTEIN 30coord: 76..278
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 81..261